4P5MB

Structural basis of chronic beryllium disease: bridging the gap between allergic hypersensitivity and autoimmunity
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
212
structure length
199
Chain Sequence
QAYDGKDYIALKGPENYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
molecule tags Immune system
source organism Homo sapiens
total genus 43
structure length 199
sequence length 212
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p5mB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p5mB01
4JB9L 3ZYJA 1QD0A 1LK2B 4KKBD 2KUTA 5IHBA 5D7IA 2G5RA 1G9NH 4LLMA 4N90D 1CL7L 5EZLA 2VE6A 4KK5C 3WN5A 4FNLL 3BP4B 1PVHA 4HW6A 1A4JB 1OWWA 5EOCJ 4HS8H 4ZD3L 5JXEA 1OQOA 3D9AL 3GMNB 3UBXI 5I1JL 3UYRL 3QJHA 4KDWA 1KLGB 4M1CD 4X7SL 1U8PB 4ODBD 3D85B 4CJ1A 1UM6H 4DUXA 4EI5B 1G9NC 3ZDYE 3GKWH 3LKQB 1UEMA 4C56D 1HYRC 1U2CA 3FKUS 5IOPB 4ZFFB 4KI5E 4KTEH 3MRQA 4OUOA 1HYSD 1FYHB 4ODVH 2DMKA 5MI0B 1CR9L 5TE7L 5F9WC 3PIQB 1A6WL 2ORBH 4U4BA 1DQLH 1G9EA 5IKCB 4JFEE 4ODHL 1A02N 5A40E 1PAMA 4MCZB 1GOFA 1QEWB 4KQ4L 5EC1A 3T4YA 4X4YA 1L9NA 4Y5YB 3VWJB 1RIVL 3B43A 5ACLA 3MRHB 4KGLA 4RBPK 3K2UH 4X6DB 5M94B 1R3KB 1T80A 2P46B 3CFEB 1F00I 4LHQB 4G8GB 3U1SH 4OSUH 4G7YH 3RDTB 4HC1H 1JK8B 1NAMH 1T21A 4J3WA 2VLRA 3PGDB 3QDGD 3LS5L 3PUCA 3JV5A 2QV2A 2OZ4A 3LRSB 1C08B 2GTWB 4N9GA 4PRDA 4OZHF 2A6DB 3SCMC 4F33B 4U7KA 3O3BA 5GS1A 1UA6L 3TYGL 2CRYA 1UKSA 1Y0LB 2Y25A 1J12A 4LCYB 3RWFB 2XACC 2HMID 3TCLB 4EUPA 5DXWA 4X9HA 5JQHC 4X5LA 4J1UA 4PJFE 1GRWA 4HBCH 4X80H 5TDOB 5CKAA 2YD5A 5D7IE 4HK0B 1YEGL 1N0XH 2OQJB 1P6AB 3HAEH 5DR5H 5DQJA 3KYNB 2E7MA 3EUUA 5C6PB 1GXEA 3LKPB 5BVPL 4L9LA 2AV7B 1MCBA 3P0VL 1D6VH 4UU9A 4OF3A 3DBXB 4U1NA 2ZUQB 1VSCA 4JZNA 3BZ4A 1MFAL 3T2PA 3TN0A 4GMTL 1T89A 4LARH 4JHWH 4M6OH 5ESQA 5C07B 1FO0L 4LVHB 1ETZB 1Q9KB 5CHNA 4B53A 3OJ2C 2DQUH 4PGBB 5DDHA 3E6HA 1CDCA 2X4TB 4WV1A 2Z35B 4EUPG 5B8CC 3OHXB 4L5FL 3QA3A 4IOIA 1JGVL 1INEL 3L3OA 3V5DA 2VLJD 4APQA 1WWBX 4LSUH 1WWAX 1MFEH 3CUPA 2NY3B 3QCTH 1LEIA 3PL6C 5JXAL 4RAVB 2ADIB 1KG0A 3WKMH 1MJUH 4HUUB 3OAYH 4Y2DD 1I9JL 1DEEB 2R0KL 4WNQA 1OHQA 5C0BD 2BNRA 3UZQA 5JZ7C 2VZUA 1K85A 1WBXB 1K6QL 4TNWK 3U79A 2OYPA 1BJ8A 1TJHH 4J4PA 5EBWA 3U0WL 4YXHL 5SV3A 4OCYH 2BVQA 2CIKB 3BH9A 2WLZA 2VLRE 2D9CA 1IAOB 2H6PA 2J8HA 4GXUN 3CIQA 1T0PB 1MREH 1KOAA 2P42B 3MJ9A 4JFDA 4UDTA 4JFFB 5AYUL 2WUCH 5HHOD 1E4XH 3CFBB 3UJTL 1KIRA 3GJEB 3BMVA 4NN5C 4AH2A 2VJXA 1CICB 2CLRB 5D7LB 2DM2A 4I0PA 4NM8H 5FHBL 4P4KD 5DURD 5GJSL 3KYOA 1X6NA 1F11B 3F7PC 1R3IH 1IC7L 4NBXB 3CK0L 4L8SC 4YHPA 4Q2ZA 4E9LA 4Y4FC 3LAFA 4DZBB 1CK0H 1I7RB 3LKSB 2JF1A 3FQXA 4WDIA 1ZLSL 4ODSL 1ZHKB 4HIJA 1E6OL 5E00B 2DI7A 4ONHB 4MXWL 4G8EA 3BWAA 4AM0A 4L29B 3CGTA 4K2UL 5L6YH 3QIWC 5FXCH 1T04B 3HI6L 5MENB 5A3ID 2JIXB 5L2JB 1F4XL 3QEHA 2XY2A 5ESAA 5HI3C 4F9LA 1DEDA 3OKKA 2AVGA 4WJ5B 4JFXB 5FYLL 4JPIA 3X3GL 1DDHB 1TFHA 1UG9A 4JLRB 2IQAB 4EN3D 5FGSA 1W0WB 1R24A 4OZGF 3TT3L 1FV1A 4WHYH 4XRCA 1DL7H 1A7OH 3VGAB 4DZ8B 5J9PB 3F12A 3GJFK 4GAYB 2WMPA 3OR6A 3W5MA 1QFWL 3IJHB 5E7BA 4X4XB 1MNUH 1CE1L 1WEJL 1FSKC 4OZGB 1PX3A 3VFPA 4R7NA 5C9JA 2UUDH 5DK0A 3HPLB 2BNRE 1VADA 1UJ3A 1UCBH 3NZHL 5L8JB 1TIUA 3TBWA 1KPRA 4XNZB 3TH4T 1WZLA 1ZGLB 5FM4A 2NY6B 4RX4D 3BIBX 5SV4A 1YMMA 4RGNB 4WU7B 1T7ZA 2X42A 4M3KB 2Q6WB 3QXTA 2GJ6D 4NJAH 3O6FD 4NYLA 2KPNA 3CVIH 2X4OA 1NDGB 3K74B 5ILTL 4FABH 1XGQB 5HI4C 1AFVL 4CVWA 3ROOB 4J8RA 4NN6C 1TETH 4JFDE 4HIHA 4P2QB 4YDVB 1AJ7L 5AYQA 2ED7A 3L95B 3KS0J 2WBKA 2B39A 4WTXA 3VWKB 1INDH 5DHVA 5DYOB 1MVUA 2GW5A 2HN7B 1T5XB 3MLYH 4K71B 1JYNA 3FQNB 3MO1B 4XMLL 1D5BB 1FZJB 2ZKHL 1NBZB 4CADB 4EQ2A 1HWHB 2EYSA 2W59A 5T3ZE 1ZANL 3ESVF 4P5MB 2B4CL 4EOWH 1QLRB 4POZD 2AEPL 4PS4L 4TSAL 5KVGL 5CWSA 4OF5A 1J1PL 5CFHA 2VLMD 4LOUC 4DTGL 1BFTA 2X1PA 3IRZA 4HFWB 3BP6B 4HUVA 2QTEA 3P2TA 3VA2C 1IL1B 1G6RB 1NDMA 3TBVB 4GQ9L 3SGEI 4LP5A 4JZJB 5EOTB 4NC1C 1ERNA 4YC2C 4XX1G 4XVSL 4MJIA 4OD2B 2JB5H 1AXSA 3KJ6H 3NZ8A 2IPTL 1KCUH 1RU9L 5CJOL 1FL6A 2APFA 2NXYB 4QHKI 2PYFB 3IT8D 2NYYD 4JO4L 5IG7A 3GIZH 4LLMB 4TQEH 2VE6B 3QJFA 4U6VH 4X6CF 3OG6B 1IQDA 3CH1A 3W5NA 5JW4N 1FCGA 4ONFH 1QPPA 1YMME 5L8KB 1FNAA 1BVLA 1TXKA 4X6CB 5KJRL 1NCCH 4I3RL 3MR9A 4FQ2L 1T1ZB 4K3HA 1VFOA 1B4RA 4OF8A 3X12A 2W60B 2YK1L 3RWIA 5HGDA 1XIWA 1DVFA 3EYVB 2EO9A 4JHAL 1MHCA 2B1AH 3CFDA 1MCEA 3GMPB 4GAJL 4P9HH 1KN2L 2VAJA 4YIQB 1ED3B 4XX1E 3VRJB 2ZNXA 3RAJH 2Q86A 4TVSa 4X4YB 3T4YB 4GW5A 4P2RA 5D93C 4YUEH 1GGIL 4UOW0 3GJFA 2CPCA 4JDTH 1RIHL 1BF2A 1RUKL 1N5YL 4RIRA 4R7DA 3MGTB 3L5HA 1ZVHA 3O9WD 3KYAA 5LGKA 3QCUH 3KGRA 4ODTH 1IT9L 3M17B 4F7MA 3WXVL 2ZUYA 3JWDL 4X6EB 2FBJH 1WBZA 2NW2A 5DJZB 3GSOB 4MMZC 5GSVB 5MEPA 3T0EC 1CN4A 2W92A 4W4OC 3MRJB 1S7UB 4PR5B 3ARQA 2BVPB 3I6GA 5E4IA 4MJIE 3UJJH 4EBQL 1U3HD 1A7PH 1QHOA 1KEML 3I75A 4HIEA 2LVCA 3H7BB 4P48A 4XCNA 3D0LA 4EUPB 5DMIL 2C3XA 2AGJH 2EE3A 4NDMB 4WW2C 3DHJA 5MEOB 1BAFL 1MQKH 4QTHA 1JE6A 4JR9L 2Q7NA 3S96A 3H9YA 2NY5H 1J8HA 1C12A 1AGBB 4NGHH 4Y4KA 1RUAL 3F7VB 1RZFH 3QXDB 5EUOA 3WFCL 4RMRA 2H3NB 4JCMA 4HJJL 3LMJH 4U1NB 2UVEA 4PJAF 3GSNA 3VG9C 4C4KO 1GGUA 1OM3H 1KCVH 3TN0B 3EZJB 4JREB 2OTWA 3NFNB 4PJXE 5HGAB 3VI4F 2CKBL 4UNUA 3IXAB 2VL5A 5EUKA 1I3RB 5SWZD 3N1MC 5HDBF 3AREA 3E6HB 4WV1B 5T1KD 1Q9OB 2VN7A 4LSSH 3JTTA 2NNAA 4BFIA 3V4VL 3VFOA 3QA3B 2LTQC 1S7SA 4KROB 3WSQL 3L3OB 4LBEA 3VMNA 4APQB 5IQ7L 1TTFA 4N8VA 2W0FB 3PP4L 4N1CA 4NNYA 4M1GH 1KG0B 2DWDA 4P2RE 3PWUA 3NCCB 4WNQB 2B5IB 4KZDH 5M95B 1U42A 4I18B 2BRRL 4JO1L 2BNRB 3L6FA 4RMSA 3QNXA 5D2NB 4OF0A 4MD0A 2P8PA 1P4LB 3O8XD 1NCDL 2A73B 2Q76A 1P6FA 4Q97A 5IB4A 4QYOB 3PJSA 4UUJB 3MRBB 1P7KA 3S35H 3ARFD 3TV3H 2DBJA 3ZKNC 5C0DA 1NLDL 1GSMA 4N8VG 4QXGH 5GGTA 3ZTNH 3L3GA 3DVFA 4DOHB 2OMNA 3L3JA 2R69L 5MHSE 4RFNB 1D7FA 2HKFL 3HI5H 2AXJA 1S7XB 4NOBA 4AH2B 4A6YL 4AIXA 4DN3L 3OJDB 4MAYA 1OAKH 1EH9A 2BJML 4LDOB 5DUPL 1N3NB 4NWTH 4I48A 1QUNA 1UT9A 3NCJH 4CDHA 1G7IA 1NGWA 2P5WD 3OJVC 4NRZA 3VJ6A 1J8HE 4YFLI 2OK0L 4YHPB 1G9ML 3V7MA 2P47B 5EUOE 2ZNWA 4WDIB 2EDYA 5AG8A 4HIJB 7FABL 4UTBH 4KUCD 2DQFB 3SDAD 1VHPA 2PO6A 3QG7L 3OKLB 1NJ9A 2Z4QB 1GJIA 1EK3A 4GS7B 2FL5B 2GJZB 5J6GA 2MHAA 4P2OA 2DI9A 3QEHB 1NGQL 3BZEB 4HK3N 4IOFC 5JUEL 3QNYB 2AW2A 3RIFF 4JPIB 4MYWB 5CCKH 4TTDD 4K9EH 1FGVL 4Y4HC 4AK1A 1CD1A 3DX8A 3T2NH 3FFCA 5JR1H 4KJYA 3D3VA 4JFHD 4XRCB 4UI2A 1JHLL 2FX8L 2BNQB 3CMOH 4M48H 3TWCL 1S9WA 4OKVA 2FR4A 2W07A 3OKNA 4ZTOL 1BM3L 2C9AA 2SEBB 3V0WL 4XBGB 3EAKA 2H26A 5CSGA 4R7NB 3VFPB 5C9JB 3BO8B 3QSKB 4HDIB 5FKAA 4MA3A 5IT2L 2Y7QA 1NAKL 2IH1A 1MCIA 1UJ3B 1FCCA 3C60B 3QFDA 4K9EC 1PBYA 1R3LA 3KPQA 5TH2A 1ZHNA 1KPRB 4N0YL 4U6HA 1JNLH 4LK4A 5E0QA 3MUZ1 3L3HA 3D9AH 3GIVA 4QRSA 1CFQA 1DP0A 4MA1C 1D6EB 4BZ1L 3O3EB 4X7DC 4ONOA 4Z77A 1H8NA 3VDBA 3GSWA 4HKXA 2QR0A 1EX0A 3RWDB 4R4BA 3MV8B 5FM5M 4GG8B 3QZWA 3G08A 4KMLB 1QLFA 5CEYA 1JPGB 1TDQA 2JTDA 2IBZY 1IC5L 3EHBC 4WO4C 4ETYA 4PGZA 3ZTJG 4ZNCD 2Y9RT 3Q5OA 2P49B 3IDMB 2FWOA 2DLIA 4W68A 1SJEB 3DVGA 3K4DA 3MX0A 4ZPTB 1JRHI 3C5SA 5EOQH 3EYFA 3GBLA 3PHOA 1AHWA 2AAVA 3UC0H 2G5BA 1FORH 2CRZA 2K7PA 4UINH 4XAKE 3DX9B 4CW1B 4YEFA 3DMMA 2XTLA 4Z0XB 1JPTL 3QZWG 2A9NH 1PG7H 1EMTH 2FEEI 1V3MA 1YC8A 3RWGB 4HUVB 5ERWA 4JN2B 2WWMC 4YAQB 2X89D 4UIMA 2MKWA 3C08H 4KJPC 4P0DA 4S11A 5B4MC 3BN3B 1Z0NA 4HAGA 4B5EA 5BXFA 1UA6H 3UTQA 4HHAA 3CMGA 4U6XA 2EIZA 3FFCE 2VLLA 1AXSB 3D3VE 2PNDA 5ICZA 3CVHA 1PSKH 3QUXC 1NC4D 5IM7A 1CGWA 1LWRA 5F9DC 4H88H 5D6DA 2XN9B 4LU5L 3CH1B 4ZSOB 3IETA 4ZFZB 3WBDA 4MNQA 3FMGL 4M5YL 2OR9H 4TSCH 2Z91A 4KK9C 1MFAH 2IPKA 3PGCB 4QHUA 1SYSA 2Z93A 2AI0H 5HDLA 1FO0H 1GGTA 2HKHL 4GO6B 4J3UA 3MQIA 5DRNA 43CAB 1GYAA 2CK0H 4M61A 4C57C 5HGDB 1XIWB 1MJ8L 4YFEA 3QFJB 3H3PL 4L5FH 1IGMH 1FIEA 1RK1A 1LE5A 1INEH 3MRGB 5DD3H 1F90L 4Z5RB 3CFDB 3AFLA 1YJDL 2MFNA 3ULVD 3IXTB 2H2PC 3GM8A 4P5TD 4F15B 1XF5B 4F7TB 4D9LL 1ITBB 5E4EB 3RU8H 3WCYA 1IGCL 3WNLA 3EYQC 3KAAA 2COQA 4FQXD 4P2RB 5DSCA 5GJTH 3MLRL 3GJFB 1EFXD 5DJ0B 1JF5A 3FZUD 1RZIA 4RIRB 4LLUA 4R7DB 1CT8A 5H94A 2DKUA 3FT4A 4Y8DC 3U0WH 5BZDB 5I6XC 3DNKA 1V7ML 2A0LC 2C3VA 5KANG 3IJSB 1IZJA 3VFWB 3KR3L 3RWJA 4BUGA 1VKXA 2NW2B 4YDLB 2XNAB 4NQDA 3QIUA 1F97A 2VN4A 1U2HA 1E4KC 1XCTA 2WWKO 5D72H 1YQVH 2O61A 2P8LA 2ZPKH 4ZAKC 3SE4C 2DICA 5I71C 3I6GB 3S9DB 2NZ9D 1F3RB 2V2XB 3MACH 1T03H 3I75B 3RTQB 5E6IA 1BPVA 3VW3H 3IB4A 5GJSH 3PQYD 4QNPF 3MV01 3STBA 3LPGA 3FN9A 2GCYA 4R26H 3S96B 3ROLB 3CK0H 1C12B 2EDXA 2HP4A 3ARDD 3W0WA 3KHOA 1QBBA 2AXFA 1OAXL 1ZLSH 3MOBL 4ODSH 5AZEH 3MLZH 3V4UL 1II4E 1I8MA 5CSZA 4MNQE 3C5ZD 4O2EA 4MXWH 4MJ6A 5EN2B 1CFNB 2YPLB 4BSJA 1VFMA 3H6JA 4OIAA 5IQ9B 3BP7B 2OTWB 2GSIA 1TVHA 5I9QB 5DVLA 5EUKB 5J7CC 4AENA 4P59H 1CDGA 2V2TA 1G0DA 2OL3L 5JHLL 2CUMA 2APXA 2KBGA 1X5YA 1S7SB 5DZNA 2JB6B 5INDA 1LHZA 4LCIL 3WE6A 2VXSH 5KZCB 1QTYT 4FHBD 4RMVA 4U1KB 2Z9TA 4N8VB 4JPVH 4OQ1A 4NNYB 4G7VL 2VC2L 4NRXB 3V6OC 3SDXF 1OAUH 2V7HB 1D5XA 1WEJH 4JQIH 1DUZA 1K8IA 4RQQB 1A3LL 4GG6F 1T7YA 4S1QL 5HD8D 1IJ9A 2VXTL 2MKLC 1YN6A 2QLVB 3OL2A 3U36B 3I02A 3KPSA 2Q76B 5E8OA 3PWPD 4GG6B 2GK2A 5EIVA 3FHQA 2XWTA 3ARUA 5LBSH 5IB4B 3S88H 3PJSB 1P7KB 4LEOA 3SKJL 4ZUWA 1XGTA 5GZNC 4NQDE 3TJHD 3UAJD 1AQKH 3KLSA 1OARL 4X4ZA 5EPMB 5C0DB 1AFVH 1R3JA 3L3GB 1AJ7H 3VGFA 3L3JB 2FIKB 1T7WA 4JFOA 2EZ0D 5TGBA 3AM8C 3WFEH 5TFSH 5I2IB 5IW1B 1AD9B 2E6PA 3BRDA 2GUOA 3SGEH 3TJEH 3B9VA 3IGAB 3SCMA 5EBGA 4AL8H 3MRRA 5GRVL 2I27N 1DFBL 1KGCD 1X9QA 4I48B 4M9OA 3KPRA 1LO5A 5T5FL 4HC1A 4QTIH 1NAMA 3IKCA 4YJZL 1ZANH 2BSSA 3W0WE 2CDEA 1KENL 2NZIA 4DGVL 3LEYH 1HINL 1KEGH 4UILH 3MYZA 1UM5L 4GMSL 4V1DA 1J0JA 3O4LA 2YUVA 3Q3GB 4TSAH 5KVGH 3ARBC 1KACB 4GW4B 4P2CG 3FO0L 4LLAA 1A14L 1U9KA 2DL9A 4M7JL 3DVNB 3BD5A 4WI4A 1WZ1H 2UUDK 1LEKA 2MHAB 4P2OB 4X6FA 1DBJH 3B5TA 1U8QA 2Z31D 3CX2A 2L0DA 4GQ9H 3HAEA 5B38G 3SDYH 1KCSL 4ZO8A 1MOEA 5CGTA 2HMIC 3NIGF 3FFCB 5B8CA 5F9JB 5CEZH 3P11L 4TN9A 5DD6A 4UQ3B 4BKLB 3MMEB 2FJFA 2FLRT 4YK4C 3IDNA 4OKVB 2FR4B 4IJ3C 3PL6A 4JO4H 4MD5A 3FQWA 1F5WA 3ILPB 3MUY1 1K4CA 2IH1B 2M26A 5DTFA 4Q58C 3KPQB 1R3LB 1CLZH 5TH2B 1YNLL 4OCLC 1C5DA 4K23L 4W6YB 2EDKA 2OS7A 3KPSE 2W0KA 1S9YA 1B2WH 4X9BA 1Z5LB 3BYYA 3BE1L 2YWZA 1KLFA 2VOTA 1CFQB 2XG5A 4LSPL 2J12B 3NFSH 4QRSB 5CD5C 4I3RH 5IFJB 4FQ2H 4Z77B 5E5MA 4FQJL 1P2CA 2YMXH 4O5LH 1FFPB 3S36X 5GGUA 3GRWL 1Q1JL 3TNMA 3EJZD 5T1MA 1GZPA 3QZWB 3QXUA 2HT4D 2ZP0T 4NO0D 1QLFB 2Y6SD 5CEYB 4GSDL 2JJSA 5KVEL 2D0FA 2R29H 1NEUA 2YEZA 1A6VL 5TQ0L 1FG9C 4AIZB 4PRBA 1J11A 1KN2H 2LAAA 4ZUUB 4Y2DC 4OLXL 3KPRE 4LPUA 4R9HA 2IQ9H 1G7JA 2R2BA 3EYFB 1OGAD 1I75A 3GMLA 4EDXB 3PHOB 1XCQB 4FTVD 1N6QL 2G5BB 5J11C 3VFRB 4V1DE 4L8SA 1RIHH 1SBSL 1N5YH 3O4LE 4TUKH 4HPYH 1A6TA 2YA2A 4Y4FA 4ZO6A 4TSBH 1I85A 3MLXL 1JNJA 4GKOA 3DMMB 4O2FA 3MOAL 4NQCD 3P4NA 5LXGL 1HXYB 3CDYA 4MXVF 4P3CH 3RKPA 3P30H 2YPVH 3ARGD 1RQ5A 2X9XA 3QDGB 5ERWB 4UIMB 1UZ8A 3DYPA 5DJXB 1EV2E 4Z7QE 5IMOA 1L0YA 5E03A 4KQ3H 5FA3A 1FNHA 4RWHA 3NABL 2EXWD 3UTQB 3PG2A 1SEBA 4EBQH 1FZOA 25C8L 3RP1A 1HQRA 3C8HA 5I76A 1XGRA 5IM7B 4JR9H 4RMTA 1P1ZB 2C7UA 1JZ7A 4IS6A 2NCMA 4YDIL 1HXMA 2R8SL 3MV9D 3O11A 4A2MA 5FYLD 3FQRB 4MNQB 1MCOH 1UB6B 3RGVC 3O3UN 1H8SA 2IPKB 3SJVA 4OIBA 5DRWB 5IJVA 2Z93B 4HKBA 1AGDA 4M8VA 1FIGH 2ICWA 2UZXB 4ZDHA 2P8MB 4RFEA 5F3HA 1D9KC 4BH8A 4Z8FL 1RAMA 5AWNH 3B9AA 1NKOA 4RRPG 4R8WL 2W0PA 3ALPA 1QRNA 4GXVL 5C0CB 4ZFGL 2VLJB 5IQ7H 5FYJH 4JPWH 4M7ZB 4PRIA 1JF1A 1YEKL 5EWIL 1IEBB 3VGDA 2XZQL 3NMEA 1F4YH 3F58L 1S5HA 2XKSA 4OBSA 4JG0H 1OSZA 1KTRL 5C0BB 5C9KA 4JO1H 4M02A 3LPFA 4HH9A 2QQNL 2AQ1A 4HLZH 4LLUB 2HVKB 2E9JA 2QKIA 5IFHH 4QHKJ 4M7LL 1AO7A 3RZWA 35C8H 3O6FC 3U30B 5I1GH 1U8KB 3HNVH 4KVCH 1VKXB 3RHWF 4J3SA 1N4XH 1MHPH 1XCTB 3MREB 5GGRY 3MNZA 2EEDA 2L4OA 3ARTA 4PLNC 3AXLA 2VQ1B 5I1AA 1KT2B 3BDXA 5HHOB 5IFAH 4HS3B 3NTCL 2HKFH 1FFQA 4U1SA 3SY0A 1NFIB 3DGGA 2Q3ZA 1KYOJ 4Y5VC 3PV6B 2NMSA 1REIA 2APTA 3IDGB 1FJ1B 4LSRL 2B20A 3HS0A 2VO5A 2BJMH 3SGDI 4JM2A 3MLPA 1RIUL 1H5BC 2GCYB 3MA7B 5FDWA 1A7NL 3MLVH 5JOFB 5CP7A 2AXGA 3TO4A 5K59F 1H3WM 3VFUA 2P44B 1UCTA 3O2DH 2AXFB 4FXGA 4LAJH 3QI9D 1H8OA 5HHQA 1YEJL 3V6FB 3QDMA 1I8MB 4YLQT 5ESVB 3F62A 1YYMH 3FCTB 5D1XB 4MJ6B 1C1EL 2ZZUT 3SJVE 5JW5A 3WUWG 1BWMA 5JW3L 3QG7H 4KY1L 4PTTA 5HHME 1T6WA 2GSIB 4CVZB 1S8DB 5CJQL 4D8PA 2HLFC 4CMHC 1NGQH 5IB1A 4KZEH 4UT7H 5DD5H 5JUEH 1J1OL 1D5ZB 1H0DB 2BOBB 4MB4A 3MJ6A 4MWFB 3FT2A 1QRNE 1UZ6E 5D70L 3PF2A 2XFXB 3T0XA 1GPOL 5GGQH 4EN3B 1I7UA 4RZCB 4IHOA 2A83A 3DYOA 2WBJD 2DYPA 4JDZA 4PRIE 4OCXL 5IMMA 4LSTH 2DBLL 4AEIL 1JUFA 1XT5A 4PRHA 4KVNL 2A6JA 3B9KD 1IKFL 3OSKA 2IGFL 1D5XB 3QXWA 4PG2C 1K8IB 1JRHH 5D7SH 1U8JA 1FPTL 1MI5A 1I1AB 2QQQA 4HWZA 1O7SA 2VDLH 1YN6B 4GKNA 1YPZF 3IU4H 1MCNA 1NEZG 3L3KA 1QHPA 1UYWH 4PTUA 1AO7E 1MY5A 3AROA 5K9QI 5IMLA 4I4WB 2A77H 4Z78A 1AP2A 5LQBL 4NOFA 1WK0A 3NFPA 5I18H 3CC5B 1FDLH 2WANA 4ZUWB 1PGRB 1XGTB 5EZJA 5EC2A 4YFLF 4M43L 3BPLB 5CD3B 3ORJA 3I6KA 3RJDA 4LLWB 4U3CA 5D2LB 5INCB 5AAMA 1YC7A 3PWLB 1CXKA 4H1LH 1BZQK 3MOQA 4UV7L 2GUOB 5I1LB 3QCVH 4ISVA 1IC5H 1NMBL 4J6RL 4W4OA 1X4ZA 1AH1A 1F8TL 5FFLA 1EA9C 4NC1E 5BCAA 3TBYA 2YWYA 2IAMD 3H9ZA 2WIIA 1J0IA 1I8KB 4JRYA 5B38B 3GI9H 4OV5B 4HLJA 4P49A 1MIEL 2FX7H 4TULH 3W81A 2AV1B 1L0XA 4WW2A 3SOBH 2CDEB 1FZMB 4NKIL 3ZMRA 3ZYOA 2XWJA 3OBAA 3B2UD 4V1DB 3QDME 4NZRH 3LKOA 3O4LB 4JM4H 1MF2L 4QRPD 1IAIM 1JPTH 2YOCA 3MODL 3CFIC 3T09A 5I1IH 5FHAH 3ZDXF 5J1AA 3UTTD 4NZUL 2DLFL 4ZNEA 1LEKB 5KVFH 3ZHLA 4PJ9C 5EU3B 3DXAA 4FQQB 2J4WL 4WWKD 1U3HC 1EVTC 1FNSL 2KQMA 5DC9B 4QOKD 2WIMA 5I1EL 4FZ8L 4Q9QL 1S3KL 4P99A 5GRWA 5DD6B 2DQDL 4HCRH 4Q0XL 4PRHE 4XNMB 3SHSA 3GGWB 3BPOB 1ZHBB 1TZGL 4YQXH 1NQBA 4PJCA 1A64A 5DWUL 1KIUA 3CAFA 4MDIB 1MI5E 4KRNA 4N1EA 5BO1L 2NY7H 1J5OL 4PBWD 5LGJA 5DTFB 1CLYH 1DQDH 1C5DB 3NGBC 1FL3A 1GOGA 4R97B 5FGCB 3FMGH 3GKZA 2OZ4L 5C86A 1RZ7L 1I7ZB 5SWSD 1CLCA 3ZYIA 4BFGA 1Q0YH 2A9MH 5T1MB 1MJ8H 2K7QA 4S1SL 1EVUA 3STZB 4HX1A 1F90H 3BGFB 3MJGX 1OTSC 5DFVC 5JHDB 4PRBB 4JRYE 1LO3H 2WP3T 4D9LH 1Q0XL 5A43C 3HFML 4WI3A 1G7JB 4WHCA 2X4UA 2R2BB 3GFUA 4PRPA 1X44A 1NC2D 3QRGH 3REVA 5CZVL 2UY6A 4DGYL 3O8XC 3QIBA 3QUYA 1HOCA 1X7QA 1RUQL 5E8PA 2BP3A 2QSCL 4O2FB 3P4NB 1LNUA 3O9WB 1QQDA 4JKLA 3ARFC 3CZJA 5MP6L 1YNTB 4KKCD 3EOBB 4ZNEE 1KB9J 4PREB 5E2WL 2DQIH 3DXAE 4BQ9A 1WAAF 3RKDD 4BK5A 2FJHA 1E6JH 3C2AL 2F5AH 5EZOL 2RB8A 3ILQD 1N7ML 5C8JA 3LEVH 5BRZB 2ERJB 3LCYA 2Z8WC 4Y4HA 4QRTA 4L8BA 5CMAA 1BGXH 1GVIA 4YWGL 5F7NC 4ELKA 5I76B 1XGRB 1AGCA 4PJCE 3UBXA 2DTML 4LCUA 4JY5H 3QWQB 3K81A 4UT6H 2VDNL 5ETUA 1HXMB 5ITBH 4BYHA 4OB5L 5CGYC 3SQBA 1BMGA 2HFGL 3TBSA 2YPKA 3BP5A 3UYOD 5C0FA 1S7WB 4GRLA 1DUYA 5IJVB 4F9PC 1R5IA 5GGVL 2ICWB 1UXWA 2I5YL 4H0HB 4RFEB 5F3HB 4M8QA 5SWZB 4BH8B 2HVJA 3T0AA 1NFDF 5T1KB 4C83B 2OL3H 4P46A 4RAUB 2RCSL 4S0SD 3P73A 4ESKA 5EA0H 1YDPB 4LCIH 1GHFH 1WZMA 2QQKH 4PJHB 1KJ3L 2VSDA 4LF3A 2ZCHL 1HSBB 4KV5F 5T3ZL 4AT6A 4HV8A 2VXQL 1HHHA 2PR4L 3VFGH 3HZYB 3MLWL 4PRPE 1S5HB 4EDWH 5KW9H 3LDBB 4MD4B 1HDMA 5EU5B 3C2SA 2HH0L 2OLDA 1FE8L 5ADOH 3W9EB 2VXTH 5GS2D 4L4VD 3WEXB 1P7HL 2V9TA 1T1WB 1XF4B 2F8OA 1B0GA 3LIZL 4GBXD 4JFYA 5FYKD 1L0QA 5JOPD 3SKJH 3UYPA 3QO0B 4LVEA 2OP4H 5DEGB 4D3CL 1OARH 2UWEA 4U1IA 5IIEB 2NLJB 3WUWB 1FFNA 2W91A 4OLUH 4YX2H 5F71A 5HXMA 3HNSL 4U1SB 3SY0B 3MXVL 4WY7L 2CK2A 4D9RE 4BZ2L 3HS0B 4XBPA 3VFNA 2I60H 3KPPB 1FP5A 4OIIL 4JM2B 3ZT5A 3B5GA 1QP1A 3RUGF 1AIFA 1RUPH 1FLTX 3WKNA 3B2VL 3QUXA 4KUCF 3TO4B 3O41B 2G60H 2OJEB 1DQMH 1E27B 4RISH 4FXGB 5IVZB 2NR6D 2FBOJ 3QDMB 3RUGB 3RWEA 1K2DA 2ZOLA 1T3FB 3BI9X 2JK5A 1WCBB 2Q1EA 3T0DA 4GW1B 1A14H 3SDAB 4WUUD 4LSQL 1DBBL 4M7JH 5L88H 1T66D 1P53A 2JJVA 4PTTB 4R96A 5LWYH 2VZSA 5BS0D 4NKOB 2X09A 1JBJA 1QSFA 3BKJL 3FT3B 5ECJE 5IB1B 2ENSA 1J8KA 1MCLA 2BSRA 1A1OB 5JW4Q 4UQ2A 5J3HD 2NTFB 2ZCLL 1FAIH 4XCYB 1FVEA 2IBBA 4XNXL 4Y19A 4C59B 4P57A 5IW6A 4WFGD 1NLBL 3HE6D 3WJLC 4ZFOA 1JZ3A 5C0AD 1JUFB 4Z7WA 1Q9LB 4NN7B 4OI8A 5DT1H 4L4TA 2DMCA 3G6JB 3RJQB 1FO0A 5L9DL 4MSWA 3ZE2F 1ZVSA 4DKDC 4K23H 4PJBA 3IKKA 3JVGC 3OAZH 4JRXA 4HIIB 3RPIA 4FFYH 5IMLB 2C4FT 2IADB 1S9KC 4Z78B 3CZFA 4LSPH 1ES0A 1KLUA 4W6XB 5DMYA 4W70A 2B0SH 5EZJB 3X11A 4QEGA 3MRMA 4Y16D 5F1SA 4ZQKA 3M1BA 2RFXA 4F2MA 1N5AB 1UJTA 3GRWH 4HPOL 3MRDB 4G80A 4MJ5B 4XI5D 1ZSDB 1UWEL 4D94A 4NQEA 1MWAB 2X7LA 4LCCC 3S4SA 3SE4A 4ISVB 2P45B 4MDJB 2EC9T 1A6VH 2D03L 1LO4L 3TBYB 3BISA 3VH8G 2WIIB 4JRYB 3MV11 4EIGB 4LSVL 1JMZA 4YDKH 3GI8L 4Z9KB 3IFNL 5D7KE 5D1ZC 3CLFL 8FABA 3I9GH 3U7WL 4HUXB 1FG2A 4QF1B 5CEXB 2R15A 3BHBA 3LKOB 2OTPA 3KDMB 4LVOC 3MOAH 3N0PB 1FBIH 5EU6A 1J0HA 1SJXA 4PV8B 1RY7B 4X0KA 2VLKB 4NRYA 1LDPL 1QSFE 3SE9H 3HC0B 4GT7A 3ZLQC 4PY8I 2LAGB 4I5BA 4NCDA 2ITDA 1SMAA 3NAAL 4Y19E 2NXZD 5SX5H 4K8RL 1ONQA 1IBGL 5DJDA 5D9SA 4Z7WE 3W2DL 1EEYA 2CXKA 2FB4L 5DD1H 3VXSE 4EEEA 1A0QH 1SJVA 3AUVA 1WBYB 1U6AL 2NY4C 3ARDC 4PJCB 1KTLA 2ESVD 2VDOH 1YYLL 3RVVD 4YH6A 3V6OA 4G9FD 2EYTB 5LGJB 3G5YB 3C5ZC 1ADQH 3SDXE 1T20B 5T3XH 4PJBE 1BLNB 1H3PL 2X2YA 4JRXE 1JN6B 3FOLA 3CCHA 4PJDB 2GJJA 5D7JC 4BELD 1J88A 4GAGL 2VKWA 2Z0BA 4K7PH 4NQEE 4GJTB 4C56A 1ZTXH 3IAPA 4R8WH 3ULVF 4HX1B 2QHRL 1MCDA 3SPVB 3NVQA 4QRQA 4GRWH 1J9CT 1XGUA 1T6VN 2Q7YA 3K1DA 1OLLA 4DKEL 1B0RB 4P5TB 1JI1A 4OFPA 3SGDH 3E8UL 4UNTA 4H8WH 4WTZA 1VFAA 1I8IB 1IGYA 1C7SA 4FQXB 2YD7A 4PYHA 5J06A 3FTGA 4O02H 1EFXB 3S35X 4XVJL 3GSNL 3EOTL 4XHQA 3QIBB 3L7FA 4Q74A 3QUYB 2OTUA 2V9RA 2XRAL 3X3FH 4GAFB 3LVEA 5E2VL 3GSXB 5I15L 3TA3D 1NMCB 3DTXB 1LNUB 3SKOA 5EU6E 2D3VA 3GHBH 3GZKA 3RFZC 2VISB 2NY1D 3ARBA 1FH5L 4H8WC 4Q9RL 4YHKL 4KPHH 1NBVH 2R0LH 4NJ9L 4LAQH 4HXAH 3ZT6A 1JPSL 4WTZG 2F19L 2CKNA 4U3XA 1H3TA 3ZHKA 5L7XL 1CIDA 3LB6C 2DQTH 4LSRH 1J1XL 3GM0A 5DD0L 2EECA 2ZWLT 3PQYB 4KKLC 4L8BB 4L8CA 3T1FB 5CMAB 3QQNA 1PLGL 4ELKB 1AGCB 2XZAH 3V6ZA 4EI5D 3NIGE 1U92A 1BF8A 3UBXB 2WLYA 4LHJB 2AEQL 3V6OE 1JWUA 1MAML 4LCUB 4MX7A 3TESA 3V7AG 3MNWA 1B4JH 3T3ME 1A2YB 5C0GB 1EFQA 5T33L 5LAXA 5E08L 2BVOA 1YEJH 3E3QC 5HHVL 4N5ED 4L8DB 2PXYC 3MCKA 3U46B 1C1EH 3TBSB 4I1NB 1AXTL 5C0FB 4GRLB 1DUYB 4NCC1 5GGTL 4E42A 4YHML 4KY1H 1R5IB 3HCVB 4PJ5A 3ULUL 5CJQH 2AJYL 5HYJA 3DUUB 2Z31C 4NQSA 4PJIA 2HVJB 2R1YA 4PLJC 5JPNA 3IDIB 4C56E 4DN4H 4P46B 5TPWL 3AB0C 3KNBA 1HILA 3ZKXB 3P73B 4G8GD 5AZ2L 3GSQB 4DW2L 5DJ2B 3RDTD 5E8NB 5DGQA 5E6ZA 4EXPX 5CAYB 1OTTD 1Z6JT 1H3VA 4LVNC 5JA8B 4YGAB 4AEIH 4AT6B 2OR7A 4MA8L 1GC1L 4LPTA 1IGFL 2MMXA 1F6AB 1TQCB 3PABA 3B83A 1FPTH 3QDJD 4GRWF 1PD6A 4MJ2A 1MCWW 3O6LH 5SWQA 4XH2A 4PJEA 3PWPB 2Q8BH 4X7FC 1IAIL 5CZXD 5B3JF 3V8CA 1IRAY 3E6FB 1B88A 3BW9B 2D7TL 1KUMA 3EJZC 1IGIH 3FRPG 4M43H 1T1YB 3OV6A 2UWEB 3CSYA 5GGVY 3FO1A 2Y6SC 3HA0A 3MFFB 3VCLA 1FFNB 2ZCKH 3BKCL 1S7VB 3VFSA 5EORH 1RUML 5F6IC 4C4KT 5E70A 2O5XL 1R0AH 3FFDA 1S9VA 1F8TH 1FHGA 1YEHH 4XBPB 3O6KH 3V8OA 5H35A 1NPUA 1EBPA 3REWA 2OI9C 5HJ3A 2AJUH 4ZOBA 2UZYB 1OSPL 3T2OA 2JKXA 5E99L 2HTKD 4OGYL 4NHCH 1PG7X 4YXLH 2GFBA 4NKIH 1UH4A 1ZOXA 2N56A 3MTRA 4B41A 1MCWM 4WFFD 4P9MH 1LEGB 2R2HA 3V0AC 1K2DB 3QXAA 2NY3D 1AGEA 2JK5B 4O9HL 1GGCH 2DRUA 3ARGC 1EUUA 5CEZE 3ARSA 3RGVA 1EO8L 4NZUH 4PJ5E 4R96B 2F74A 4BQCA 5HYJE 2J5LB 3P0YH 2DLFH 4JFZH 4PJIE 3SBWC 5ITFA 2HFFB 1DLFH 4KKNA 2EXWC 2BSRB 1CF8H 4UQ2B 1D9KA 2P7TA 3H0TA 1FNSH 1FVEB 5E2TH 1JF6A 3OB0H 1CQYA 1A1MB 5IW6B 1UENA 1A5FL 5EBLA 4Z7WB 5HI5C 4MMXC 2YC1A 1SYVA 1TZGH 4X7TB 5DWUH 5F96L 3AU1A 2HRPH 3ES6A 4L4TB 5IBLD 3BZFA 5C0RH 4FFZL 4MQSB 1FO0B 1NGZA 5BO1H 3VH8B 3U9PH 1CICD 4PJEE 5D7LD 2PF6A 1DTUA 2A74A 2E8ZA 2IMNA 3ZKQD 4PJBB 4BJLA 4OFDA 4Z18A 1Z0MA 4ACPA 4D0DB 1SY6H 5C70A 2A6KB 4ZS7H 3PP3K 3VXQB 4MAUL 1EBAA 2AJXL 2DF3A 2VZ1A 5C09A 2GJ6A 5GRXG 3X11B 3MRMB 4ZQKB 3M1BB 2RFXB 4F2MB 3OTTA 4LKCB 5DHXB 4G8IB 4XBEL 4NQEB 3CLEH 3OGCA 1CGSH 2I25N 3CVHL 4PB0L 2BSTB 4L3CA 5IUSA 4NQVA 3VDCA 4FOMA 1M05A 1P69B 3MLTA 2XYCA 3OF6D 1HKFA 3BPCA 4Y5VA 2GITA 4JO3L 5I8EA 2V5YA 1T22A 4XPBH 4XTRD 3NIFE 5BVJA 4PJGB 4L4JA 1H5BA 2R39A 1DR9A 2ZSVA 6FABL 1PW3A 4FTVB 3DOSA 4I3SL 1CGXA 4HQQL 4CAGA 5BV7H 1D3CA 2JE8A 5EU6B 3Q5TA 2H45A 1MFCH 4X0KB 3JV4A 4NRYB 4TPRL 5E2WH 3TLRA 1CI5A 4HLZG 4HUWB 2D7PA 4WWID 4JO2L 3U4BL 3C2AH 3CXDH 3DUSA 2XA3A 1MEXH 4JAMB 1N7MH 3O2DA 2H32H 3HC3H 4L3AA 5BV7C 4HFUL 1QNZH 1ONQB 5E7FA 4U0RB 4CBPA 2W9EL 3G6DL 3QULA 4G3YH 1EEYB 4AG4H 1JPFA 4YWGH 5FUCC 4MB5A 2DQHL 1SM3L 3MYJA 4NO2A 1JNNL 5DJAA 3NACH 2DTMH 2B8OT 2EKSB 3P4OA 4KI5D 1CFTB 4V2BA 3MCG1 3VWKD 5IV2B 5JDSB 1VACA 2BX5A 3BKYH 2C1PA 3DURA 4PG2A 4DGIL 4DFIA 2VDNH 4IRJC 4OB5H 2X05A 3FOLB 2A1WH 4R0LC 2HFGH 1YUHA 4JQVC 4X7CC 3VG0L 3STLB 2AKRA 5FYJE 2DLHA 1XR9B 2FIRT 4OZFH 5C09E 2GJ6E 4JFED 3JTSA 1FVDB 3T8XA 1HHJA 3OZ9H 2I5YH 2IANA 1KJ2H 1CFVL 5DLMH 4ONGL 4HWEH 2OR8A 1MCJA 2Y1VA 1OY3B 1V05A 1BQUA 3J8F7 3FO9B 2WBJC 3DSFH 1X5HA 5IR1B 2F54A 1XGUB 2GEEA 3B9KC 4OCSL 5T3ZH 3MJ7A 3X14B 3CX5J 2FGWH 2VXQH 1AC6A 3AS3A 3MLUL 5KSUA 4OFYD 2DIAA 2BHUA 3MSPA 4XVUC 1IGYB 3TVMA 3AS2A 2AS5M 3A67L 1P84K 3SDCB 4ALAH 1FE8H 4OCMC 3L5JA 2VXUL 3QR2A 1RJZA 3BUYB 5I1DA 1FZKA 4DVBA 3U2SA 4H1LA 1MUJA 4JY4A 3RX5A 3CXHJ 2YD1A 3T77A 3ARXA 3Q1SL 3AMKA 1ORSA 2FHBA 5A16A 4NO5A 2FJGB 5F7UA 4N0UA 4D3CH 1G9NL 2I07B 2OXGA 5E2UL 1CDUA 3SE8L 1MLBB 4DKFH 3ZDXE 2YD4A 1HH9B 3ARPA 4HS8L 4PJ9A 5JXED 1EEZB 4CDGC 4R4FL 1BFVL 2IAMC 1S5IH 2CMRH 1OT2A 5CJ5A 4RFOL 3WXWL 1WT5C 4IDLA 1L7IH 3WDJA 4L8CB 5ID1A 5ISZA 2HFEA 1UM6L 2BHYA 5ANMB 1TCMA 2EYRA 1EO7A 3A6BH 5E8DH 1AR1D 3X13A 5ACZA 2FHCA 2BVYA 3B2VH 1A1NA 3B2UC 4XXCC 1I1CA 5CBEB 1T1XA 4U7SA 1YN7B 2CLZA 4D0BA 4ODVL 3FB8B 2ATPA 5JIIA 3U48A 3V5HA 3MCKB 2ORBL 1WVZA 1OAYH 4I9WE 1KPVB 2ATKA 4HCRA 4FQIL 3TBTA 2IANE 1XH3A 2BY1A 3W39B 4IRZL 3BMWA 3VMOA 4BSVA 4C58B 1QO3B 3BKJH 4PJIB 2P1YA 3RVWC 3BSZH 2R1YB 3K2UL 3MXWH 3V0VA 1DZBA 2ZCLH 3VXRA 5I75C 3RL2A 1OAZH 3FQTA 1PG7W 4CMMA 3U1SL 4OSUL 5I16B 1BZ9A 1JTTA 1ZLWH 4G7YL 2F54E 2RIKA 4HC1L 2AEIT 1NFDA 4AJ0A 1NAML 5IF0B 2VLRD 4PGCA 1VPOH 2VITA 1CD8A 5DI8A 3L1OH 3BAEL 4X8JA 4EQ3A 1ULVA 2C1OA 4UT9H 5DC0A 3PHQA 5TDNA 3IDYC 5C6TH 3E2HC 4MQ7B 4QRRB 4M5ZH 5KBNC 3D18A 3K80A 1SEQL 4Q7DA 5DFWH 4EVNA 4XH2B 1P7QA 3TPKA 2KL6A 2Q87A 4OTXH 1EHLH 1KCKA 3O8XA 5HVHC 5CIPH 1TJIL 3D2UA 1ZHLA 1IAKB 4X80L 5DJ6B 1INQA 4FP8H 4N0UE 5DR5L 4GKSA 3ARFA 1R5WB 3CSYB 4PLKD 2YD3A 2CDFA 4HEPG 3FO1B 1ZE3C 1A7QH 4YZFF 1YNKH 2IJ0C 5T1LA 1D6VL 3WS3A 1TPXB 4XMKL 2X1XR 3UJIH 1RJCA 1CBVH 1RJYA 3TN0D 1LO2H 1S7RA 1N2RA 4LARL 4JHWL 1VA9A 5ISZE 3PWNB 4M6OL 3BEWB 1XF2B 1KCRH 1YY8A 1K5NB 2P5WA 3IU3A 1EHNA 3HPJB 3QG6B 2XZCH 4N5UA 1Y6KR 3EDJA 4TVPH 2BNUB 4APQD 4LSUL 3ZDZE 1FQ9C 4KXZI 1MFEL 1ORQB 1Q8MA 3QCTL 1AGEB 4LCWB 4KKCC 3WKML 1MJUL 2Y36H 1ZT7B 3L3DA 1JZ2A 3LD8C 1FVCB 1QR1B 4LNRB 4G9DA 5F7FA 5DRXA 2BNRD 4WI9A 5ITFB 4F9PA 1KPUB 3T65B 2QHLA 4NC2B 2R1XB 5CILH 3VXRE 1CWVA 1TJHL 4J4PD 4WWKB 2BSED 3NAAH 3M45A 1JNHA 2NY2C 4OCYL 1NFDE 1MHEA 4H25A 4HJ0D 4Y1AA 4LLYA 5IK3B 4LPXA 4QRUA 2EDLA 1A6ZA 2FB4H 1MREL 1VCAA 1U6AH 4JFDD 1D5MB 1YYLH 3ES6B 2ID5A 4E0RB 1GGBH 2CKBB 1E4XL 1NGZB 4KAQH 1BQHG 5J6HB 3RVTD 5EBMA 1DE4A 4I0PD 4NM8L 2OL3A 4OLYH 5F7HA 1F6FB 1R3IL 3GHEH 5SWSB 4IIQC 4HGMA 3HZVA 3TPUB 3SO3B 5F9OL 1OP3H 4GAGH 3QPXL 3EJYD 3OGCB 1KJVB 4L3CB 5EZIH 1VEPA 3NPSB 3RI5F 3C87A 2BY2A 2AEWA 1UWXH 5FYKH 1N6UA 1PKQB 4GXUM 5L6YL 4O51B 4Y5VB 3CSPA 2I9TB 1KJMA 3RVXC 2VR5A 1T22B 2CO7B 3HRPA 2P5WE 2B2XL 1NC2B 3JWNC 5FECB 1PDKA 3B6SB 3MROB 2DOCA 2Y06H 5SX5K 5KOVC 2EICA 5IMKA 5E2VH 1DL7L 4BH7A 1A7OL 4BFBD 4XWOD 1A22B 1BIIB 2BNQD 3RZCC 5K9KA 2NW3B 4A6YB 5TQ2H 5JPMA 1MNUL 1IM3B 5LVEA 3MRIB 3NBNA 1DBKH 4FFWC 1RZ8B 4AEEA 2ZOKB 5HGHB 3A6CL 2BK8A 1T0NA 2I9LA 3PDDA 4ODUB 4M00A 4OLVL 4NJ9H 4J23A 1UCBL 1LGVA 3C60D 1UQSA 1F3JA 2Q8AH 3NN8A 3EYUH 4F8QA 4AYFA 3DWTA 3HUJB 4LPVA 1Q72H 1A6AB 2ZUXA 7CGTA 5I73C 5LGHH 2F19H 1JWSA 5EO1A 1N26A 3VD3A 5F72S 4Y1AE 3ZL4H 1QG3A 4NJAL 3BVNA 5J89A 3EBAA 3QULB 2QL1A 4Z7NF 1JPFB 1E4WH 3PV7A 4FABL 2WK2A 1HZHL 3P9LA 3VRLE 1TETL 3MV8D 3KPMA 4PY7A 3MYJB 1OLZA 4NO2B 5DEFA 2AEQH 5DMKA 5DMJB 1R3HA 3ABZA 4PGDA 2NR6C 1INDL 4X6BA 4IDJL 3OKEB 1R5VA 1TLKA 3DURB 5AD0B 5GGSA 1VEOA 4ZTPH 2KH2B 5E08H 3MLYL 2D7NA 4PJ7F 5H37G 3CJJA 3OXSA 3N1GC 1T66C 2Y07H 3JVGA 4M9PA 4YHMH 4JFQB 3BZDA 1BVKB 4LNVA 4PJ7B 4LKXA 2IANB 1T4KA 3ULUH 2J8UF 4XP1H 3V4PH 4NUGH 3PXHA 4MLSA 5J3HC 2Q20A 3QHZH 1QYGL 4WFED 1VDGA 4Z7VA 1UVQB 2J8UB 4DW2H 1RJLA 2PCPB 2JJUA 3M8OH 4LCCA 4MLIA 2E6QA 4MNGB 3MJ7B 4HAFA 4PJ8C 5C0EB 1ZA3B 1BD2A 1EXUB 4LQFH 4KUZL 5KS9F 1IGFH 4ZPVA 3T3PE 2H8PA 4J2XA 1G0XA 4Q6IC 3TVMB 2EDOA 5F1IA 1V3KA 3GRWA 2FEDD 3HI1A 5D1ZA 2JB5L 3MBEA 1NCUA 4GBXB 4DEPB 4DVBB 1MUJB 2EH7H 3C6LA 2H9GA 4YHYB 1X5KA 4Y16C 2N1KA 4EIZC 2H1PH 1U95B 5FOJA 5A16B 2D7TH 2KKQA 4TQEL 1U93A 4X8XA 4U6VL 1JGEA 3BKCH 4LLQA 3O2WH 5DUMH 2G2RA 3L5IA 1TJGH 4ODXB 4FFVC 4WEUD 5FOBA 2HG5B 1K3ZA 2HJFA 1C5BL 1NCCL 5HPMB 3OX8B 1I9EA 5ENWB 3S98A 3VFMB 5ID1B 5ISZB 3GUTB 1U8OA 3KLHD 3I2CH 2EYRB 5FGBC 4NZTL 3EW3B 4TUJB 1XIWD 5ACZB 2CQVA 3HE7B 1ZT1B 4OGYH 3BQUC 1A1NB 3G5ZA 3U6RA 2FECL 3D0VA 2B1AL 4F37K 4JFPA 4CVXA 2CLZB 4D0BB 3DRQA 1NUDA 3S36H 3TIDB 5F21B 3BPNB 3K1KC 4WUUB 1M7IA 3RAJL 4K8RD 2ITCA 4P2RD 4YUEL 3LQMA 4RCAA 5JTWA 1KXVC 5D7JA 2VWEC 1M71A 4JDTL 5E95B 2ED9A 1MHHA 4Z7VE 3BRGC 1MRCH 2AJVL 3L9RA 2ZUWA 2APWA 2OBGA 2NXZC 3DSNA 1D5IH 1ADQA 3GBMH 5F88B 3HE6B 2YBRB 3UTZA 2AK4A 1A5FH 2FBJL 1FYTA 1P9MA 3ISWA 4TNVK 1BD2E 5DI8B 2PTUA 2C1OB 5F96H 4H5SB 2BCKB 4CJ0A 3SDDC 3KYMA 5MHSD 2IF7A 3CX5K 1A7PL 4EVNB 2QADC 1QBMH 3FB7B 1P7QB 2B1HH 2BZDA 4CN1A 1XGPB 3QQ3A 5HHPA 3KJ4C 4P5KB 4D9QD 1J8HD 3ELAT 4GKSB 4NHUB 3TIEA 4NGHL 1SQ2N 1RZFL 4AMKH 3VFVB 5C0IA 1WUNT 4MS8C 4XBEH 3LMJL 3WS3B 4PPTA 4PB0H 1CFSA 3Q6FB 1YA5A 4WW1A 2YPLD 1OM3L 1KCVL 3PWJA 3OKMB 1N2RB 1DQJA 3HB3D 4UAOC 5J8OA 1MJJA 1OTUD 2OJZH 3LN9A 2E27L 4G43B 1LP9F 2XZZA 4OFIA 3ARED 1YY8B 1CLOH 3HTLX 3U4EB 4ERSH 3OR7A 4U1MA 6FABH 1RULL 5KZCD 3OB0K 4N0FA 2EH8H 4M1GL 3T04D 3EYSH 5D5MA 1T7VA 1BQHB 4G6FD 2PXYA 3BGAA 3C9NA 3UMTA 3G5XA 1Z9SA 1QSEA 2J1KA 5DRXB 4U2ZA 3CDCA 5JIHA 1YY9D 3GSRB 5I74B 3GK8H 4IMLB 2EXYD 2Z31A 3PHSA 3IFOA 1YZZA 5DGRA 4XT1C 1JNHB 5T3XE 3CSBA 4Y5XB 3SKMB 3IF1B 4HFUH 2PW1A 3S35L 4LLDA 4Y1AB 2AK4E 1FYTE 2W9EH 3QPQD 1SBBA 3TV3L 4QRUB 5L2KA 1A6ZB 1XEDA 1MCFA 3QWRA 2DQHH 4QXGL 3ZTNL 3QNZA 5I17A 4FZEH 4OQTL 2F5BH 3MLSH 5C0ND 4KRPB 4P4RB 5KSBB 1NBYA 3HI5L 3WNMA 5MI0C 3SN6N 4N5EC 4DGIH 2RQ8A 2OL3B 4OZIA 4LDEB 5KN5B 1OAKL 3PDOB 3G5VB 1BP3B 3HNTL 4GRWE 3NCJL 3MUHL 5HTSA 2J2ZA 2JCCF 4Y5YC 3LN4A 3VWJC 3TNNA 4U1JB 5CGMA 4NUJB 2YZ8A 2PKDA 1I3GH 4I0CC 4ONGH 5C6WH 1LO0H 2IBGA 1WICA 4XAKD 5FV2A 4HF5L 3RDTC 3WV0A 3GNMH 3P77A 4QT5A 1A9BA 4X99A 2AJ3B 2PO6D 4PGEA 2V9QA 4NP4L 4ZODA 4HKZA 4P2OD 5ID0A 3MLUH 5EO0A 5K9OB 2WP3O 2VUYA 1TVBA 3S37X 1J10A 2Y4SA 1V8HA 4K9EL 5I8KH 5EH1A 4YNYB 3T2NL 2DLTA 3FFCD 5JR1L 3TFKD 3TT1H 2R0ZH 4HUNB 5IMKB 3GMQB 1BOGA 1Y18A 3TA3B 3H9SB 1BECA 3CMOL 4M48L 3E3QE 2H2SD 5K9KB 4LDLB 2WSKA 5D5ME 1HQ4B 1Q9WA 5H8DA 2XPGA 2NY1B 5JPMB 1YEDA 3Q1SH 3J7HA 1OB1A 4YHIA 1QSEE 2FCBA 2AK1H 1T0NB 2I9LB 3MRCA 5D71H 5E2UH 3SE8H 3C8KA 3KPOA 3VXMA 5KTEH 4CU8A 1JNLL 2ZUQC 4WVRA 1QLEL 4X5WB 1MFBL 3EO0B 5HHNA 4R4FH 1JWSB 1AGFB 1BFVH 2HJKB 1N0LA 4RFOH 3WXWH 5KSVA 4LVHC 4OCWH 3H8NA 5L2KE 4CGTA 4DQOH 1U8LA 3CPLA 5DEFB 5GS3A 5BQ7A 1R3HB 4PGDB 1DN0A 5CBAB 2R4SH 1I4FA 2HRLA 1C8PA 1R5VB 5ICXB 2NY3C 5C0JA 4OZIE 4HGWA 1BJ1J 4HWBH 4K7FA 1B6UA 3EGSA 4JQXC 5JMOC 2D31B 4XP4H 4LPYA 4BQ6A 6CGTA 2HT2D 1MAJA 4H0GA 5EOQL 4X6DF 2O26U 4FQIH 3HLAA 4LKXB 1U8IB 1T4KB 3UC0L 4IRZH 4LIQL 2WAHA 1FORL 4UINL 1EHAA 4U1GB 4Z7VB 1N8ZB 3QRFM 2ADJA 3DMMD 1VFUA 2BXYA 5KVDL 2A9NL 1PG7L 1EMTL 5BW7C 1WFOA 1QVOA 1HHGA 1IAMA 1SY6A 2WINA 4AY0A 5F6HI 3BAEH 5IBLC 4WI8A 3C08L 2H8PB 1YEIL 3V6BR 5JLZA 3EO9H 1G7HB 1CICC 2HAZA 1ZS8B 2R23B 5EO9A 3THMH 1W0VB 3QDJB 1FLRL 4TUOA 1SEQH 3HI1B 3MBEB 2HTLD 1JHKH 4OUUB 1S9XB 1XGYH 4KXZH 1PSKL 3C6LB 1TJIH 5IW3A 1TZIA 4H88L 4ETQB 3C6SA 1IQWL 2UZIL 3UZVB 1I3VA 1I7TB 1UXSA 1FL5A 1U36A 1U93B 1U91A 3ZE1F 2VZOA 4L1DA 4PRNA 3VXME 3BESR 4ZFOL 2FYYA 3BUTA 4MNQD 4XMKH 5FKPB 2OR9L 4TSCL 4X98B 5FOBB 2HJFB 3LKRB 4O2CA 4ZUTB 3RNQB 3P4MB 2AI0L 2FDBP 4ZXBA 1IKNC 3MRLA 4GRMA 1FN4A 4I13B 1HHKA 2CK0L 4NO3B 3UX9B 3TEUA 2GK0A 1IGML 3WNKA 1UH3A 4G6ML 5EU4B 5DD3L 4JFPB 4CVXB 5C0CD 3DRQB 3VGAC 2V5SA 3VRIA 2CDGB 2HJLA 3WYRA 4E5XA 2H32A 2K9UA 4IRJA 3RU8L 1M7IB 5D1QC 2ITCB 4R0LA 4JQVA 3ME0A 5GJTL 5C3LD 3WFDL 5C1MB 3MRNA 2DDQH 1FNGA 4NFDA 4XNZC 2NY6C 1MHHB 3VXNA 3SKNB 5DRZA 3T0WA 4GQPH 4RGNC 1Z3GH 15C8H 2AABH 1AE6L 1KIPA 5IVXA 3F5WA 4JKKA 4OT1H 4Y88A 5F1NA 2AK4B 1KTDB 4NQDD 4ZUSA 2MPAH 2PN5A 5D72L 4MB3A 4HT1H 1YQVL 3B9KA 2X4QA 2ZPKL 4OZFA 4KDTC 5GIRA 4R2GD 3IJYA 3VWKC 1A47A 3K7UA 2E7LC 2IH3A 2YR3A 3KYMB 5KAQG 3WFHB 1UC6A 1KJ2A 3LV3A 3UXFA 4K71C 2X5PA 3MACL 1CG9A 1T03L 5E6ID 4RA0C 1IM9B 4MZ3A 3VW3L 5BJTA 2JELL 3D25B 4K7PX 4DCQB 4YGVA 1F13A 4PD4K 3LZFH 5HHXH 4IRSC 3S3JA 3N9GL 4LLVA 5GS0D 2QSVA 4R26L 1U8NA 5DJCA 1ZT4A 2E9IA 3NIDE 4Z76A 1G6RH 4Z7UA 3W0WD 2VH5H 3JSSA 5F9OH 3T08A 5KG9B 1LE9B 1AQDB 5DFTA 4CKVX 3VFTA 5C0IB 4HMCA 3KLAB 5AZEL 3QPXH 3MLZL 3WLBA 1I1FB 4NNPH 4BUHA 3K8LA 4A2LA 4QHNB 5D1XD 5HYSA 1RZKC 1KIQB 5JA9A 1ZK9A 1DQJB 4OGXH 1MJJB 1XF3A 3EFFA 1WT5A 2VXVL 3DHMA 3H42H 5DF0A 3DO7B 5DJ8B 4P59L 4XC1H 5J12B 4NKMA 3OR7B 2B2XH 4WI5A 1RFDH 2X9YA 1PYWA 2HYMA 2OMBA 3R1GH 3BGMA 2VXSL 4XXCA 2VDKH 4JPVL 4N0FB 2NXYC 5DUBB 1EGJH 3G9AB 4CU6A 1OAUL 3F7YA 1IFHL 1CGVA 1JWMB 2XA8L 4JQIL 3QAZB 1QSEB 1I1AD 3A6CH 1SJHB 1LD9A 4OLVH 4R3SA 1ZLUH 3MUGB 5GHWH 1QFOA 2OM5A 3KPSD 5FO7B 4M7LT 3IFOB 5IVXE 2GIYA 1JJUA 5LBSL 3S88L 1ZVYA 4XAWH 4QOKA 2PW1B 4YO0A 3ZDYF 5IESL 4KI5F 1AQKL 4OGAD 4TRPL 5DC4B 2AJZA 1HZHH 1EJOH 1FRGH 3HR5B 5I17B 5IEHA 1MLCA 3WFEL 5TFSL 1VERA 5CP3H 4N9OB 5GPRA 4IDJH 3TJEL 3SCMD 1AKJB 4OZIB 2R9HD 4AL8L 2KDGA 3H7LA 5E9DA 3KPRD 4Z95H 1G1CA 3LN4B 4QTIL 4JFEB 4Z7UE 4X9GA 3QO1B 1F4WH 2YZ1A 4NT6A 3LEYL 1KEGL 4UILL 4V1DD 1QYGH 2ADFH 5B22A 1R6VA 3O4LD 3IVKB 4XNQB 3B8SA 1A9BB 1NUNB 2ICEA 1WF5A 3DX6A 4JHBA 3CFJA 4HIXH 4PGEB 3S34L 2XWBA 5CIPA 1IEAA 1WZ1L 1VGKB 3T2QA 3LQZB 1OWRM 5ID0B 4KUZH 3IDJA 5EO0B 1DBJL 4H0IA 3QEQA 3FRUA 3H2WA 3SDYL 3D87B 3EOAB 1E0OB 4GLRI 1HHIB 2DD8H 2LU4A 4QWWC 4F3FA 3VXPB 5CEZL 2E5EA 3HZMA 2IPUK 2R2EA 2M1KA 3QWOA 3QUZA 4PJFB 1YEDB 2CLVA 3PL6D 1OB1B 5D7IB 5EZLB 1BFSA 3QEUA 3U7AA 1CLZL 3WN5B 3K4AA 4WGVB 3KPOB 3VXMB 3RA7H 3TZVA 5JZ7D 3TN0C 1B2WL 4JREC 4QOKE 4ODWA 3NFSL 1C5BH 3QJHB 5KSVB 1G7LA 3MUJA 3O3DA 4RA3A 4PJXA 2R1WA 3F7RA 1RZGA 2YMXL 2D9QB 4S10A 4O5LL 4WV1C 2MSPA 5E8EA 1KTKE 1VFBA 1RZJH 4NZTH 5BQ7B 5KSAA 4KROC 3TH3T 1DN0B 4APQC 3MRQB 4RGMC 5E56A 2R29L 1JFQL 4M93B 2ARWA 2G75A 5JHDD 1N64H 4KMQA 5E9DE 2NX5A 3KHQA 5LJYH 2IQ9L 4QHMA 5DO2D 2B5IC 2IBZX 4I18C 5KANI 1M6OA 5EC1B 1RZJC 1HCVA 2FO4A 5D2NC 1RHHA 3JV0A 1QA9A 2GAZA 1K8DA 4IIQA 1DLHA 4TUKL 4HPYL 4Y4FD 4KK8C 2AJVH 4TSBL 4OJFH 4JKPH 1UH2A 2XKNA 4P3CL 1ZA6A 3U0TA 3P30L 5GISH 2YPVL 4YE4H 1T21B 2VLRB 4OZ4A 3O45A 4OD3H 1NCAH 3QEQE 4RFNC 1EHXA 5E94A 4N9GB 4PRDB 2DQCH 1IZKA 1C5CL 3BH8A 4KQ3L 4AIOA 3O3BB 5GS1B 5JLZB 2VZ3A 3RVTC 3B9DA 5C08A 1LK3H 5BRZD 2VERN 4TUOB 1P4BH 1F3DH 1UFUA 1GOHA 1WZKA 4PG9A 3VI3F 3C5JA 3BDBA 4J1UB 3WJJA 3FQUA 1TZIB 2EDBA 3RZCA 3B9EA 5DQJB 1UXSB 2ICWJ 3EJYC 1CU4L 3FO2A 4HZLA 1AC0A 2V7NA 4PRNB 3H3BC 3RIAK 4L9LB 2XKUA 2PTVA 2FYYB 4UU9B 2BOCA 1MCOL 1DBMH 4TVPE 4JZNB 3W9DA 3BZ4B 3SJVD 2PTTA 4GS7C 1J7VR 4AQOA 4ZXBB 1EEQA 3VD9A 1FIGL 3MRLB 5ESQB 1MFDH 4GRMB 5F7MC 4K94H 5CHNB 2E27H 2IFFH 4QXUH 5CKGA 5K9JL 5DDHB 5AWNL 3Q6GL 1WWCA 4YPGA 1I9IH 1CVSC 2CRIA 4IOIB 1QRND 1OF2A 2VDRH 1RULH 3V5DB 5FYJL 1V5JA 4JPWL 2QJDA 1KN4L 3CUPB 3HRZA 2NX5E 2LVEA 1LEIB 2DS4A 4IRJB 3VGBA 3F7QA 4K94C 5D6CA 2D7MA 1F4YL 4XPGL 1MJ7H 4JG0L 1UJ3C 2VQUA 3C60C 5JIKA 3BD3A 4QHLA 4F7PA 4ORGA 5DRZB 5H2BA 5EBWB 5IFHL 1AO7D 3UEZA 35C8L 1RK0A 5DHYA 5I1GL 1CS6A 4PV9A 2BVQB 3BH9B 3HNVL 4KVCL 1EZVY 4NKQB 2H6PB 3P9MA 2VDMH 1X5ZA 1N4XL 1MHPL 4NPYA 2ADGA 5TF0A 2GY5A 3UTSA 2CGRL 5GIRB 4OLZH 4JFDB 4UDTB 4PJ8A 2XXCB 4OQTH 2IH3B 5IFAL 5C08E 1PQZA 1KIRB 2GT9A 4Q6IA 5I8CA 4PRAA 2IPUG 4F8TA 1S78D 4I0PB 1OOAA 4QGTA 4WEMB 5BJTB 3KYOB 3HNTH 4JM2D 4YGVB 5HPOA 4G6JL 5FYKE 1OPGL 2YS4A 1U8NB 5DJCB 5BOPA 4M62L 3MLVL 2DL2A 4Q2ZB 3TO4D 2Z8RA 1CXLA 3O2DL 3VFTB 4XP6H 2UY7A 3FQXB 1HH6A 4M6NH 1F45A 3QDMD 1V7NH 1YYML 4HF5H 4TOYH 3VXOA 4G8EB 3BWAB 4AM0B 1XF3B 3EFFB 4NP4H 1T5WA 5ESAB 4LEXH 4KZEL 4UT7L 1JL8A 5DD5L 4YPJA 1CQKA 3OKKB 5D96B 2E7BA 5FGBA 5GGQL 3KWWA 3BQUA 1NBQA 4RMWA 2Y5TA 2DYPD 1R24B 1W8OA 1FV1B 4LSTL 5CUSL 4XXDA 4MCYA 2EDHA 4PRHD 2YD8A 3F12B 3OR6B 3O0RH 3F7YB 1F2QA 5ICYA 2X70A 4S2SA 1JRHL 3QXVA 5D7SL 1A9EA 1MI5D 5DK0B 4K3EL 3T4AA 1VADB 2VDLL 5IB2A 5E1AA 4LFHG 3IU4L 3TBWB 4QO1A 1UYWL 2W9DH 1QLEH 5A2JH 1MFBH 4RWYL 1YMMB 3N1FC 2A77L 3DV4A 4UIKH 1YMHA 5I18L 1CFBA 1FDLL 2ARJQ 5FUZH 4NYLB 4JANA 2FEEL 3KLHC 2X4OB 5C0AE 2FSEA 4ELMA 4LRIA 1XIWC 3G9VA 3LKNA 3UTSE 4J8RB 4HIHB 5A1AA 2ESVA 3R8BB 5L0QB 3ULUE 4G9FA 5F7DA 3QCVL 5DHVB 1MVUB 4S0TD 3SDDA 3T0BA 4G5ZL 1UEYA 4F15C 4OFVA 3WO4B 4LQ1A 5E4EC 3BXNA 5TE4H 4DAGH 3QH3A 4X5XA 4JRYD 3P9WB 3GI9L 1U41A 1XZ0A 4WFHE 2EYSB 2FX7L 4TULL 2OXHA 2DJSA 2F53A 1U0QA 3SOBL 5I1KH 1HSAA 32C2A 4HG4J 3EZ8A 4NT6B 5DVKA 1CXIA 4LIQH 4TNWF 3SE3C 1RPQA 3H9HA 4NZRL 3P0GB 4JM4L 3AC0A 5CWSB 3IS1X 3VD5A 5KVDH 1GAFH 5I1IL 4YDLC 3CFJB 5FHAL 3ET9F 1BX2A 2XTJE 2VLKD 5KVFL 2X4SA 1TNMA 3DXAD 1Z9LA 1NDMB 3RWCA 1YEIH 3FRUB 5IHUH 3NA4A 4ZUVA 3RTQC 4MJIB 1FLRH 4G8FA 4F58H 3HZKA 1WLHA 3NZ8B 5IBTH 1U58A 4Z7OE 4HCRL 3GBNL 2GI7A 3L3IA 1FL6B 3LSOA 3S5LA 3QUZB 3RL1A 4YQXL 3O3AA 2CLVB 3LOWA 1IQWH 2UZIH 1KB5L 1LK2A 2NY7L 5IG7B 2DKMA 2EDRA 3QJFB 1IQDB 1CLYL 1DQDL 2CR3A 2EE6A 2VWEE 4UMGA 1TENA 3TZVB 3BIAX 4DJMA 1BVLB 3GMNA 3HB3C 5HDOA 3MR9B 1G7LB 5I9QC 2PW2A 3O3DB 4PJXB 2R1WB 4ELME 1Q0YL 3X12B 2A9ML 3D85A 3RWIB 1VFBB 2BMKA 3ZKND 1NUGA 2ESVE 5KSAB 1LDSA 3LKQA 4G9FE 5IOPA 3S5LG 4ZFFA 1DVFB 2EEBA 4G6MH 1MHCB 3A0OA 2XV6B 1ACZA 4KRLB 3WHXA 4HMDA 4PB9H 3PIQA 1QR4A 1LO3L 3G6AA 3L7EA 3KVQA 4U6YA 5GRUH 5IKCA 2Q86B 2F53E 4GW5B 4PRPD 4MCZA 4XCFH 1UM4H 2IALA 3QRGL 3WFDH 4JGUA 2GHWB 1OD7A 1RHHB 3VWJA 1QA9B 2EXYC 3QIBD 1DLHB 3QUYD 4X6DA 1R3KA 3I3DA 2X1QA 3CFEA 1AE6H 2XKNB 4G8GA 1ZA6B 3U0TB 4F7MB 5J1TC 4OZ4B 1WBZB 2GY7B 2VYRE 3DUHA 4OCNC 2YHGA 2DQIL 3LRSA 1C08A 2GTWA 5MEPB 4TTGA 2O5ZH 1E6JL 2A6DA 2F5AL 5C08B 4F33A 1WWWX 3LEVL 4P23A 4HIEB 4D9RD 1NGXA 4KHTH 1Y0LA 4YDJA 4PG9B 4Y4HD 3VXUA 4XCNB 4LCYA 1OGTA 2JELH 3D0LB 1BREA 2CO6B 4OZHA 3TCLA 1BGXL 3QEGH 4F7CA 3N9GH 5TF1L 1WFTA 1NH6A 3FQUB 5EUOF 4QTHB 4L1HA 2OCFD 1KBGL 2X10A 3DETD 5TDOA 3OXRA 1J8HB 4HK0A 2ILLA 4YHOL 3BKML 4Y4KB 3KYNA 4JY5L 4HZLB 1IMHC 5EUOB 4UT6L 1C7TA 4HD9A 3LKPA 3MV7A 5GZOC 5ITBL 2AV7A 2BOCB 3DBXA 3GSNB 3RNKA 3W9DB 2DJ4A 4GRLD 1X5LA 4KDVA 4XCCH 5C7XH 3OAYK 4UTAL 4P2OC 2BVTA 4JZOA 1HIMH 2VL5B 2VXVH 5C07A 3AREB 5GRZA 4PGBA 3JTTB 3VGHA 4P46D 2NNAB 2Z35A 4BFIB 5IBUG 3VFOB 1A7RH 3NCMA 2ICES 3LHPH 3OHXA 1BWWA 5EA0L 1OF2B 1E4JA 5JQ6H 1GHFL 4JDVA 4LBEB 4YBQD 5AUMA 2QQKL 3UTOA 5F6HJ 3EHBD 2CJUH 2R2CA 4RAVA 3VFGL 4KKBC 4JQXA 2DWDB 4G6FB 1IFHH 2XA8H 3PWUB 4HUUA 4EDWL 5KW9L 5EOCH 1IARB 1IGTA 5ADOL 1A6UH 3EO1A 3BN9D 3L6FB 4QHLB 3QNXB 1W0YT 5CINH 4MD0B 2P8PB 4X6DE 4FQCH 4G8GE 2PYEA 5DHYB 3S37L 4M1CC 4HWBA 2JJTC 1QZ1A 5IESH 5BW7A 3ZHDA 1IAOA 2OP4L 4TRPH 4YBLB 3ARWA 4NPYB 4P2YA 2ADGB 1WC7A 1DANU 3UTSB 3B5HA 2R56H 2I26N 2ARJA 2WWMD 4YX2L 4OLUL 4JFFA 2R0WH 1HYSC 3RY6C 1PQZB 3CFBA 2GT9B 2EEAA 4XPAH 5KOMC 1OW0C 3GJEA 3VXUE 4YR6A 2CLRA 5D7LA 1ZV5A 4MAYB 4GLRH 4OZHE 2I60L 3U0PA 3JWOH 2FGZA 1F11A 1G7IB 1NGWB 3KXFA 4NRZB 1A8JH 3VJ6B 1RUPL 5D7KD 2G60L 1DQML 4RISL 3H3KA 2VMFA 2YSSA 4DZBA 3MV7E 1L9MA 1I7RA 1NL0L 3LKSA 3DMMC 4MNHA 1ZHKA 1NCNA 1NFKA 3JWOC 4ZS6D 3U7YL 1FGNH 5L88L 4L29A 2PO6B 3S34H 3OKOA 4HBQA 1NJ9B 4MA7H 5LWYL 2XTJB 1O0VA 5C07E 1T04A 4OLEA 1QSFD 5J6GB 1CD0A 5MENA 2BFVL 5JW4R 2JIXA 1JYWA 5L2JA 2KQNA 1ZLUK 1IKNA 2MQCA 4M4PA 3OQ3B 4NM4H 4JFXA 1FAIL 3O4OB 1CD1B 5HYEA 1QSZA 2E9BA 2HTLC 3DX8B 4Y19D 2YRLA 5FCSH 4OF6A 5GQBA 4KJYB 2IQAA 2EDTA 3D3VB 5TE6H 4XXDB 1S9WB 3DI3B 3QISA 3OKNB 4DZ8A 3BIKA 2FNBA 1CCZA 4GAYA 2H2PD 3IJHA 3VGEA 2H26B 4X4XA 4F80A 5DT1L 2FZ3A 4L4TD 4IBLT 5FKAB 4OZGA 1A9EB 2DTSA 4MA3B 2Y7QB 5D1QA 3T4AB 3HPLA 2FH8A 3QFDB 2NTSP 1ZHNB 5K33A 4U6HB 1OL0A 3L3HB 4WI7A 4KHXL 1ZGLA 2PYEE 4FFYL 3GIVB 1YEFH 2P5EA 4B7IA 3HAEG 4EI6A 1S7QA 2B0SL 2EDJA 3TF7C 2FSEB 3GSWB 1NDGA 2QR0B 4HKXB 2KZWA 1T2QL 5J13B 4KC3B 4R4BB 5DQDH 5F7EH 4J12A 4JFFE 4P2QA 4YDVA 3G08B 4NQED 3WD5H 3L95A 1YECH 4KDTA 3DX7A 2WQRA 4M7ZC 5DYOA 2CXGA 1JFQH 5D7LE 1NUFA 1BEYL 1AI1H 1YEEL 2FWOB 2J88H 3MO1A 4X5XB 5IWLC 3DVGB 3KXFE 1D5BA 1XZ0B 3EDEA 3C5SB 3UTPE 4CADA 4YDKL 5DVMA 3QUKA 4IRSA 1AHWB 3KJ4B 3I9GL 32C2B 1IC4L 4P5MA 2VR9A 4OLWL 5FUOH 1QLRA 5I1HH 1IVLA 3PWVA 3U30C 3D69A 3B3IA 1B90A 5EU6D 1FBIL 4I77H 2ED8A 5GS0H 3HMXH 5D4QA 1BX2B 4HFWA 3BP6A 3SE9L 5F1OB 5MENE 3MPCA 3KPLA 3QIWA 3LQAH 3RWCB 5AG9A 1C5CH 1G6RA 4GFTB 4JKWA 3TBVA 5BXFB 4M6MH 4ZUVB 3U9UA 4HHAB 4U6XB 5EOTA 2EIZB 2H41A 4P4KC 3HZKB 2VLLB 5HGBA 3KPNA 1U58B 5HYQA 2QSQA 5ICZB 5GS0C 3CVHB 5SX4I 5DD1L 3S5LB 1A0QL 5DZOA 2VDOL 3LQAC 4OZGE 2PYFA 2G9HA 2XI9A 1Y6MR 1CU4H 1ADQL 3JBG7 5T3XL 5D1XC 2QQLH 1UACL 1DQTA 3IETB 1OCWH 2Z91B 2P5EE 4RGNE 3PXJA 5IGXH 4QHUB 4X6CA 1SYSB 2NY0B 3CU1A 2PW2B 5A3IC 3OAUH 4N8PA 1T1ZA 1EGJA 5C3TA 1U8MA 1YQ2A 5DRNB 3BEVA 4MQXD 5GZND 4K7PL 1OAQH 2BMKB 2W60A 4M61B 4P2QE 1QFUH 5F93C 2V17L 4BZYA 5K9JH 3Q6GH 2FH6A 1ZTXL 3I84A 4EN3C 1U8HA 2P48B 1RK1B 1LE5B 1JP5A 3EYVA 1WITA 3WHXB 4RDQG 4QY8A 1KN4H 3GMPA 2LE9A 2DKSA 3G6AB 3L7EB 4K3JL 4YIQA 4U6YB 4H8WL 1ED3A 3VRJA 1I1AC 3OKYA 4XPGH 1XFPA 2IALB 5DSCB 1CL7I 3SDCD 4O02L 4XVTL 1RZIB 4WHYG 2FATH 5ACMA 3X3FL 4U3HA 1CT8B 5H94B 3FT4B 4K3DH 5CP3A 3MGTA 4HG4K 3GHBL 2D0HA 2C3VB 3ARBD 3O2VH 3BPLC 4OGAC 3M17A 1MCQA 3RWJB 4MHHG 3KS0H 4X6EA 4NQDB 3QIUB 4KPHL 1NBVL 2WNGA 5DJZA 2R0LL 3GSOA 2O61B 2P8LB 5GSVA 2CGRH 4LAQL 4R2GB 4HXAL 4NSKA 3MRJA 4S1RL 1S7UA 5EIQA 4PR5A 1ZXQA 2BVPA 3RIFK 2R9HC 4P23B 1NGXB 5E6IB 3FN0L 4YDJB 2DQTL 3VXUB 3H7BA 1OGTB 3LH2H 4OZHB 1G7MA 2IG2H 5HDQH 3V95A 5IBUB 4F7CB 4G6JH 4HSQA 3JV6A 1OPGH 2XZAL 4NDMA 5KVMC 5MEOA 4M62H 2ZG3A 3OXRB 1BQLH 3PE9A 3W0WB 4POZC 3DECA 1AGBA 4KMTH 1B4JL 3F7VA 4KH2A 3QXDA 3MV7B 5E1HB 5CSZB 3D39A 4O2EB 5D8JH 2H3NA 3RNKB 2DAVA 2DQJL 2Y23A 4X6CE 5CEZD 5JDJA 3VD7A 4HZAA 3NFNA 2RHEA 4JZOB 5HGAA 4PJ5D 5CD5D 1TVHB 5HYJD 1VENA 1X3DA 3IXAA 4PJAA 4AENB 4LASH 2V2TB 1ZAGA 1I3RA 1NMAH 2AJSL 2N7BA 1XAUA 4DN4L 1Q9OA 1WSST 2E7HA 5INDB 4JDVB 5AUMB 3WE6B 1I9RL 3VU2A 3BPOC 1MRDH 5CUSH 2W0FA 2P43B 1WTGT 2NYYC 2ZJSH 3CFCL 1L6XA 2MJWA 5F9WB 2ZSWA 1DUZB 4QRRD 1IGTB 1J18A 4K3EH 3EO1B 4I18A 3O6LL 4R97C 3IFPA 3BWUC 5D2NA 4HJGA 1M7DA 3I02B 3KPSB 1P4LA 5E8OB 2Q8BL 2A73A 4RWYH 2XWTB 5DQ9A 2PYEB 4QYOA 4UUJA 4LEOB 5D2LF 3MRBA 3VE0A 4XB7A 1IGIL 3RQ3A 2APVA 1JTOA 1WC7B 5FM8A 2J6EH 1R3JB 1EDQA 2C3GA 2ARJB 4JFOB 2JJSC 2ZCKL 3WFBH 5TGBB 1N59A 4R6UA 2MNUA 5EORL 3BGFC 3T0EA 3S3PA 1R0AL 3SCMB 1S7XA 4G5ZH 4RMQA 4YR6B 1YEHL 3O6KL 1DCLA 3OWEA 3U0PB 3OJDA 5DO2C 3MRRB 2AJUL 1N3NA 2AERT 4X83A 3KPRB 3KXFB 1LO5B 4WHDA 1PEZA 1NAMB 3IKCB 2BSSB 4NHCL 3VI3E 4YXLL 2WBWB 4IEFB 5FB8A 4P9ML 2YSSB 1I85C 3WNPA 1X5FA 3D39E 2WW8A 4MNHB 1W72L 3O9WC 4FQPA 3BFOA 2O5YH 4OM1L 1GGCL 4UV4H 5DA0B 2DQFA 4LCWD 4Z7QF 4R4ND 3RGVD 4WEBH 3OKOB 3RGHA 1W8NA 4P3WA 3OKLA 1JHTA 2Z4QA 3P0YL 4PJAE 2V5MA 4JFZL 1QKZH 1J87A 4F57L 2FL5A 2GJZA 4X6FB 1DLFL 1U8QB 3BZEA 4BQ8A 1CF8L 2ERJC 1D9KD 3HAEB 3QNYA 1J0YA 3VI4E 4OAWA 4HULB 4ORZC 1DANT 5E2TL 3MC0A 5HDBE 2CR6A 5B8CB 2F8VA 5GRJL 5B3NA 3GBNH 4LHUA 2FJFB 3IDNB 4PBXA 2BNQA 3BIKB 1KELH 2SEBA 3PL6B 3ZE0F 2HRPL 4MD5B 2FZ3B 3FQWB 4XBGA 2MQ0A 5C0RL 1KB5H 4ZOAA 3BO8A 1K4CB 1MCPH 4HDIA 4Y8AA 5D1QB 3U9PL 1Z9OA 2YD6A 3WNNA 5D2NE 1UWGH 3C60A 1CDYA 1S9YB 1MCCA 1SY6L 4ZS7L 1LMKA 2P5EB 4CNIA 5FYJD 1JGUH 5C09D 4EI6B 1D6EA 1S7QB 1OP5H 3O3EA 5E5MB 4NKDA 3PNWA 1P2CB 5CSBA 5GGUB 3RWDA 3TNMB 4KI1A 1GZPB 3MV8A 4DOHE 4LHUG 5FAAA 4GG8A 3CLEL 5GGSY 4PIRF 3DVIA 3T0EE 4XNYH 1CGSL 2N4IA 3DX7B 1JPGA 4EJ1C 1QBLH 2YEZB 4OF7A 3HG1A 4NN5B 2ICCA 1WJ3A 1DN2A 3IDMA 1QFWI 4XPBL 1K9TA 5DZLA 3LDBC 5HVGB 3D6GA 1SJEA 4EXKA 3MBXH 4ZPTA 5T1DH 3GMLB 5FCUH 3QUKB 4IRSB 3LRGA 3F6LA 4X4MA 5E2JA 5EB9A 2D0GA 4L8SB 4J3XA 4CU7A 3PGFH 4FG6D 1A6TB 4OQTA 3PWVB 4Y4FB 3D69B 3B3IB 5CJBA 3DX9A 4CW1A 5BV7L 1T83C 4Z0XA 1MFCL 4O4YH 3GO1H 3RWGA 1DSFH 4U33A 1UZ8B 4JN2A 3KPLB 4YAQA 3QIWB 4QXTA 5IMOB 3HMWH 2WV3A 5FA3B 2HLFD 1A7BA 3CXDL 1RVFL 2FD6L 1MEXL 4HH8A 3U9UB 1S78C 4UB0H 1SEBB 5DEZA 1FZOB 3HC3L 4HWNA 3WIIH 3CH8A 4HK3J 1PX4A 5HGBB 1QNZL 3KPNB 4JM2C 3ESUF 5HYQB 4RDQF 2OX5A 4G3YL 4AG4L 4DWHA 2BNQE 4AZ8A 2C3HA 1HQRB 2HWZH 5TF1H 3TO4C 5ADPH 1KBGH 4FQLH 4U6TA 3NACL 2G9HB 4YHOH 2C7UB 3CSGA 1RMFH 3BKMH 3ZYZA 3R06A 3FJTA 2XN9A 1FSKB 3HKFA 4IS6B 3BKYL 3MCLL 3O11B 4ZSOA 4MVBD 3SDAC 2A1WL 4ZFZA 3WIHH 3IAGC 4CUCA 5DJYA 1NCTA 3SJVB 3V79C 4YXKH 4I9WD 1G7PA 4HKBB 3PGCA 1AGDB 4UTAH 4CN4A 2YD2A 5EG6C 3OZ9L 5HHMB 2IAND 4ZDHB 1UZ6F 1KJ2L