4P5MA

Structural basis of chronic beryllium disease: bridging the gap between allergic hypersensitivity and autoimmunity
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
180
structure length
180
Chain Sequence
IKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
molecule tags Immune system
source organism Homo sapiens
total genus 36
structure length 180
sequence length 180
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p5mA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p5mA01
4G7VH 2IMNA 4OCYL 1QHPA 3H0TA 4LU5L 2JKXA 4QHKI 1LEKA 5DJYB 2IPKB 2W65B 1TZIA 2CO7B 4WHTA 5EU5B 2HWZH 4XBGB 3BH8B 4YHZH 3I2CH 4LDLB 1VADB 3RGVD 4U1NB 4EZMA 2A6KA 4P5MB 4U1KB 4GBXA 3QDAA 5E1AA 5KSVA 4O2EB 3U36A 3ZE1F 5DMIL 3GJEA 4HQQH 2Z8SA 4ETYA 3QEHB 3BEVB 3IRZA 2QSVA 4U49A 3NCFB 4NM8L 2X4PB 2JJWA 3GIVA 4HXAH 3VXTA 4P2RA 4D9LH 2ZCHH 5A2IH 2R29L 1F97A 1QACA 2FIRT 3VD9A 1CTOA 5FV2A 4KRPC 3QAZC 4XPTL 4K8RL 1UH3A 4GW5B 1WAAE 2FX8L 4PJ7F 4ACPA 5IFHH 5CD3A 5ISZB 3ARFC 3A6CH 3IDYC 3GSWB 2BY0A 3V0WH 2FEEI 2XZAH 5CMAA 3ZLQC 2Z8VC 5B4MC 4QNPE 1F6AB 3X13B 4P9HC 3MRPB 5HHXL 2VR4A 2W0FA 1NEZA 3MACL 2Z0BA 4Q9BA 4W6YB 4PLJC 1CDIA 4NM4H 4RGMB 1CS6A 1F6LL 1MLCB 1IC5L 3NBNA 2ADJA 3MXWH 1PX4A 4MJ4A 1CDCA 4G43B 4TRPL 1T0MB 1P4LB 4PB9L 1T1ZB 3BKCL 3S5LG 1NCAH 2YN3A 2QR0A 2DI9A 4NZUL 1OWWA 2YZ1A 1KENH 4LLYB 4CGTA 4AIZA 3L3OB 4ZG1A 1Z0MA 2WINA 1F11A 2NXZC 4FTVD 2P5ED 3MV8E 5ADOL 4JDVB 3IF1A 3QDGE 1JHLL 5HYFA 1UXSA 1OAXH 5FUOL 4Z95L 4OF5A 4KRPD 3TGXA 4NO5B 3HZVB 2OR9H 4YHOH 4U6TA 3VRIA 4PJBB 2V7HB 4XNQA 2JELL 3I02A 2WMPA 3MJ9H 1FIGL 3RZWA 4NCC2 3ROLA 3QNZB 1C5BL 4OLZH 5B4MD 4U6YB 4HGWA 2KPNA 1INDH 4XMKH 4GAGL 4L4VB 3P73A 4NKIL 1HE7A 4QRRB 1KJVA 4PLJD 4Y1AB 4MVBC 3GSVB 4OCWH 4N1EA 3BKJL 3G5YB 5I8KL 4Z9KB 3TT1H 1NC4B 5K9QI 2XKSA 3CGTA 5D6CA 1R3KA 3T0EE 4H20H 3U4EA 3W9EB 2R2BB 1DBML 3P0GB 3I50L 3HR6A 5MEPB 1K4DB 3QR2A 4LASL 2XZCL 1HZHH 2VB5A 2FYYB 2R9HC 3RY4A 3O41B 5F88A 1NJ9A 1NCDH 1T0NB 5JLZB 4IRSC 2DBJA 1OD7A 2DJUA 5IMOB 3H9ZA 3MXVH 1YEGL 4PJDF 2HTLC 1PDKA 1J0YA 4HBCL 3W0WA 1Q9OA 5D1ZC 4QYOA 5IOPB 4Y5XA 3WFHB 1T7WA 1TNNA 1KACB 2DM4A 4LVNB 4OQTL 4JFOA 5E4EB 3MGOB 3RNQB 5HYSA 1JYNA 3K1KC 1J05B 4MVBD 3S97C 3KLDA 4BUHA 4OCNC 1A9EB 2BCKA 1ZGLM 1CVSC 1OGTB 2YPKB 5CINL 4KI5C 1EFXB 3MGTA 2IANB 3DPBA 3EYVA 3LN4A 4DZBA 2LAAA 4S2SA 1I9IL 4TUOA 3PIQB 4I18B 5HVGB 2EIDA 1I7ZA 3WL9A 1QFWM 4FZ8L 5ID1A 4XVTL 2R9HD 3MRCA 5GRVK 3VMPA 1K4CB 1P4BL 1BVZA 1ETZA 4IRSD 3V0VB 3KPQB 1SVZA 3JBG7 1CT8A 1I85C 5BVPH 4F2MB 3HCVB 2HTLD 2YK1H 4DTGH 5FOJA 5IV2A 5TF1L 1S9XA 3GM8A 1BD2D 1MIEL 3D85D 1KPRA 4HH8A 5D1ZD 5DTFB 1TZIB 1REIA 2EDYA 4XP1H 3HPJB 1WT5A 3BH9A 4APQA 4CJ0A 5JUEH 1RZ8B 4LCCC 3IDIA 3IXTA 3ARBA 3VXUA 2V5RA 1FP5A 5DR5H 3UEZA 4LRIA 4AM0B 5JW4R 1N3NB 5J9PB 1IGJA 4LRNH 5E1HB 4IRZL 4WWKC 4I2XA 5GSVA 4LLUA 4KI5D 1M7IA 5LQBL 3VE0A 4JZJC 1U9KA 5DJCA 1EXUB 5D7LB 3S88L 3GMLA 1I1CA 4YBQC 4FXGA 3WN5C 1T3FA 4KK6D 3UZQA 2RFXA 4KKAC 4YHPB 3IDMB 2X4OA 4F58H 4XNXH 3OAUL 2VDPL 5E2WH 4Z7QE 4LSDA 4OBSA 4QRTB 5L0QC 4V2BA 4TUJB 1FO0L 4NDMB 1YYLL 4RFEB 4HSQA 2BFVL 5GGTH 2BMKA 4JRXA 3HZMB 1XF3B 1C7SA 4LPWA 3IXAB 5CP7A 4TSBL 1NEZB 1W8NA 1IAIL 4P23B 4U31A 3THML 1M05A 2B39A 3BP6B 4P4RA 5TFSL 1A02N 4OZIE 5EUOE 1E4XI 4X83A 5IROA 5IFAL 2ATPA 5BOPA 3IYLW 2X41A 4FQHB 4GQPH 4KPHL 5DEGA 2DKMA 3C6SB 5DDHB 2X9WA 1NLBL 1UC6A 2OSLA 3VD4A 2B1AL 5LJYH 3GSOA 3WUWA 1RIHL 4ZSOE 1KTDA 4NM8H 4WWKD 1A6UH 4RX4D 5DVLA 4NQCD 1EHAA 2R29H 3RNKB 1F11B 4DEPB 2FH8A 3IU3B 5DHXB 1DEEA 4OD1L 2FX8H 3GSUA 3QWOB 4HK3J 1WEJL 2DQCL 5CIPB 5DO2D 2WBWB 5HGDA 4XGZB 2IH1B 4KKAD 3VXSB 5A43C 5D7KD 2DQHL 7FABH 3V4UL 5FB8A 3S35X 3LMJH 4P4KA 3EZ8A 4LKCA 3RWGA 3QFJB 3L3KA 3ES6B 1FFNB 3QIUB 2VZVA 5BZWB 3LCYA 5HHXH 1PY4A 1IGTB 4GG6F 3MACH 5HHNB 4HGKC 3OAZK 2MNUA 3BZFA 2I07B 3KPRE 4HS6A 5AYUL 3STLB 2O5XL 2ZOLB 3BPOB 1IAKB 2BZDA 4FNLL 4QTIL 4K7PY 4PB9H 4L8CB 1MCRA 3O3DB 4NZUH 1F90H 1OLZA 1XGTB 5GPRA 3IVKA 1W2KT 4MJID 3T3PF 5C09D 3U6RA 3NPSC 3DX9B 5HSFA 2BHZA 5FDWB 3H7LA 1IGMH 3NABH 4TULH 1JHLH 4OFVA 1ZKAA 4Z95H 4YX2H 3IDJB 5I71B 1A4JA 1HSAA 2FJGB 1DQDL 3KXFB 5DGRA 5I1KL 1YC8A 1EBPA 1NBZB 1WLHA 32C2B 4HXBH 5HPOA 4IOFC 4QGTA 3EAKA 1FH5H 1FIGH 4TSAL 3VFSA 4H0IA 1OPGL 2Y25A 2RBLA 1C5BH 4HKBB 4XCYA 4YE4L 2ZKHH 1JRHI 3TO4C 3VXMA 3UJTL 1EZVY 3IU4L 3FMGL 1EJOH 3UTZB 1M7XA 2ATKA 3HPLA 3SDXF 5JOEA 5DS8B 4R26H 3BKJH 4BYHA 1QFHA 5IR1B 3ULUF 1D6VH 2I60L 5GGSY 1V3LA 2ZSWB 2BCKB 4OKVB 1D5IL 2FATL 4HS8L 4AEIL 1NSNL 3V7AE 1IZJA 3OWEA 2AJVH 3QWRD 5F89B 5J89A 3I50H 1S78C 4ENED 2F8XC 4TUOB 3GMOA 5IJKC 3GO1L 4LASH 4RFNB 3U4BL 4C83B 1EEUA 3D25A 1EO7A 5E2VL 1MHHB 4HIJA 3DX7A 4WU5B 1JNJA 1LDSA 2YOCA 2F53D 3NCYP 1X6LA 4GW1A 4WENB 3VGHA 4GH7B 3LPWA 4IOFD 5C08E 2UZIL 3UTSE 4E42B 1JNHA 5HI5C 3QDMD 1YEGH 4UTAH 4JANA 1FZJA 3TBYB 4HBCH 3MRGB 3QAZB 2XKNA 4MA3A 4AIOA 3EYOA 5IV2B 1JNLL 2VUOA 4MNHA 1DBAH 3P0YL 3ARFB 3OKNA 5I16B 3BO8A 4PJ8A 5F9JA 1U8KA 4CUCA 1WBZB 1AGBA 4P5TC 4PJ5B 5CCKH 4OF7A 2JJSA 3EOAB 4RMRA 4Z7VF 2FBJL 1N0LA 5CINH 5FECA 2PCPB 3S3SA 3VFVB 5C0FA 1Q38A 2HJLA 2P45B 5FGBA 1I9IH 4JDZA 4LIQH 5MENB 1OSZA 1NGPL 3TV3L 3RVTC 3G6JF 5SWZA 5CEXA 1Q72H 1NCBH 2K9UA 2XA3A 5FXCH 1XF4A 1LO0L 3CFKB 5JPMA 3QA3A 2GIYA 2DQDL 5HHQA 4YPJA 1K2DB 2PTTB 1FYTE 35C8H 4L8SB 4P3DB 1MLBA 2NXZB 4K9EL 1AY1L 2FX7L 5HI5D 2APTA 2OTWA 1F3DH 4FQCL 2H26A 4YC2C 1WICA 4R3SB 1HHJB 2B0SH 3FO9A 3GSQA 4ZUWB 4HG4J 4H8WH 1KJ2A 3KYKL 2A9NH 1YNKL 5E8NA 2MSPA 3MROB 1KLUB 4P5TD 2QHLA 5EUKB 5IKCB 3O4LB 2J6EL 3WUWB 2AV1A 3JTSB 4Q7DA 5I8OH 2H1PL 4UINL 3DVGB 1AQDB 3T77A 3AGVA 2IGFL 3CH8A 1RD6A 1KCRL 3TCLA 3EUUA 4HWUA 3WXWL 5IF0A 3GSUB 3U0PA 3T0EC 3GKWH 1Z2KA 1FFPB 1ZHLB 5HGDB 3RVTD 3WIHL 1QBML 1A2YB 1A6WL 1LEGB 3MLXL 3L3HA 4MX7A 3ARZA 3QHZL 3LY6A 3FO0H 3AREB 3X17A 1IEHA 3RWCA 1X9QA 1ZV5A 3KYAA 1YYLH 3MV8D 3KWWB 3U7WL 2BFVH 3QDGD 4RFOL 4L29A 3C8HA 2DB8A 1XIWA 1E6JL 4D0BA 5BRZE 3K2MC 2D7OA 3RUGF 3LDBB 4EDXA 1IAIH 1AGFB 1UACL 2Z9TA 1OLLA 5F70A 5A1AA 4J7RA 3MRDB 4YUEL 2DOCA 2VQ1A 3VWJA 3IFOB 2HFEB 5I17B 4KPHH 1MAMH 4URTB 5DEFA 1F42A 2OTUA 1IFHL 3WIIL 1NLBH 2CR3A 2PO6C 2VSDA 3MLWH 2Y5EA 5C9JA 4U3XA 3GZKA 5FYLH 1CL7I 4Y2DC 3MUGA 4MQXC 4GKNA 3PE9A 1T66C 3KYOB 5EZJB 3S34L 5IBUG 1GGCL 5CJQL 1ULVA 4DKEL 2HTKD 1I8MB 3MRIA 4B53A 1YMHA 4OD1H 1F4YL 2DQCH 1ITBB 2PYEA 4C56B 2YWYA 1YEFH 5I1AB 5KS9F 3T0ED 2HH0L 3V4UH 4YFLF 3HZYB 2D9CA 4EUPH 3CUPA 1KBGH 5KTEL 4DK6A 2Z35A 3PV7A 3LQAC 1LMKA 1HNGA 2OX5A 2O5YH 2H32H 1Q9WB 5HY9A 2HFFB 2ADGB 3BZ4B 2J4WH 1I9EA 3IDNA 4ZYKB 5IQ9A 1UM6L 2X70A 3B9KB 3VH8A 4NPYB 3O3AB 3TJEH 3VG9C 4LK4A 2ATKB 5DK3A 2O5XH 5AYUH 4MJ5A 1KCUL 2P8PA 4QO1A 3TIEB 4Y8AA 4XHQA 5IUSA 1XGRA 4YPGA 2VL5B 4JZNA 5IT2H 4FS0A 4DN4H 3T8XB 4M5ZH 4X5XB 3SCMC 3PGFL 2PO6D 3L3GB 1EGJH 5EU3B 4QHLB 4NBXB 1G6VK 2X4RB 4Y2DD 4MQXD 3S5LB 2AQ1A 3SJVE 1T66D 2OTPA 3T2PA 4XHJD 4LPYA 2CLRB 1DSFL 2FLBT 4PLOB 1DQDH 4PJCB 3CCHA 2VLME 4Y4HC 4NQEE 4HPOH 4O58L 5EDXA 4PLNC 4PJHF 3C8KA 4TSAH 1QSEE 1Z0NA 4F8QA 3F62A 4QGYA 4KJQD 3FQRA 3U83A 3G5ZB 4PS4L 4MJ6B 4Z6AT 3UBXI 3IU4H 5I1CL 2VSCA 3FMGH 1VEPA 3MCLH 1U8KB 3KNBA 5J4MA 1ZMYA 1MJ8L 4WGWB 3FCTB 3T2QA 5FYKE 4M8QA 1RURH 2EH7L 1TVBB 3IAQA 3WFZA 2J88L 4HS8H 3A67L 3DSFH 5IW1A 2UWEB 4UBDC 3EJYD 4QRPA 5L7XH 3VGDA 4ODVL 3SE3A 1X5JA 2JJUA 3MX0A 1FGNL 2AEIT 4CN1A 3QH3B 3I3EA 4P46A 2QV2A 1OGAA 5JPMB 4KC3B 3REVB 4M3JA 4N0UB 1IEBB 2DIBA 1GJIA 4Y4HD 2UZIH 3BKMH 4Y19E 3RDTA 1IE5A 4U0RB 2Q20A 4W4OA 4I48A 4YFDB 1YEDB 2F74A 3QUMA 3TBSB 5AG8A 2VRAA 1RJLB 4JHWL 1JNLH 3PGCA 5I76A 1OM3H 1N5AA 1Y0LA 2VZ1A 2G9HB 3BWUC 1ZOXA 4C58B 5L6YL 2XIDA 2AK4B 4PJGB 1CGXA 1R5VB 4XWGL 4CDGC 1FYHB 5EORL 5IHBA 1KT2A 1DLHA 4Y16B 5EPMB 2X05A 5I1IH 5T1MB 3JV0A 2Z8RA 2VMFA 4LCWD 4YNYB 4UBDD 3MBEA 2OZ4H 1DUZB 2HVKB 1BGXH 5DMKB 5EBLB 1YPZE 4XZUB 4RDQG 3VFGL 4QT5A 4K23L 5IHZA 3CMGA 3AVEA 4UOW0 1D5BB 4QXTA 3WS6C 4R7NB 1LO0H 5C6WH 1SEBA 3DV6A 3GB7B 4NWUH 4HWEL 3T04D 4O2CB 3V6FB 5GISL 3NPSB 1P84K 1AIFB 3GMQA 2PW1B 4ZO7A 4L29B 4FQCH 5KJRH 4JJ5A 3B2VH 4ZUTB 1CE6B 1ZVHA 4EJ1C 3UPRA 1N2RA 3GEWB 3MLTA 2FIKA 4Y8DC 1UQSB 3VWJB 1ND0A 3SKJL 1CD8A 2DS4A 5CJXC 1QOKA 4U1LB 3GMRA 1W72A 4UT6H 2J6EH 2Y4SA 3N1MC 1HILB 2XNAB 5DT1H 5AZEL 1JPTL 4BM7A 1NUDA 5J0BA 3S9DB 4NKQB 3CSBA 3KPRD 2W9DL 2IGFH 4WIQA 5DJ0B 4HF5H 4N9GA 5F3HA 3FFCB 4ZPTB 1KCRH 5D93C 3S98A 3KPPB 2R4RH 5JQ6L 3DMMC 4LGPB 4LLVA 2VWEE 4K7FB 4P49A 5DD1L 5FAAA 3PQYA 4CU8A 1QLEL 4KKBC 2EEDA 5ADPH 5E99H 3EJZC 2RCSL 1X44A 3NN8B 1SY6L 2H3NA 2V2TB 3PL6B 2Z35B 4AY0A 4E41E 4HS3B 2CJUL 1P7KA 2BHUA 1E6JH 5HY9B 1K3ZA 3SY0A 3TPKA 4HUVA 2PYFB 2L0DA 5A16A 5IQ9B 5DC4B 4CRPA 3WIFA 3QI9C 4YUEH 4S1QH 2EC9U 4ELKB 2XYCA 4FXKA 4GMSL 3ZYJA 1DBJL 1FNEA 3GMPA 5KW9L 1BQHG 1VGKA 5I2IB 2CLZB 4PRIB 3FFDB 4CVXA 4CADA 2J8HA 1CFQB 4NP4L 3DYMA 5DURB 5CJQH 4JM2B 5IMLB 3VFPA 5ACZB 3QXDA 3X14A 5D7SL 2HJFA 2VO5A 1WIOA 5GRYA 4XC3L 4XBEL 4F37F 5HDOA 2GI7A 4JKMA 4Q9QH 1GPOL 4WI6A 4HIEB 5T3ZL 4KKBD 2X4TB 5F9OL 3EJZD 1UCTA 1V7MH 3CXDH 3K3QA 1IM9D 1I8KA 3TBWA 1QEWA 4PP1C 5HHPA 3C60A 3FQRB 3AS3A 1XGQA 4D3CL 4MQ7B 2A83A 3G5XB 5TH2A 2DI7A 2NY4C 3OB8A 4IHOA 2LABA 3ZDXE 1KOAA 1BFOB 1RZIA 1NFDF 5HDQH 4JFDE 5C08D 1KCUH 4AQOA 5JHDB 1EPFA 3QI9D 3UTSD 5FK9A 2MFNA 5AUMB 3CK0H 4S1DC 4MQTB 1C12B 4X4XA 4NZRH 2GTZB 3EO0A 4BFBD 3PGFH 4QRPB 4GW4B 1I9RL 5FO7A 1B4JH 5EU6A 3PJSA 4NQXB 1N6QH 4J6RL 5F1IA 1NAMA 3OKLA 4PGZA 1H15A 4FHBD 5JORB 1CR9L 5KZCB 2YRZA 1DSFH 1OGAB 4JHAL 1BHGA 4BZ2L 4O58H 4QOKB 1MOEA 2KQMA 1XCTB 1QSVA 2XG5A 2GJZA 5EO1B 3SDYL 5HHMB 3RX5A 3GK8H 2F58H 2ZP0T 1LHZA 4KXZI 4PS4H 4UAOB 4UNTA 1JMZA 2IG2L 4PP1D 5E9DE 5CEYB 1R3LA 3VGGA 5H94A 4NQSA 1QRNB 3LN5A 2NY4D 3NIFE 5TDNB 1FYTD 1MJ8H 4NYLB 4WCYL 4PRDA 4WI2A 2JTDA 3HE7A 5HHOB 4GRLC 2J88H 5ELIA 2P4AB 2D31B 4S1DD 4OD2B 2R8SL 4FQIL 2HT4D 2KUTA 1ITCA 1TENA 4IRJB 3UDWA 2IF7A 1JNNL 1FGNH 1XGUA 5F8RC 4CNIA 4ZD3H 1LE9A 2PR4L 1IGYB 4RGNB 2QSCL 2DLEA 4X6BB 2X4SA 4P5KB 5ABDE 5IFJB 4YDVA 4ZUUA 2WZPD 5C6TH 2BNQB 3F7RA 3UAJC 1IL1A 3RL2A 3FOLB 5JZ7C 2VTFA 3O2VL 3UTTA 4RWHA 4EI5A 5JW5A 1IAOA 2NPLX 4OGAD 1MFNA 1YJDC 3O81A 3MQIA 4H26A 1FRGL 4LSSL 2OJEB 4PFEA 3RY6A 5C0JB 2R2EA 1I7RA 4KJWD 5TE4H 1WAAF 2RB8A 5DSCB 1CLZH 1G9EA 3G9VA 5LGHH 2FIKB 4HW6A 4Z76A 5L6YH 2DWEA 2AJSL 1KTLA 4XWGH 5DEZA 3D0VA 1LP9F 4JZOA 4Z7OE 3GMRB 5E5UB 3QXTA 1NKRA 3BMVA 3GIZH 4GRLD 4MD5A 3RKPA 4PJ7B 4UU9A 2Q86B 3FKUS 1HEZB 3ULSA 1B2WL 2WM0A 1QA9B 4HMDA 1A3LH 4YHNB 1GGBH 1WZMA 4PTTA 5CUSH 4OV5B 3NFSH 2EDNA 1MIMH 3RJDA 3CH1B 3HZKB 4IS6A 3UAJD 3WKNA 3SCMB 5MI0C 5IIEA 1T83C 4HWEH 2RAMA 1P5UA 3BKYL 5KVGL 2GUOB 5JZ7D 5BS0E 4NO2A 3DGCR 4JY5H 3VXRA 3U9PH 5GRJL 2I5YL 2BDNH 2WBJC 2BK8A 1OF2A 2P24A 4N90E 1G9ML 3BHBB 1MUJB 1QBLH 2DQJL 4OSUH 3U30C 2FD6H 3KPSB 2AXFB 3UZVB 1Y6NR 1A6ZB 1T04B 4P2OC 5T1LB 5JIKA 3DUUB 3W39A 3IKKA 4MA8L 2ED8A 1BEYL 2A77H 5ITFB 4NUJA 2VZOA 2LTQB 4NZTL 5AZEH 3AS2A 3VW3H 5D7JD 4BH8A 3O6ML 3QQ4A 1CGUA 1CDUA 3IDGB 4WFFD 3WO4C 1XF1A 2W9DH 4RRPG 5ESAB 4LLQA 2QHRL 3MCKA 3NIDF 2DLTA 2DLIA 1KYOK 4DOHE 5I8EA 2XY1A 1D5ZA 3W2DH 1F2QA 3C09B 4Q0XH 5JDJA 4PG9A 5EFIB 4GG6A 4GFTB 1R3IH 1BOGB 3WE6A 1RUQL 1CXLA 2CD0A 1DVFA 5T3XH 5CSZB 3ARDD 3SJVD 4O4YL 5HGAB 2QKIB 2CJUH 1QFWL 3HAEA 2ADIA 2RJMA 4MAYA 1NBYB 1FVDB 2VLMD 3UYRL 4HKXB 2UY6A 1S9KC 4Q9RH 1GGIH 2BX5A 4LL9A 4NQED 4F9PA 1TDQA 4XVSH 4XCFL 3ZHKA 5BXFB 3D3VB 5D2NE 4WI7A 3G04B 5D7IE 4ONOA 1QSED 4OLXL 2FJHA 4I3SH 1DBJH 5GRVL 3T4YB 3D39B 5KW9H 4LPCA 4S1RH 3L3JB 4Y5VA 4YHIA 1RHHA 2VR5A 3V9FA 3M1BA 5AWNL 4B5EA 3OKLB 3MPCA 5BW7A 3B5TA 5D7SH 5FYKD 4LHUB 4ZAKC 3KYMB 2R1WB 2EKSB 4PJDB 2MQCA 5D1QC 3OKDA 3BAEH 4XBEH 4K3DH 5TGBA 1KB9J 3VFNA 1MHEA 4WJ5B 5IBUB 3AU1B 5FIEA 1Q0YH 1GPOH 1CGSL 1H5BB 2WUBL 1W0VB 4P48A 5C0AE 5GSRB 5F9OH 2IAMD 1KLGA 4YR6B 1UZ8B 3QUYC 5F9WC 4D3CH 4X4YB 4HT1L 1D5XA 1RUMH 5H94B 3VI3E 4NQSB 3C9NB 5KN5B 1B90A 4FP8L 3DUHA 4Y19D 4JO1H 1RVFH 5BMFL 1OP3K 1HHHA 2Z4QB 2EKJA 2MQ3A 3SGKA 3C5ZC 3BN9C 1B0WA 4G8IB 1JPGA 3H42H 5F7FA 1I9RH 4FQXB 4J6RH 1FN4B 4L3EE 1OT1A 3O11A 1CR9H 4LVHC 3NH7H 2FJFA 4ZUUB 4JHAH 2VJXA 4BZ2H 5JO5A 4ZAKD 1U8NB 3QDJA 4HUXB 5D1QD 5A2FA 2BVOA 1JE6A 4IMLB 4YK4C 3HE6D 2A2QT 5L2KB 2OMNA 3HFML 4IIQB 1ZLWH 1VENA 1KTKE 5E24E 4CMHB 2VWEC 5D93B 2GCYB 5I9QC 4I5BA 2HN7B 1L0XA 4TSCH 1M71A 3BW9A 1SM3L 2OR8A 5GZNC 4Q2ZA 4OFYD 3KJ6H 4ESKA 3BRDA 5ESQA 1VEOA 5T1KD 1KCVL 2WUCH 4MB5A 1J8HA 3WJJA 1MAJA 2W60A 3C5ZD 4FQIH 4E0RB 5BV7H 2XQYK 1PG7W 1HYSC 3DOSA 4L5FL 2PR4H 4NHCH 4OZIF 1TZGL 2AAVA 4XXDA 2R1XA 3C08L 5FGSA 4RA0C 1J87A 3QUXC 1U8QB 1UFUA 4KDTA 4X6CE 1U3HA 1JL8A 5H37H 4X6DE 1NMCB 1AXSB 2K7PA 2DTML 2P7TA 4J3XA 2EE2A 3Q3GB 4XRCB 4XBPB 1ROWA 2E6PA 1FRGH 1ZHNB 4LSSH 3RGVA 3OKKB 1M1SA 3FB8A 1WTLA 4HKZA 2XZZA 2AJSH 3HNSL 3BYTA 4ERSH 1I8LA 3T4AA 4I0PC 3REWA 5C07E 4E41D 3QO1B 3WNOA 3VD5A 2J3SA 4NUJB 3FB5A 1I7TB 1GH7A 1RJZB 3OHXA 4UOW1 4EN3C 1NCWL 4LMQE 1RZ7L 5K9OB 4JPKL 1G7IA 1HYSD 2BRRL 1YEJH 3MCKB 2HKFL 1QKZL 3ULVH 1KIQB 1CLCA 4DW2L 1ZHKB 3FHAA 5JOFA 4JFXA 3UCRA 4I9WE 4TOYH 1QBAA 2YXFA 3KGRA 5JTWA 4Y88A 2BSSB 3QUXD 4OZHF 1KCSH 4C55A 1NDGB 1N4XH 3BKYH 3D5OF 4O00A 4O02L 1P4IL 3W0WE 3EGSA 4XMLL 4AL8L 1JJUA 5E00B 3QQNA 5A40E 5CGTA 2DWDA 3VFUA 2DQTL 4YXLL 3HAEB 4R6UA 5D4QA 2DLHA 1PFCA 2F5BL 1G9MH 3KR3L 3GGWB 1A5FH 2VH5L 5C2UB 3V6ZA 1HH9A 3LKRA 4RIRB 4KQ4L 5F6HI 4AMKL 5IGXH 2LVCA 4FTVA 4M7JL 2P5EA 3TNMB 3VXQB 3TBVB 1T22B 2SEBB 3C8DA 1A21A 4U1GB 5KG9A 5KS9A 4EN3D 3SDAC 2VLKB 4JFDD 4NNYB 4NRYA 1HI6A 2AEWA 2OJZL 1SVCP 1S7VB 4JPWL 5JDSA 3UTPE 3RHWF 1YNLL 1EHLL 5EZLB 3SDXB 1HXMA 1CD1B 1MREL 2CUIA 3LD8B 4F7PB 1N5YL 3WDJA 1NGYA 3X12B 3WFBL 1MNUL 5FOBB 3IT8D 1YUHA 3HS0B 2CIKA 5LGKA 2P43B 4A6YB 2M1KA 3FN9A 5ALCH 1U2HA 1N8ZB 1NPUA 1QFUH 4Y0GA 5FYJL 2UVEA 2AEQL 1RI8A 2UVFA 3BUTA 3QJFB 5FUCE 5E9DD 1BQLL 1U3JA 1INEL 5LAXB 5EO0B 3QUKB 2AGJH 2CK0L 1X6NA 2OR7A 5SX4H 3F7QA 4ZUVA 3T0WA 3EYSH 3TA3C 1BQHB 3OKEB 3SDAD 1BP3B 1A6VL 4LSPL 2NLJB 1AFVL 1ZLVK 5EOCL 2EDHA 4H1LA 4XNUL 2WUBH 3LKNA 2FO4B 5C0EB 1KIPA 3GRWL 4ZS7L 4MLSA 1G9NC 2YC1B 4A2LA 2VLJE 4LF3A 2AJXH 5CEZH 3MODH 3DX8B 4HT1H 4Z7VB 1G84A 4OCMC 4JREB 5MI0B 1JTOA 4WO4B 1QTYT 1OARH 4XNZC 1A14H 4HMCA 5FO8A 4FP8H 4BELD 1MFDL 1U8HB 1AO7E 2E8YA 4NQVB 1A7PL 4L4TB 5BMFH 1T4KA 4G6JH 5KVEH 2WBJB 2CLVA 3G6JB 2XN9B 1X5GA 2F54B 2MCG1 3S35H 4KDWA 4OZGF 2BVUA 2VLRE 4FABL 2X1WL 2Y5TB 2QQLL 5GS1A 2ZUQC 4XXDB 5CLTA 1JGEA 4NO0B 4P2OB 3ZKMC 4J8RA 4IRSA 1T80A 3TA3D 2FGWL 1BWMA 3N1PC 5LXGH 4G8GE 4LKXB 4X6FB 3RKDD 1L4IA 2H8PA 3DYPA 4KI1A 5DK0B 1BD2A 3D85A 5D1ZA 2CIIB 4XP6H 5IESL 4AENB 5HYJB 3OJDA 1OAQL 1SEQL 1AHWC 4F37K 1G6RA 1SM3H 3BEWB 4XNYL 1I1FB 4L8DB 5BS0D 4KKNA 3T4AB 3OL2A 4HV8B 1SYVA 1KCVH 3CZFA 2VXTH 3NCJL 4WVRA 2ESVE 1OAZL 3BZEA 3ROOA 3JWOC 3IDUA 3CVHB 4R97C 1XF5A 5D2NC 4L5FH 4BFGA 1M7DB 2HLAA 3RZCD 2NX5A 1OAKL 5I1HH 2OL3A 3I6KA 4ODTH 4OI8A 3OAZH 5DVNA 1S7UA 5HI4C 4JFXB 1I9JH 3ZKMD 3L5HA 4RWYH 3KPMA 3F8UB 3ZHLA 3RUGB 3DGGB 4F15C 1I85A 1U0QA 2DTMH 1S7SA 3QEQB 4JFEE 5EC2B 1T20B 1RY7B 3HMXL 5I0ZA 1UYWL 2EH8L 2BY3A 3BSZL 4PV8B 4G9FE 4XPAL 4YHYB 5B39G 3GHEH 1G7MA 4XX1E 4LFHD 2DF3A 3MRFB 2I9LB 3IKCA 3OKOB 4LCCA 4PJIE 4QHMB 3GSNB 4R96B 1ZHBB 1CFTB 1NAKL 3D2UB 4M93C 2QSQA 3TO2B 4WWKA 2Y1VA 4RX4A 4NQCA 2DQFB 5GS0C 3QUYB 5K93A 1YEHH 5L8KB 5J6GB 4JZJA 4OB5H 4DVBB 1NCWH 4G42A 3OAYK 2UV3A 4OCLC 3MRQB 3UTQA 1KJ2H 4V2CB 4EBQH 3WN5A 2BRRH 3LQAL 3L1OH 5B8CC 2YBRB 1QKZH 4NRYB 4RMTA 3D1MC 1VESA 4WV1B 1MFBH 3Q5OA 5C6PB 4MCYA 2L7UA 5HI4D 3WV0A 2JJVA 1TQBC 1I1AC 3NCEB 2OK0L 4XMLH 2Q8AL 4AL8H 4YDLB 1HXMB 5F8QC 3O8XB 5C8JB 2GQHA 2EIZA 3TPUB 4QCIA 3BRFA 1MCEA 3MOAL 3V4VL 4LAQH 1YUHB 4XH2A 1PAMA 3IGAA 1T6WA 1KJMA 3QISA 3VFWA 4B50A 5C0AD 1SBSL 2J8UA 5F7DB 3WKML 4MJIA 4ZO6A 5C09A 4C57C 4AMKH 5D5MA 1B6UA 3WHXA 5ESVA 4QEGA 5GS0D 4OFIA 5IB1B 5DRZB 4NRZB 5GJTH 4Y5YC 4PJEE 1FNGB 3DXAD 4UV7H 3W81A 4JAMA 3OKYA 4WTZG 2CDEA 3C5SB 4PJHB 1N59A 3QNYB 4MNQB 4AIXA 1A0QL 5JIPA 4U6HB 5SWZE 3H2WA 2YD6A 1MJUH 3BDYH 4ZQKA 1G0YR 3RPIA 1EH9A 1KPUA 5I30L 2B4CH 3OKMB 1HQRB 2IPTL 1TJHL 1AD0A 1BFSA 4RMWA 4HFUL 1MCCA 3V4PH 5D2LA 5DZOA 4L3ED 1PKOA 1PG7X 3DI3B 3RAJH 4ZMAT 1I1AD 4PJXF 4X8XA 3GSXB 2EO1A 4YAQB 3GDBA 1CLYL 1MNUH 1PQZB 3ELAT 3NFPA 1FDLL 2NR6C 4JRYB 2D4FA 5JIIA 1IT9L 3EJJX 3MV9B 1INQA 2YPLB 5DJDA 5E8OB 1ZT1B 4HLZH 3QWRA 5FYJH 3O45A 1FSKB 1ORQA 2IQAB 3V5HA 2COQA 2D0HA 1XFPA 1CG9B 5D72L 2YSSA 3VG0L 1IC7H 5J1AB 4PGCB 1GHFL 1RULL 2F53A 4JY6A 1CFSA 4JFZL 2C1PA 4I0PB 1AI1L 1CFNA 4RAUA 3QDMA 3QRGL 5EN2B 1DN0A 5EOCH 2X40A 4XNUH 4F9LC 3P9WB 4MQSB 1JTTA 2DYPD 3O9WD 3ILQC 4C54A 3O3BB 3OSKA 2AK1L 4UQ2B 4JY4B 3I75B 5SWSB 5T5NG 1JGUL 3T1WA 1CICB 3TBTB 3PWPB 1MAKA 1EO8L 5T33L 3D9AL 2H6PB 3PWNB 1K6QL 2NR6D 1MFEH 4I4WB 4Z7WF 4UTBL 4NZJA 4LNRB 2WQRA 4QHUB 2MPAL 5DQ9A 1CU4H 2BNRE 3K4DA 3OGCA 3BZEB 2P46B 4R0LC 8FABB 3MLYH 2F5AH 5IJKA 3IFPB 3BGFC 3DX6A 4G6ML 4JG1L 3GKZA 2HLFC 2A6JB 5MERB 4G6KH 1B3JA 2OL3B 3MOBL 3SKOB 3OF6D 4W68A 5C07D 3WDHA 2V7NA 3NCCB 2YPVL 2V5MA 4ZFFA 3FTGA 1H8SA 4ZUSB 1ED3A 4PYHA 2Y36L 2APXA 3ILQD 1ZVSA 1VGEL 4OLWL 1LGVA 1CTNA 2Y7QB 2VAAA 4I9WD 1ORSB 3T3ME 5IHUL 2NY6C 1D9KB 4GJTB 5HVFB 3O2WH 1KB5B 4P5TA 5GGVH 4PJAF 3QUMH 5KVMC 2G5BB 1PZUB 3KLHC 3BIKB 4QRUA 5KVFH 5E8PA 3NCJH 4RNRA 4UI2A 1UENA 3RWDA 1HOCB 3EO1A 2DQGL 3NGBB 4OLVH 5H35B 1MCDA 4UIMA 3TYFA 3Q1SL 2HLFD 3OZ9L 2BY1A 3FQTB 2XTJC 4LMQI 1HQ4B 3H7BA 3MV8A 2YN5A 1C08B 1IKNC 3QDGA 5E0QA 1N26A 2VE6A 3TYGH 3T65A 1BF2A 2GFBB 4M8VA 3TN0B 4MSWB 2WIIA 4NNXA 2EH8H 5C2BH 4U1SA 4OV6F 3FQXA 4ODXA 5AYQA 3PDOA 4LSTL 1LDPL 3C2AH 1JWSB 1PKQE 3ARWA 1N0XH 1EEZB 1V7NL 1MCBA 4MCZA 3JV6A 3UTPD 2XPGA 2NY6D 3X11B 1A6PA 5E94B 1CVRA 3BP7A 4DQOL 3DV4A 4NKMB 4NQDB 4G7YL 4WUUB 5A3IC 4NC2B 1J8KA 2NY7H 3KLHD 1IBGL 4U1MA 4O5LH 1DANT 5DYOA 1IC4H 1ZTXL 5F21B 2R69L 1LILA 4POZC 3V6BR 2JCCE 3O6FC 3T0EA 3OX8B 4WW2F 4M6NL 4GS7C 4LP5A 3QEUB 3CFBA 1RZKH 3BFOA 5C0IB 4LVEA 3D87B 1YMMB 4M61A 4G5ZH 2C3VB 5F71A 1YECH 5KSBE 4IJ3C 2OK0H 2Q8AH 2ICES 1G7JA 3QIBC 1NFDB 4E5XA 3RIFF 3ISWA 5KANG 3MOAH 3UBXA 2EDLA 1TNMA 3LSOB 5SX5K 4R90H 1TVHA 4LCYB 4WFED 2BHYA 2EC8A 2XWBA 2PO6A 3WKMH 4ZNEE 4X9GA 5I19L 3FT3B 2YRPA 2VC2L 2Q7YA 2VLJD 4Y2DA 1RSFA 2Z31C 4B7LA 3L6FB 4JN2A 5A3ID 5L8JB 1LO2H 1XR9A 3LEXA 4WDIA 5L2JB 3RWEA 4ELMA 3U46B 1AO7D 2QQNL 4POZD 1J0JA 4OD3L 2EYTA 3NIFF 3O6FD 2A1WL 4R8WL 2P48B 3NA9L 2IPTH 1TJHH 4LVOB 5GGRB 4KVCL 1IGIH 4MHHG 4Y4FC 2R1YA 4R97B 3H9SB 1CIDA 2J7LA 4LEOA 2VLRD 15C8L 4X7TB 1VPOL 4J1UB 5B3NA 1NGZA 3WD5L 1OL0A 3INUL 5IK3B 1NMAH 3QIBD 2L4OA 1K5NB 2IBGA 1MI5E 4KY1H 4G8GD 5I1EL 5HGHA 4K8RC 1IT9H 5IMMA 4ORZC 1UM4H 2JIXB 4KRNA 1MH5A 3OPZL 1J10A 4C4KT 1U8JA 4IDLA 2W92A 5IVNA 1RZJH 4WNQA 1U93A 4A6YL 2R56H 3BPLB 2Z91A 1P6AB 2Z31D 3DBXB 1DBBL 1MQ8A 5JW4Q 5D72H 3VG0H 5J06A 4ONGL 1IM3A 1X5ZA 1VFBA 3B83A 2MTPA 4Y4HA 4BZ1H 2P8LA 3G6DL 4KHTL 3CXHJ 3F5WA 4ZPVB 1KEMH 2ESVD 3QRGH 2NZ9C 1YN7B 2VIRA 5JPNA 5C0DB 1U58A 4Z7OF 1J12A 4R7DA 5TE7L 2GJ6E 3P30L 4FN0A 3HMWL 5DRXA 3U9UA 4GRMB 3LS4L 1BVKB 4Y4FD 3PNWB 3BVNB 4QXUH 4OF3A 2AK1H 3OV6A 4WFGE 1PGRB 1PBYA 5FDYA 4M1GH 1LP9B 4GRWH 4ISVA 5DHYA 1EMTH 1MCWW 3DJ9A 4P3CH 2FB4L 3RU8H 3RHWK 4K8RD 4GT7A 3ZYIA 4JFED 5F96L 4LCWA 3PABB 4HKJA 2D3VA 4OZIA 5EUOA 4UTBH 1S5IH 3TT3H 5EH1A 3CDCA 4I77L 3RWDB 4G9FD 1P6FA 3IJSB 5E2JA 2GKIA 2Y06H 4QY8A 4JG1H 4JVWA 3KPLA 3QHFL 1NFKA 1YN6B 2G5RA 4X5WB 4ZSOA 3RWIB 5IG7A 3BGMB 4M1DH 2YPVH 3VXNA 5EOTB 3PHOA 4DVRL 1E27B 3U7YL 2NZ9D 1CWVA 4IOIA 4TVPL 1JWUB 3HHRB 4KKLC 4N8CH 3OJ2C 1QRKA 3AY4C 4NKOB 5CGMA 1W0YT 3MYJA 4OLWH 3V5DB 1MCHA 3QDHA 2XTLA 3CMOL 3MA7A 1L0YA 3WLBA 5CLWA 4UIKL 3JV6B 4DGIL 1T2XA 1U92B 2AQ3A 3RQ3A 2AERT 1OTSC 2RR3A 3KPRA 4H25A 1Q0XH 5DMYA 3CFJA 1H0DB 1GVIA 1JV5A 1MF2L 4YBLB 1A6TA 3ZYZA 4M9PA 4EQ2A 4EUPG 1Q94A 1QFPA 1WCQA 1V3JA 2HRLA 2NY1B 4D0CB 1WZKA 1ZS8A 4WHCA 3SDDC 4M7KL 3VWKC 3WS6A 3FB6B 3OZ9H 4HWBA 5BZDB 5F93C 3CVHL 5D7IF 3RWFA 1HN1A 3DVNB 5C86A 2DM2A 3MC0A 2D7TL 3HC3H 1S5HB 2PXYB 3O2DA 4PUBL 2QTEA 4NFDA 1RUPH 1S3KL 1SYSB 4Y89A 3ARVA 5ENWB 2C1OB 4KKCC 1MEXH 1GRWA 4OLYL 4TPRL 4KJYB 3WEXB 4LSTH 1ZA3A 2GSIA 2BNUB 4LSQL 4CVZB 5DQJA 1GOGA 5FKPB 5CJXA 1C5DB 5KBNC 3VCLA 1IARB 2XWBB 3E2HB 3U1SL 3MREB 1C7TA 1F13A 1DTUA 5ICZA 4KUCD 1FV1A 1OTSD 1A8JH 3L5WB 3PWUA 4J3VA 3GSNL 4FQQB 3GI9L 3EDJA 3P4MB 1ZTXH 2R69H 2EIBA 4WDIB 1GC1H 4YDJB 3HG1B 3WXVL 5ICXB 2HVJB 2D0GA 3KS0J 3G6AA 3VI3F 3RFZC 2NYYC 5ERWB 3AXLA 1PSKL 3SDDD 5IB5B 1S7QB 3VWKD 3SDCB 1TJIL 1LO5A 2W59A 1H3PL 1IM9A 4P2QB 2GAZA 3ARGC 1F00I 4KU1A 2Z92B 2VQUA 4AT6A 1PLGL 3MRBB 4F7CB 1OSPL 4M6ML 3LZFH 1XH3A 1LK3L 1BREA 5GGSB 3MRNA 1DDHA 5IVXB 1LVEA 5C08A 1HHGB 3D69B 3QI9A 5DRWA 4KKCD 3UTSA 1XF2A 3SOBL 2N7AA 1NH6A 2VDKL 2X5PA 1W0WA 3HAEH 3OXRB 4QF1B 1MH5B 5ALBL 3AROA 1U8JB 1Z9LA 3J8F7 3B6SA 4Z0XB 4HUMB 1FJ1B 4U05A 1JZ4A 3ALPA 1FGVL 5KSAC 3EYFB 1UT9A 2FDBP 4J3SA 4MHHI 4QRRE 2NY5L 4MZ3A 2EZ0C 2QQNH 2WWMC 4Y1AE 4OD3H 3RRQA 3IFLL 4XP9L 2NYYD 3I3BA 4HUUB 3F5WB 5GRZA 2CDGA 4HC1L 1KIUA 2BNRD 3MV7B 4O9HL 5DUPL 3ARGD 4R2GB 4O2FA 3EOBA 1KIRB 3INUH 5H2BA 4RMSA 3WFDL 4M5YL 2DJ4A 2P8MB 1FYTA 2XTJB 3EFFA 2YMXL 1EIBA 1UVQA 3IFNH 3GNMH 4MDJB 3ULUH 3LKQB 4MXWL 3BP5A 2YD3A 3STBA 5I6XB 1KG0A 1FFRA 4A6YH 4NN5C 1UB5B 4MB3A 1EAPA 1HXYA 1QNZH 3FO1A 3ZT6A 2ICEA 4HFWB 5KSAD 3TNNA 3WSQL 3SGJC 1PZ5A 2YKLH 2GT9B 2WWMD 2CUHA 5AD0B 3ALXA 5IQ7H 3N1GC 5TE7H 1LE5B 2ENYA 2YEZA 2MKLC 4M62L 2OP4H 4N0CC 1K8IB 2DM3A 3MRRA 5IP4A 4U1JA 2B5IB 1B4RA 4DUWA 2LFGA 3MYJB 3QCUL 2EDBA 5LCVH 2JB5L 1I4FA 3PP4H 3ILPB 3K2UL 2LAGB 1MVUB 3N85L 3CVIL 5C0BB 2ITCB 2FB4H 1T5XA 2BRQA 4GRLA 4PRAA 1WWAX 4ZXBC 5FA3B 3W9DB 4FQ1L 2NZIA 4XPBL 1NC2D 3G08A 5ANMA 1Q9LA 2FLRT 4J3UA 3BPCB 4LSRL 1JFQH 4OZHB 5FGCB 1QR1A 4AH2B 5I75C 1K85A 5F7YC 1WIUA 3BZDA 2PW2A 4MJ2A 1PW3A 4ODHH 1EA9C 2AJZB 3H3BC 4XB7A 4EQ3A 1H3TA 2XWJA 3LAFA 4DVRH 1NGQH 3QCTL 3MNWA 2OL3L 4GXVL 1KELL 1FFOA 4POYA 5D1XC 1UEMA 4OTXH 3DI2B 1DP0A 5GRWA 4ZDHA 4D9RE 5D7LE 1R24B 1TTFA 4U1HB 1BMGA 3QPXH 3N1QC 2Q8BL 2QADB 4UIKH 5F97E 1BZ7B 3MO1A 4MB4A 5KSUA 2DD8L 2OI9C 3DUSB 5D7JA 1S9WB 2K1MA 5EU4A 4N68A 1KB5L 3BP4B 4BKLA 4NO3A 1NGXB 4U6XA 3RIAF 1MJ7H 3KPNB 1VDGA 4BH7B 2KQNA 4HX1B 4HWNA 4ZS6C 4HIIA 5DD5L 3JWDL 3PDGA 1T83A 1U8OA 4F3FB 4JKKA 1M6OA 1CDGA 3ARDA 3SJVA 4PUBH 3CLFL 2JB6A 4MAUL 4HIHA 5D71L 2DN7A 2C3WA 1OP3H 3BXNA 1FQ9C 3MMEA 4NQEA 3QG6B 2ZJSH 5D1XD 5T3ZE 4OI7A 2EDOA 1QSEA 3UTSB 5KVDH 3VXSE 5IVZA 2G2RB 4IDJL 3BDXA 1OQXA 5TDOA 1L6ZA 4XP5H 2A6DB 3QFJE 4EDWH 4DUXA 5E6IC 4JQIH 1D5MB 2EDKA 5DA0B 3GI9H 3O6KH 5E5RB 1MJJB 3DHMA 4K9EC 1U8LA 4PGDB 1MI5D 5I66A 4IBLT 5I0DA 1TJGH 1G9NL 3WMSA 4OUUB 4UILL 1EFQA 1UWEH 2FECL 1IKFH 1X5FA 3OR6B 1EO5A 5LKNA 1R0AL 1T89A 2IAMA 4G6FB 3P11H 4CU6A 2ED9A 3GJFA 1MWAB 5TDPA 1Q9KB 1DBKH 2NY3C 3O3EB 1PLGH 4XCCL 2H9GA 3ARSA 1FAIL 4M6MH 3EOBB 3QUZC 1RV6X 4YDIL 3PG2A 4NJAL 3D0LB 2IPUK 1C1EH 1TPXB 4Y19A 4NRXA 1DQTA 2ZUUA 3KPTA 1RMFH 4P9HH 3KXFE 2GJ6D 3U2SB 2DMCA 3WNPA 5F1SA 3LPGA 4OZGB 5INCA 3RTQC 5AEAA 5EBWA 5D9SB 5J12B 1O5DT 4WFGD 3SPVB 4PRPB 4HDIA 4OAWA 1I1YB 5E6ID 1FGVH 2ERJB 4ZFGL 3UZEA 3NZ8A 1KTRL 3FO1B 1U95B 5IJVB 4S1SL 5BCAA 5IWLC 2BJMH 3ZE0E 5CZVH 2X4UA 4ZAKA 3AM8C 2EDWA 1Y6KR 3QXAB 4Z8FL 1HWHB 5D1QA 4HZLB 4JFFB 1ZT4B 4LLAA 4X0KB 3MRJB 3HE6A 3IFLH 3HLAB 1RFDH 1YPZA 1RZFL 3QB7C 4OZ4B 2AXJA 5JA8B 2QL1A 5IB3A 4O9HH 5DUPH 1SMAA 3FO2B 3MUZ1 1NFIA 3L7FA 3MRMB 5F7MC 2NY3D 2I27N 3B5GA 3C6LB 4LQFH 4LSUL 2E27L 4AQ1B 4XVUC 5CSGA 5TQ2H 4M5YH 1P7QD 4OFYA 4FQJL 2YD2A 2FZ3B 3JWOL 4H1LH 4OGYL 2V17H 1ZWIB 1KGCE 1T2QL 4FQLL 5T1KA 1BZ9A 3CX5J 3CJJA 3LEVL 5BRZB 4ZOAA 3BQUD 2ZSVA 3C5ZA 4DKFL 3DTXB 1A1OA 3DIFA 2Y9RT 5EC1A 2A9ML 5C0NC 3KJ4C 5GIRB 2Y72A 3PWLA 3RTQD 4YDKH 4H5SA 3RIFK 4RCAA 2DIAA 2AJUL 4PJ9D 1HH6B 3BWAB 2CMRL 2FH6A 3ZSSA 5J1SC 2XFXB 3Q0HA 5F7LB 4XAWL 1EDQA 3E3QC 1FNSL 2BVYA 4PJ5E 2YD5A 1E28A 2VL4A 4FA8A 5CP3A 1A6AB 3SKMB 5I18L 4RGMC 5DJ2A 4IMKC 1LNUB 1UZ6E 2JE8A 3LKOA 4MNGB 3ZE2E 4LBEB 1I7UB 5HBBA 1N6VA 4ZDHB 1U8IA 4XVUD 3QCUH 4OBRA 3DRTA 1SJEB 1MHCB 3K2UH 1HHIB 4BJLA 2BVEA 5DA4A 4QTHA 3VFMA 1AKJB 4E41A 3CVIH 3FN3A 4XB8A 2GSGB 5I1DA 5FM4A 2GITB 3CU7A 2XQBL 4XPGL 5B38A 2HFGH 1OAUL 1UB6B 1QQDB 3BIAX 4X8JB 5IBTH 3S37L 3KDMB 4I0KA 2Z93A 1F58L 4ZNCD 4HJGA 1ODAA 5C0ND 2BSRA 1E4XH 3EBAA 1NUGA 3JZ7A 5FA4B 2V5YA 5E70A 5JQHC 4JO4L 4K3EL 3WFEL 2FL5B 3VXOA 1ES0A 1NGWA 4N1CA 5CILL 4OLUL 1EVUA 2E9IA 3UTOA 2EE6A 3P4NB 2XA8L 3QUXA 5FFLA 4G3YL 5GGUB 1MQKL 3FQUA 2ORBH 3O4LE 2OL3H 4GXVH 2N1KA 3O4OB 4PREB 4PG2C 1NEZG 2FWOA 4NQEB 3DO7A 5TPWL 1MRCH 2V2WA 5LGJB 2DMBA 4GMTL 1KEGL 1YNTB 3S6CA 3I9GL 1ADQL 3EW3B 1A9BA 3I6GA 2H2PC 3LRGA 2DD8H 4YQXL 5DK2A 2IH3A 1Y18B 5TDOB 1FLTX 3I2CL 1ZLVH 4EN3A 3UO1H 1CD9B 1KULA 1KB5H 4X6EA 3ZKXB 4JFDA 4PD4J 4ZFOB 3W82A 4KAQH 5BVJA 1LD9A 2E8ZA 5CKGA 1WBXA 4RAVB 4HQQL 4AEHH 1TIUA 3WJLC 2XWTB 1U8PB 2P5WB 3WNNA 5DD5H 1T7ZA 4HXAL 4D9LL 3QQ3A 2CPCA 4WEBL 2VDOH 2IAMB 3H8NA 3EYQC 4PJXB 4AEFA 3MSPA 2VLLA 3CLFH 4MAUH 4RZCB 3FRUA 1BD2E 3FT2B 4ETQB 3EFDL 3D48R 2BC4A 2H32B 4KK5C 1DUYA 3A6CL 5JOPE 4HCRL 5E8EB 4LVNC 4RISH 5C3LD 5E4EC 4PGEA 1F4HA 3PP3H 4QRRD 4G9DB 1VB9A 2XZAL 1CFBA 4Y1AD 4JPVL 4PTUB 1Z5LB 4Y19B 3TVMB 1OY3B 5CKAA 1CGVA 2O26U 1HDMB 4C56E 4XXCC 5E9DA 4NM4L 4KRLB 2H2PD 3MXWL 5EO9B 3P9MB 2W0PA 4I18C 1U3ZA 4MDIB 3IJYB 4FQ2L 1NCAL 1DQMH 3SDAA 4MD0A 1T1XB 2GY5A 1KENL 4PGBB 2NX5E 2BP3A 4UILH 4OGZA 5I1JL 3CPLB 4CW1B 4HWZB 4WRLA 4ZFZA 4ZXBB 1KCKA 2C26A 4G80B 3FQWB 5F7NC 1R0AH 3HE6B 3MNVA 4L9LA 3K80A 4M6OH 3SGDI 1OAXL 2AQ2A 3MRLA 1FHGA 3IETB 2OR9L 2XKUA 4I13B 4U3CA 1FAIH 3LKSA 3DRQA 3MJ9L 1BLNB 1YEEH 3UP1A 4NJAH 3VRJA 2E7HA 1WGOA 4OLZL 5CWSB 4Z7WB 4JG0L 1I8IB 1P1ZA 1JGDA 1BZ9B 1INDL 1PJ9A 4PJCE 3E8UH 3S36H 4EOWH 2V2XB 1EFXD 2CKBB 3TZVB 2VXUL 2IAND 4DFHA 1HINH 1YDPB 3S4SA 5EC1B 2NY0B 4OCWL 2YD4A 1SHMA 1AQKL 1F3DJ 1FZKB 2IALB 4O51B 1WC7A 2A74B 3MTRA 1PY9A 4CN4A 1N64L 5EG6C 1EK3A 5H37G 3TA3A 3NFNB 4H20L 3T3MF 3KYNA 4HUWA 2Q76B 4Z8FH 4JGJA 4OIAA 3RJQB 4RMVA 5DQDL 2ZUYA 5DJ8A 5FO9A 1RZFH 1EHNA 4P23C 1EEYA 5I1LA 2OS7A 4HULB 2XXMB 4LSUH 4OCXH 4BK4A 1A1MB 1QSFB 4PJAB 2QJDA 1CYGA 3OAYH 1X5HA 5BS0A 1JYVA 4FQLH 3V52H 1FZOA 3LKPA 3M17A 3DURA 3ARRA 3LEVH 1QPXA 1FL5A 3ARYA 4EVNA 5B38B 1BX2A 5D5ME 1UJ3B 2A9MH 4DEPC 3EO9L 3G5VA 1ZVYA 4HJGB 5D7LD 4ODUB 2KH2B 2APBA 3CSPA 1FCCA 4U3HA 4KTYA 3MFGB 1G7LB 1OTUC 2CMRH 4Z0BH 1ONQA 3ZT7A 1BIIB 1AH1A 2AK4E 1C16A 4PJGE 1FNSH 4JFYA 1RJYA 3QIUC 2AV7A 3FB7A 3WNLA 3MJ8A 2OQJA 2QQKL 5D2LE 2XACC 5I18H 2VDMH 1G7QA 3GBMH 1ZSDA 2AI0L 4JGMA 4P23D 1MFAH 3BJLA 1I3RB 3BPOC 2V6HA 1AHWA 5EIIB 4QHNA 4QXGH 1NBVL 3GI8L 5BVPL 4OJFL 1JHTA 4TTDD 2A6IB 4DTGL 4X98B 1DANU 1IEAB 1AGCB 2XQBH 4XPGH 2BVQA 3L9RA 2R0ZL 3B3IB 4XP1L 3WUWG 3QUZB 3SGEI 2ICWB 2OXHA 4WW2B 1GZPA 5JUEL 4UQ3A 3F6IA 5HYQB 5DJXA 5D2NA 1ZE3C 4X6EB 3GMMA 3RA7H 5T3ZD 5I71C 4NKDA 4PB0H 4OZFA 3OG4B 4LRNL 3WFEH 1NDMA 2A0LC 1TVDA 2F53E 3MUHL 5DFTA 5CILH 3VXSD 4AYFA 4OLUH 1OTUD 4Y4KB 2XA8H 4X7SH 3MLVL 1CL7H 3QFJD 5IB4B 4J23A 1YQ2A 2X9YA 3FOMA 3IAGC 3QIUD 4LLWB 4G3YH 4N8VA 2ZNXA 5KOVC 1KXTB 2CDFA 2HG5B 3KG5A 4JPIB 4UUJA 1YYML 4JN1H 2NNAA 4L8BB 2CQVA 4XNXL 3S96A 3MRKA 1S9YA 1VFOA 5BV7C 3V5KA 2BOCB 3BUYB 5TPWH 3L3DB 1L0QA 3L95A 3O2DL 4RSVA 3RWJA 1AD9B 3MBXL 5C0AA 2EDJA 3FFCE 3H6JA 1ADQH 4EXPX 5DZLA 1G1YA 2X7LA 4YQXH 1RJCA 5EU7C 2ZUTA 3DXAA 3F6LA 2IADB 1JI1A 3LQZB 2WQ8A 5AZ2H 4RFNC 1FL6A 4PRNA 1SJVA 1F3JA 1ZLWK 1XCQA 5B8CA 5GJSH 1CLOH 4BQBA 2NW3B 3H9YA 3KXFD 2A0LD 5FYJE 4V1DB 1A6UL 3GSRB 2X4NA 4BSWB 3KJ4B 4WEBH 3EOTL 3VGAB 1TZHA 4L3EA 4JVPA 2ID5A 4TNWF 1I1AA 1QVOB 4BQ6A 4U7KA 4ORGA 3EFDH 3VFRA 4DZ8A 4HCRH 1CZ8L 2EYRB 43CAB 5FHAH 2E7BA 7FABL 3LMJL 3HC0B 3WFCH 1T21A 1JPFA 4JPVH 4U2YA 4LRIC 3AAZA 4Z7UB 3F65A 3HI1B 3ULVC 1R5WB 1LK2A 1BFTA 2DLGA 4PY7A 4K7PH 3L3IB 4LCIH 3QO0A 1GSMA 5EBMB 3U0TB 3TIDB 3V2AR 1S9VA 3CSYB 1OTTC 3LOWA 4Y5YA 4KK8C 1K8DB 4FQ2H 3VFTB 3CFEA 1BVLB 1KGCD 4I1NB 3L5XL 1F90L 1JK8A 2AW2A 5I1JH 4L8SC 2FR4A 1G9MC 4UT7H 4D8PA 4F33B 4K3JL 1IGML 3NABL 3QHTC 4TULL 2DYPA 2VDNL 3O9WA 1JYWA 1WBYB 2R2HA 4YX2L 2C3GA 4WI9A 3RIAK 4KWUA 3MR9A 5I1LB 3R4DA 4HXBL 2YUXA 1R6VA 3ARFD 1R5IB 4N5UA 4X6CA 1FH5L 2RGSA 3QIWB 1MWAL 4BFIB 4X6DA 1GGUA 5EWIL 4JG0H 1UWXK 4XNMB 4PJ5D 5IMKA 1QYGL 3MNZB 2ZG2A 2ZKHL 2M26A 3EDEA 2Z8WC 2ZUVA 4LARH 4NOFA 4QOKE 4GO6B 3H3PH 2VXUH 1EJOL 4R4FH 5E8DL 5GZOC 3CDGA 1SJXA 4R26L 5HHME 5HJ3A 3PGDA 1AQKH 5SV3A 3RZCB 1D6VL 2KZ1B 4QRQA 5MEND 4R4NC 1CE1L 1QP1A 1N64H 4GUPA 3OF6A 4KK8D 5C07A 2C7UA 3MJ7B 2CGRL 1WZLA 1CD0A 4UDUB 3AREC 2AJVL 1B0GB 1QRNE 4P99A 2ARJB 4JFYB 2FSEB 3T1FA 5DQDH 1YC7A 2NXZD 4KMTH 4HK0B 5HHOE 3LDBC 1MCLA 5B39A 1A1NA 3MFFB 5E2TH 4DOHB 3CC5B 3K81A 1L7TL 2UYLB 4B7IA 5C7XH 1Z3GL 3M8OH 1T6VN 4YGVB 4YHMH 4GAYA 4UTAL 3AS0A 5C92A 1UCBL 2BNQE 2UY7A 4GG8B 4EXKA 2BOBB 1DBAL 3O4LD 4GRWF 5CBEA 2YWZA 3C5JA 4NOBA 4NGHH 1BJ8A 4LQ1A 4R0LA 4Q6IB 3ZKSD 1B88A 1P2CB 3EO9H 1KPVB 4LLDB 3JWNC 5GZOD 5CCKL 1JYXA 4PY8J 5D7IB 4TYUA 4WU7A 3QFDB 1CCZA 1TITA 2E9WA 2DBLH 3SO3B 4ELME 3A0OA 3PHQA 3NVQA 1A22B 4R4ND 25C8L 5J11B 2BSTB 2IFGA 2VN7A 1DE4B 1JPSH 2P49B 3ARED 5SX5H 4LIQL 4ALAL 1GGTA 2QQKH 4MA1C 3WS3B 2EYSA 1Q72L 1EAJA 1NCBL 4KQ3L 5CSBA 2BVPB 1MELA 3B9KC 4PJ7E 2AI0H 1HSBA 2AJYL 2WP3T 5JW3H 4F7TB 2Y23A 4OIBA 3QP3A 35C8L 4KTDH 2NW2B 1BQSA 2VKXA 3L95B 3RWJB 3GHBL 1NBVH 3GI8H 3QCVL 1UH4A 4OJFH 1OP9A 4WI3A 2IC2A 3H0TB 1LEKB 1HKLH 2B0SL 4W4NA 4NQTA 4YIQA 5JOPD 1FZMA 2R0ZH 5CAYB 5E7BA 4WHTB 3NCMA 4H8WL 3WNKA 2A6KB 2VISA 1CXHA 2A9NL 4GBXB 5E1AB 1QFWI 5KSVB 3JSSA 3U36B 3GJEB 5F7UA 4M4RA 4C56D 3RGHA 5HGGS 2B2XH 1JF1A 4P59H 5I8OL 3GIVB 3BD5A 3VXTB 4P2RB 3MLVH 1IKNA 5HPMA 5C0GA 2X4NB 3AMKA 3R1GH 1UKSA 1TZHB 1X5IA 3GKWL 5CD3B 1G7HA 1MCNA 1YYMH 1QUNA 2NX5D 5SWQA 1HWGB 4HLZG 3B9KD 3FO0L 4K3HA 1T21B 5E2UH 3O2DH 5CMAB 3UYOD 3VH8G 1TCRA 3MBXH 3CFDA 5JHLL 3WHE0 2VLJA 5FYJU 2W0FB 2APFA 4LCWE 4PJFA 3Q48A 5DWUL 2ADJB 1X7QA 3VMNA 1S9VB 4WEUD 3OXSA 4LGRB 1AJ7H 1MAML 1AO7A 4RGOH 5IB2A 3O6FA 2QR0B 3PWJA 3MLWL 4AIZB 5FYLL 1NMBL 3LRSA 4I3RH 3D3VE 4ZFOL 2WINB 3K8KA 4M43H 4U0RC 3EOTH 2DYPB 2VLRA 3IF1B 1UXSB 3D18A 2R2HB 3QULA 4YBQD 5F7KC 3D39E 5HD8C 3QIBA 1YEFL 5SV4A 3VRIB 5CBAA 1CZ8H 1NKOA 4XNQB 4LCUA 3I02B 2EECA 3ARUA 4G8GA 1KBGL 3IJHA 1TQCB 3RVUC 4DAGL 1Q1JL 3ROLB 4Q9CA 4R4BA 4MXVF 4JDTH 1YY8A 2O5YL 4Y16C 4HGWB 4PJDE 2Q6WA 4ODBD 2J4WL 4J3OC 4LAJH 4XCEA 1HHKA 5F44A 3P73B 4KXZH 2Z31A 3U79A 4FZEL 3TJEL 1KJVB 2G75A 1AXIB 3NACH 4TUKH 3EDDA 3SE9L 1X5KA 3HR5A 5JXEC 4HHAA 4KROB 4NBZB 4JFPA 5IT2L 2O5ZL 3L5XH 4DN4L 4JLRA 4M5ZL 3DVFA 5D6CB 1R3KB 3LS5H 3U4EB 4B0MM 3DROA 2ESVA 4FFWC 1EGJL 5CHNA 1H3XA 4K3JH 4Y4FA 2VDNH 1ZLUH 1XGPA 2MQ0A 4DGVH 5F88B 1NJ9B 2H45A 4HPOL 5HD8D 2GK2A 4ZO9A 5J56B 2XZQH 3VWJC 4FXLA 1MWAH 2AK4D 5EWIH 3RVUD 2VXQL 4JFEA 2X1OA 3W0WB 1QYGH 1R3JA 1Q9OB 4OKDA 1FG2A 4QYOB 2J12B 4H0GA 4Y16D 4Y5XB 1TETH 4G9FA 5F9DC 4W81A 5E8DH 2GK0A 3MCLL 4JFOB 4BZYA 5BV7B 5HYSB 5L2KE 4PJIA 5DUBA 4EI6A 1RURL 4J4PC 1CE1H 4WU7B 2CKBL 3DSFL 5AAMA 5JXED 1GXEA 3LV3A 2CGRH 3MGTB 5L7XL 4U2ZA 1ZA6A 3EYVB 3CFCL 3LN4B 4JFQA 4DZBB 3PL6C 1IGCH 1PYWA 4S2SB 3SE8L 1I7ZB 3WL9B 5IEHA 5DHVA 5ID1B 3ECBA 1J5OH 4K94L 3MRCB 1E6OH 1KC5H 1L7TH 5BO1H 3ZKNC 1Z3GH 1ETZB 4Z5RA 3BKML 2LQRA 3L7EA 4F7MA 3P4OA 3KLAA 1CT8B 3PWVA 5IW6A 3ZTJH 5GXBB 1UCBH 5EIVA 1U91A 2VQTA 1S9XB 3IDXH 3TO4D 1OM3L 1KPRB 4MXQC 3LIZH 3BH9B 4APQB 4NT6A 1TLKA 4JM2C 4UT9H 3IDIB 1XZ0A 3IXTB 3ARBB 3IS1X 3VXUB 2I24N 4X99A 3FFCD 3ZDZF 3QNXA 4HEME 1IGJB 2AJ3A 4PP2A 3T0VA 4J4PD 5I1IL 25C8H 4I2XB 5GSVB 4LLUB 1M7IB 3AFLA 1JF1B 3ALWA 3VE0B 2OZ4L 3FN0H 1BGXL 4PJEA 1UXWA 5DJCB 3P77A 4ALAH 2BSED 1S78D 5ETUA 3GMLB 3STZA 3PL6D 4G8FA 4FXGB 1T3FB 1IC1A 1RUAH 2RFXB 2WAHA 1F4XH 3EYUH 4KQ3H 3TEUA 4WUKL 2X4OB 3AY4A 4NWUL 2AJYH 5FYJD 3V95A 4N0YH 2J5LB 3OTTA 3FAXA 2O61A 1TCRB 3GHBH 4JM4H 1YJDH 2GY7B 4D2NA 3QCVH 2BMKB 4JRXB 1EBAA 5KJRL 3B2VL 5CP7B 1TTUA 1M05B 3TLRA 1DEDA 4P4RB 2DQEL 4PRID 1LWRA 4MXQD 2Q7NA 2AXGA 2ATPB 1RU9L 4P46C 5DURD 4JM2D 2R0LH 3RBSA 1WZ1L 5DEGB 2OSLB 1R3HA 3SDDA 4UT6L 3VWKA 3GSOB 5DT1L 2H41A 4OQTA 4P57A 3FONA 1KTDB 2X4QA 1AE6H 3T3PE 3GUTA 1CIUA 4HF5L 4W4OC 1JZ8A 2MKWA 4UAOC 2R4RL 1DEEB 2PTVA 4OCRH 1BJMA 5E08L 5D8JL 1H3UA 2VITA 5ADPL 2VABA 5E99L 5FB8B 4P4KB 4OFDA 3RWGB 4LKCB 3ZE0F 3L3KB 2VLKE 5JHDD 2XI9A 7CGTA 1YY8B 2DMKA 5JHLH 4XP4H 2HJKA 5MHSE 4OF8A 2G60H 2D7QA 3BZFB 4FFVC 4JVUA 4IRJC 1LO4H 5DWUH 4HS6B 2GTWA 5FEBA 4RGNC 3SDXE 4S1QL 5ANME 4YBHA 4N1HB 1A3QA 2NY2B 5GGQH 5KZCD 4KMLB 4WW1A 2FO1A 1JN6A 4LHUG 3B4NA 2XRAH 3IVKB 4WHDA 1NMBH 2BNRA 4QOKD 3U6RB 1H8OA 3ARGA 3F7YA 3W5MA 1YZZA 5FYKH 5HHMD 3T0DA 1KFAH 4X7FC 3JTTA 4J3TA 1A4JB 1HSAB 3TP4A 1DQJA 5JNYA 3QZWA 4JR9H 4LLMA 1N7MH 3A6BL 3LVEA 4Q9QL 1JHKH 4NN7B 5E5MA 1A4KA 1QRND 3VFSB 3OJMB 4DAGH 1V7ML 3CXDL 1Q1JH 3UPAA 1CXEA 4XCYB 1S7WA 5BJTA 1SJHA 5HHOD 3X3GL 5M94B 4UB0L 3NIGE 3VXMB 5ICYA 4MA1B 4LHQB 2JK5A 4WFFE 3TM6A 1RZKC 4N9OB 1ERNA 4FZEH 3HPLB 4FFVD 1FO0A 4IRJD 5KSAA 4MS8C 5HDQL 4NUGH 3HI6H 3ZE2F 1RK1A 4RGND 3SE9H 1MSPA 3CK0L 4F57L 2R0KH 2O5ZH 4NZRL 2BNQD 3BESR 4BFEA 1E4WH 1JIBA 4Z7VE 1B4JL 1ZA6B 3UPCA 4JFQB 1N6QL 2MCPH 3MJGX 3GMOB 3TWCH 4L4TE 2R15A 3D25B 5HYEA 4HIJB 3DX7B 1IQDA 3G6JE 2XN9E 2F54E 3MLSL 4GW1B 3DO3A 5EA0H 1JNHB 3GK8L 1D6EA 2F58L 2VXQH 1FZJB 4JANB 1U41A 4TVPE 2XKNB 4G6AC 4MA3B 1U91B 3EYOB 2LTQC 1RZGA 4TNWK 4MNHB 1NC2A 3OKNB 3ARXA 4EUPA 3BO8B 1T5WA 4Z78A 4PJ8B 5F9JB 1PKQA 1AGBB 4MS8D 2NXYB 3P9LA 5HYJE 5FF6A 2CKBH 3C09C 4WGVB 4QRSA 5T1DH 4CU7A 5FECB 1I3GH 1NBQA 5C0FB 3SCMD 1JMXA 2HJLB 3CFCH 3N9GH 5L88L 4ZD3L 3R06A 4JDZB 3SE8H 4P9MH 1OSZB 2JCCA 3QWQB 1JPST 1J0HA 4MA7H 1JGLH 5C6TL 1AGDA 5SWZB 5CEXB 5KAQF 1FORL 5FHBH 1XF4B 4K94H 3QA3B 4DGYH 1JUFA 3D6GA 5HHQB 4OF6A 3KPSD 1MLBB 4LEXH 4UV4H 3LH2H 5KSBA 1LEIA 1T7VA 1B0RA 1BJ1H 1F2XK 2CH8A 2F15A 1QLRA 2OTWB 5T1LD 4OFKA 1II4E 1P53A 2H26B 5DJZA 4G6AD 1FNAA 3FO9B 5DVMA 4W6XB 5TE4L 3RUGE 3GSQB 1B9ZA 1CLZL 5LGHL 5DJ6A 3QEQE 4IEFB 1KJ2B 5E8NB 2L7JA 5JXAL 3H9HA 4ZNEA 1VKXA 4K07A 3SKNA 3GIZL 1BECA 1MCJA 2AV1B 1H5BC 1KXVC 5K9KA 1S8DA 3T77B 4KI5F 1A3LL 4ODWA 1GGBL 5CUSL 3BDBA 3TCLB 3NFSL 4L4JA 5IF0B 3U0PB 2B20A 5ID0A 1MIML 5D1XA 4WUKH 3GMNA 3SO5A 5MEQA 3HAEG 2GHWB 3L3HB 4MX7B 5MEOA 3V7MA 3RWCB 3D3VD 1RUKH 3QG7H 4JY5L 5CS7A 3U9PL 4GKZA 4X9FA 2BDNL 1XIWB 3KPOA 4D0BB 1IRAY 4PR5A 4EDXB 3D39D 4FQXC 2DQEH 1QBLL 1V5JA 1MI5A 4OSUL 2FD6L 2VQ1B 4ONFH 4NC1E 1RU9H 4WHYH 5DEFB 5C1MB 2OTUB 1WZ1H 4FG6C 4LHUD 1XR8A 2A77L 5EIQA 4NFBA 4U1IA 5J6HA 1RK0A 1GGYA 5C9JB 3VW3L 1XGYH 3MUGB 3RWHA 4GKNB 2VYRE 4IIQC 5B22A 4CMHC 2M2DA 3MRIB 1J0ZA 1DQQA 1YMHB 5E08H 5D8JH 3W2DL 2PYEB 4Q0XL 4NHUA 1BBJA 5BQ7A 4LLMB 3TJHC 1R3IL 3CUPB 5I8CA 2GJ6A 5T3XL 3F12A 4D0DA 2APWA 4PJHE 4FMKA 4JKPH 1CF8H 2A73A 3HC4H 5F1NA 3SE4C 5D70H 3IDNB 5E6IA 2X70B 4Q9RL 1GGIL 3VH8B 3VGFA 5DD0H 4EEEA 4XVSL 4FQXD 1NCCH 4JO3H 4PV9A 3BIBX 3O6LH 3HI5H 4MJ5B 3NCBB 3TH2T 2P8PB 1BAFH 1XGRB 4YPGB 4I3SL 2V9RA 4JZNB 2M8XA 1YEKH 4MWFA 2BVTA 4JQXC 4S1RL 4FG6D 3AB0B 4X9IA 1NMCC 1QZ1A 2X09A 2J8UF 1T1WA 3MV9E 1DN2A 2WIMA 2YPLE 4PRBA 5L2KD 5D5MF 4G8EA 3F7VA 4L3CA 2J6EA 4LOUC 1P7QA 3BAEL 3CCHB 5IEKA 4K3DL 3OR7A 4KZEL 3DMMD 3A6BH 1Q0YL 3QJHA 4YWGL 5L8LB 3C8KB 3TJHD 5J1TC 1D6EB 3BQUA 4GAJH 3R0NA 3E6HA 3X3GH 1A7NH 4UB0H 3WIHA 3RTQA 5KOMC 2ZNWA 1OB1A 5JMRA 5TJWK 4WY7L 1FVCA 3MRHA 3JV4A 5D2LF 1RUML 2OMBA 4PJ9A 3KNBB 5BOZG 4CVUA 4JO1L 2VXSH 5IWLA 1RVFL 4M8QB 5SWSE 3AM8A 4F57H 5IW1B 2VOTA 3Q6FA 3PWPE 3H42L 2KDGA 5INDA 4ONHA 3HRZA 5HVHB 4TQEL 2IPKA 4P46B 2W65A 1CXKA 3NH7L 5EU5A 4XBGA 3BH8A 1FL3A 1VADA 4U1NA 1HCVA 4P5MA 4LOUD 1GIGL 4F9PC 3MLSH 2DDQL 3JUYA 4O2EA 3BE1L 3RDTB 2HRPH 3NZHL 2NTFA 3BEVA 4K71B 2X4PA 4I48B 2F74B 3QUMB 4XPFL 3PGCB 5I76B 4TSCL 1N5AB 1Y0LB 2ADFL 4U1GC 1FLRH 2IJ0C 4GW5A 2C9AA 3KJ6L 1DCLA 2ARWA 4OIIH 3KHOA 1KT2B 1DLHB 2WUCL 3GSWA 4OCSL 5BV7L 1F6AA 4NBYB 3X13A 2DL9A 3MBEB 5L88H 3MRPA 5E6ZA 4NHCL 3LD8C 3MLRH 4FFYL 5C0RH 4ODWB 3BGAA 4QT5B 3ULUC 3EZJB 5IHZB 3HNVL 1UJTA 1FORH 4QXTB 1SEBB 5AG9A 3DV6B 1P4LA 2QEJA 3I84A 5F7EH 3X3FH 1T1ZA 4ZOBA 4LLYA 2WW8A 3GMQB 2D03L 5FKAA 1IGFH 3L3OA 4JJ5B 2AKRA 3CLEH 5EZIH 3OJVC 3UPRB 5K9QG 1N2RB 3UC0H 5D96C 3MLTB 3HZVA 1ND0B 4ERSL 1WITA 4PJBA 2VLKD 2W07A 2YXMA 2V7HA 5JXAH 3M07A 3L5IA 3B9VA 3FT4A 1W72B 1XR8B 4QNPF 1U36A 4QKXB 1WK0A 5GRXG 5MHSD 3QNZA 1J18A 2HP4A 4YZFE 4U6YA 3KLSA 2XQYG 1YEJL 4OZFH 4N9GB 5F3HB 3ULVL 2HA1A 4NQDE 4QRRA 3K74B 4WUUE 5ACMA 4LLVB 4Y1AA 4TOYL 3GSVA 2OYPA 3PQYB 3G5YA 3A6OA 3C87A 4JREC 4WO4C 1KCSL 1HK6A 1N4XL 2H3NB 5JW4N 2IBZX 3R8QA 3W9EA 2R2BA 2A73B 1P7KB 5EOCJ 3SY0B 3SKUD 5MEPA 4HUVB 1K4DA 5A16B 4ODSH 1YMME 3WIFB 1A5FL 2FYYA 2WV3A 3O41A 5DC9B 4KGJA 1T0NA 1UWGL 3CDYA 4FXKB 4LDOB 5FUZH 5A2JH 1A7RL 1FNEB 3WJLA 3GMPB 5IGXL 1FC2D 1VGKB 4CVXB 4CADB 2CXKA 4H1LG 5IOPA 3WFHA 3VFPB 3QXDB 1J88A 3X14B 4YEEA 3HNTL 2HJFB 3RNQA 3MGOA 4I3GA 1J05A 1A9EA 4HG4K 1OGTA 2YPKA 4WO4D 4M4PA 1EFXA 1CN4A 1I8KB 3TBWB 1QEWB 4XXCA 2IANA 4L4TD 1FCGA 5HHPB 3C60B 1BFVH 1XGQB 1CI5A 2A83B 5I73B 2KBGA 2UUDK 2WBJD 5TH2B 4I18A 4IHOB 2XN9D 2F54D 3H9SE 1RZIB 3JV5A 5KAQG 5ALCL 4DK3A 3RP1A 5FK9B 1K4CA 1QFUL 4X4XB 4TVPD 4BK5A 4NO0D 4P2OD 3V0VA 3EO0B 2B7DT 2C3XA 3KPQA 5FO7B 4U33A 1Z6JT 5EU6B 3PJSB 2AGJL 4F2MA 3HCVA 5F1IB 1NAMB 1H15B 1G0DA 3EYSL 5DTFA 1CDHA 3ZO0A 3JUZA 4TN9A 3HPJA 4YHYC 5HYJD 2ZCLH 1FL3B 2VZTA 1RZ8A 4KZEH 4NSKA 4YWGH 3ARQA 4AM0A 4ELMF 1N3NA 1NLDH 4GRWB 5J9PA 1P9MC 4LGSB 4X80L 4JFHD 2GJZB 2IQ9H 2WWKT 2NTFB 12E8L 4PRHE 2AJXL 5CEZL 3MODL 5DUMH 4OLEA 1EXUA 5D7LA 4WY7H 5FV1L 1R3LB 3DXAE 1SY6A 3OG6B 3LN5B 1OARL 3ZKQD 1A14L 1BM3H 3IDMA 4HAGA 4YHPA 5J13B 2O93L 4PRDB 1CK0L 4BQ9A 4WV1C 3HE7B 4LNVA 1IILE 4G6JL 4QRTA 5KVEL 1LP9E 4TUJA 5DI8A 4NDMA 4RFEA 3HTLX 3S35L 1NL0H 3HZMA 1XF3A 4RMUA 1XGUB 3IXAA 4NC1C 4YDLC 4CNIB 1LE9B 4TQEH 2EXYC 4P23A 3BT2H 3QEQD 3O8XC 3BP6A 2X4SB 4GLRI 2F8VA 5CJOH 5FCSH 4HBQA 4YDVB 3K1DA 1IL1B 3RL2B 4FQHA 1GIGH 5LXGL 2Q3ZA 2HFTA 2DDQH 1JZ5A 3C6SA 5DDHA 3ZZ1A 3UTTB 3BE1H 4EI5B 5JW5B 3D2UD 1IAOB 3SQOH 4XP6L 3NZHH 3O0RH 3Q5TA 5ILTH 2NY5C 4H26B 5FKAB 3IAPA 1CFVH 4NIKB 2AKRB 4XPFH 3QUYD 3RNKA 3P0VL 2R2EB 1I7RB 2ADFH 3IU3A 1IZKA 4Z76B 2DWEB 3QWOA 5CIPA 5FCUH 4XGZA 2IH1A 4Z7QF 3VXSA 1MCPL 1KTLB 3D0VB 4JZOB 2VXTL 3FT4B 4XWOC 2Y6SC 1HKFA 4OCSH 3QFJA 4MD5B 3K8MA 3ES6A 3B43A 4UU9B 1FFNA 3DHJA 3QIUA 3ULSB 3BN9D 2R2CA 5I15H 5BZWA 1IGTA 1VCAA 1MCIA 5HHNA 1WWCA 4FFYH 5EUOF 5I1HL 2I07A 3NIDE 4PTTB 4ODTL 2EXYD 4PBVC 3O8XD 3HNVH 3STLA 1N6UA 2ZOLA 1I9JL 1IAKA 4RWYL 4IS6B 5IIEB 4L8CA 3O3DA 4NO2B 1XGTA 3VXRB 4S10A 5CZKA 1VACA 1I3UA 1TCMA 2D03H 5ACLA 3DX9A 3U82B 1FSKC 1ZXQA 3L5JA 2B1HL 5TQ0L 1DQLL 1OCWH 3GHEL 4YFLI 1OF2B 5FDWA 2P24B 2CRZA 2VAJA 1WCBA 1WFTA 3MYZA 3IDJA 2FJGA 1V8HA 3KXFA 5GS1C 4JEGB 5GZND 1DL7L 1NQBA 4MNQD 1NBZA 3BPNC 32C2A 3W39B 4C4KO 5K33A 1YEHL 2VDQL 5M95B 4XWOD 2Y6SD 4OB5L 4HKBA 4BH8B 3QQ4B 4QLRA 1KJ2L 4XAKD 4EBQL 1UWXH 1QPPA 3L1OL 4LLQB 5GGRY 2ZCKL 3UTZA 5I8EB 5DS8A 4LPTA 1CICC 1D5ZB 1MFBL 1P84J 3HUJE 4PG9B 4GG6B 2GEEA 5IR1A 5T5FL 3WE6B 2ZPKH 2ZSWA 1JVKA 1MCOL 3K4ZA 4JRYD 4OKVA 1DVFB 5GS3A 3HG1E 3MV9D 2YPLD 1EEQA 3HKFA 1IQWL 4MAYB 2ADIB 5F89A 3MV11 4Q97A 4LAQL 4KK6C 4P2QE 4C83A 1MHHA 3RVVC 4Y7MA 4M00A 4WU5A 1UKQA 1UWGH 5DXWA 3FRPG 2FJHB 1A7RH 4M02A 4I0PD 5IVXE 4YXHH 1SBBA 2BXZA 4E42A 4Y5VB 4YHIB 3TBYA 5GJTL 1RHHB 3MRGA 3OB0H 4UV7L 3M1BB 4Y2OA 5HHVH 3ARFA 5I16A 3HNTH 3KVQA 1F6FB 1MJUL 3BDYL 5SWSD 3OKDB 3TH4T 2B4CL 3VFNB 5TGBB 1D9KC 1MHEB 1WBZA 4NSKB 4X7CC 1CICD 4PJ5A 3PWPD 3VDCA 4YFEA 3V4PL 3QBTB 3EOAA 2PCPA 1KLGB 1T03L 3RAJL 1F4WH 3VFVA 2W0KA 1WSST 3JWDC 3RVWC 4GKSA 3OQ3B 3BN3B 3NGBC 3MV7E 5MENA 1D5XB 2E7MA 1J1XL 5DO2C 3MA9L 4S0TD 3MLZL 3CFKA 3RVVD 2N7BA 1HHHB 2VDLL 4I8DA 1K2DA 2PTTA 2XTJE 2F19L 4L8SA 4P3DA 2C4XA 4U7SA 5DI8B 3QXUA 1CDJA 1JPGB 2X89D 3HA0A 5D96B 3UROR 4OCYH 1IC7L 4R3SA 1X4YA 4LU5H 1HHJA 2DLFL 3TN0C 2W9EL 1J7VR 3O11B 4ZUWA 2FJFB 5JO5B 3QDJB 4HH9A 2BVOB 4JE4B 4WFEE 1D9KD 1NANI 3MROA 1KLUA 4J2XA 4X80H 5EUKA 5DMIH 5IKCA 3O4LA 1ZGLA 4M7ZB 12E8H 3JTSA 2HT2C 3DVGA 1AQDA 4I5BB 2R0WL 4PJFE 3CIQA 3VFOA 3RVWD 1M71B 2P42B 4DUVA 3BW9B 1VA9A 2IFFL 1J0KA 4XPTH 1RQ5A 4N0RA 4K8RH 4Q2ZB 1FFPA 1F3RB 1MFEL 1ZHLA 3DYOA 4A2MA 5ESQB 1CK0H 1A2YA 1LEGA 4BA8A 4NN6B 3AREA 3PP3K 1J8HB 1CU4L 2W60B 3KWWA 3MLYL 1X5AA 4WI8A 2F5AL 5C0CE 5C0BE 1ACZA 1AGFA 4ZTPL 4G6KL 4RDQF 2R1XB 1IC5H 4XMPL 3TN0D 3MRDA 4TRPH 1KXQE 3IFOA 2HFEA 5I17A 1U3HB 3BKCH 3V8CA 1G7PA 4OZHE 5DVOA 2P7TB 5FGCE 5DHVH 1VACB 4ENEC 4NQDD 5EZJA 3KYOA 3RGVB 4WUUD 1H3WM 5C3TA 1MPAL 2HT2D 3T2NL 3P0VH 5ADOH 5J57B 3VXPA 4L1DA 3FB8B 3O2WL 1I8MA 1WFUA 1WCBB 5FUOH 5GGVL 4HKZB 4LP4A 4C56A 1GL4B 3TH3T 3SQBA 3QUML 1MCPH 5I1AA 3REWB 2JELH 1EHXA 3GBLA 5KVFL 3HZYA 3B5HA 3FB5B 4LVOC 4J12A 3OHXB 4OLVL 1AXTL 1H8NA 1YMMD 4TVSa 1Q9WA 1G7IB 2HFFA 2ADGA 3BZ4A 1KV3A 1QHOA 3LHPL 4GAGH 4ZYKA 3B9KA 4NKIH 4NPYA 3O3AA 5JOFB 2JF1A 3P40A 1DZBA 2W9LA 5I8KH 3TIEA 2PTUA 2VL5A 3U0WL 3UBXG 3TYGL 1JWMA 4NC0B 2FECI 3T8XA