4PD4E

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
185
structure length
185
Chain Sequence
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/inhibitor
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
total genus 44
structure length 185
sequence length 185
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 4pd4E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4pd4E02
1BE3E 3H1LE 2E76D 1SQPE 4H0LD 4OGQD 3L75E 2HMOA 3TGUE 1O7NA 1SQVE 3DQYA 2GBXA 4HKVA 2DE7D 3H1JE 2JZAA 1P84E 4HM1A 5BOKA 4HM3A 2DE6D 3EQQA 4EMJB 4NB9D 2E74D 5KLVE 2QJPC 3H1KE 1PP9E 1EG9A 1O7HA 1NU1E 4QURA 1BCCE 1NTZE 4H13D 1SQBE 2ZT9D 3L72E 1EZVE 2NVEA 1ULJA 1Q90C 2JO6A 4PD4E 1G8KB 3L73E 1UUVA 1NYKA 3N0QA 3VMID 1NTKE 4HM4A 3L74E 1WQLA 2QPZA 3VMGD 1G8JB 2BCCE 2NVGA 2XSOA 4HM6A 4HM0A 5AEWA 1NTME 2FYNC 1KB9E 3GL0A 2HMKA 3L71E 2YFIA 2YFJA 2QJKC 3GCEA 1L0NE 2YVJB 3GOBA 3H1HE 2HMLA 3H1IE 1SQXE 3CWBE 3BCCE 2HMNA 1KYOE 1SJGA 2NWFA 1SQQE 2NVFA 2NUKA 2YIUC 2XRXA 1VM9A 2NUMA 2FYUE 4P1BH 4QDFA 3GTSA 4HM8A 2E4QA 4NB8D 4NBFD 2XR8A 3GB4A 2I7FA 3C0DA 3GL2A 4NBED 2E75D 5HL4A 2Q3WA 2HMMA 1NDOA 1RFSA 5KKZC 4QDDA 4PV1D 2HMJA 1JM1A 4NBGD 5CXMA 2YFLA 3CX5E 1ZRTE 4NBDD 2B1XA 1FQTA 1ULIA 1PPJE 4H44D 2B24A 4QUPA 1RIEA 4HM7A 4D6TE 1O7GA 3GZXA 3EN1A 1VCKA 2BMRA 4HM5A 2DE5D 3CXHE 4NBBD 4QDFB 4U3FE 2D2CD 1O7WA 5KLIC 3GKEA 3VCAA 1BGYE 4P1CH 4AAYB 2QJYC 3GZYA 2CKFA 2E4PA 3AZCA 4AIVA 1O7PA 3GTEA 4HM2A 4NBHD 4NBCD 4QDCA 5AEUA 2A06E 3VCPA 3VMHD 2XSHA 3FOUA 4HJLA 4QCKA 3D89A 2IBZE 3L70E 2BMQA 4QUQA 2ZYLA 4NBAD 1VF5D 2BMOA 1UUWA 2GBWA 1L0LE 1O7MA
chains in the Genus database with same CATH superfamily
3FXEA 2IZ0A 1YQ4C 5GTHE 3VP9A 4UB8H 1HGZA 3SWYA 1BGYG 5APUA 4EIJA 1LTGC 3SSUA 4LGDE 1HBWA 3P32A 1MV8A 3G3ZA 1EZVI 1GZLA 3EQQA 4DZOA 4NB9D 1T3JA 1AQTA 1N7SA 3P8CE 3IF4A 4WY4C 1VPCA 1KILB 2JR8A 3B5ND 4DCKA 4JYCA 2O01J 1ZW0A 3TSIA 2KZJA 3GF3A 2POHA 1VL2A 5AW0B 1U7MA 1NKZB 1NGMB 1PFIA 1VQPP 3BCCE 1SQXD 2FYUE 2YMKA 2A45I 1EDLA 1YYCA 1FOSF 5KKZC 4U3FJ 4NBGD 3L71J 2HPCB 3H1KG 3L36A 3MD0A 4D6TD 4RO0A 1SP4A 4ASVA 1TU3F 2M3EA 2KNCB 3JCUH 4IL6E 2WSFH 2E76B 5AVWB 1Y9BA 2WPRA 2R5BA 3L75D 2E4PA 2QJKB 2OGUA 3N4XA 5AEUA 3AE1C 1LTJC 1KFNA 3RL0g 2Q3IA 4C7RA 4HJLA 2A45H 2ZFCA 3A0HH 1PZQA 1CI6A 1DH3A 2FYUG 2IBZI 1GL2D 4OGQD 1S5LX 1L4AB 1NTZK 2ZXXA 3JC22 3V4QA 4GODA 3TF5A 1FZGA 4HM1A 1JM0A 4PV1C 3B8EB 3FGAD 3NMDA 4XFJA 4YTPC 1LP1A 3RL0C 5APXA 1ULJA 2K37A 1IFNA 3W68A 3N7NA 1MFTA 1KQLA 2M5AA 3AE7C 4Y28J 1N7SB 1RF1A 4HM0A 1JCCA 3CLQA 1M7LA 4K35A 2E76C 2P7JA 2YVJB 4C7NA 4H13B 1UIXA 2Q3EA 1N7SD 1SQQE 3MGNA 5B66E 2XRXA 5E79E 1E79H 1K9MQ 1UIIA 1NU1G 3GL2A 4NBED 1GD2E 4PV1D 2D2CB 5AVUB 1G1IA 3RK2B 1FZCA 2WPSA 3FWLA 3EN1A 1VCKA 4U3FD 2UWJE 1SQVJ 3IAOA 1SQQK 2WWWA 4QDFB 3A3YB 1KQGB 4ZMDA 5KLVK 1SQXK 1VQ7P 2N9YB 3V5BA 4CPGA 1SQPK 2HLOA 1UUWA 4RJTA 2KS1B 3PH0A 1DEBA 1VQMP 2V7QH 3DQYA 1LTAC 2GBXA 5H2FH 3CMEP 3L37A 3RK3D 1DD4A 1P84E 2GUVA 5KAFE 2OTKE 1QL2A 1OW8A 2FXMA 1NU1E 5C39A 1IK7A 2RH0A 2O1JA 2LR2A 2N1TC 3KXDA 3FX0A 3K5BA 1XTGB 1NKNA 2WQYC 4C7NB 1UUVA 1K73Q 4YPCA 4WWIA 2P2UA 3EWKA 1RF1B 1JY3O 2BCCD 3MP7B 4YXDC 3L71D 2B89A 3BATA 5B5EH 2O3JA 3BCCD 3S4RA 5KJ7C 2WITA 2K88A 2PRRA 3B5NC 3A5TA 4GOFA 2HG5D 1SQBG 1JMBA 5GTIH 2OYHC 1RE3C 1KV4A 3S1KA 2YKOA 1EZVG 1KORA 1S1CX 1QVFO 1NTZG 1L4AA 3A2AA 5AW6B 1HH0A 5AVYB 2E75B 1N2DC 1JMMA 3IN6A 1PGPA 4I2LC 3U1AA 3VCAA 1M1KQ 1YI2P 2CKFA 3VCPA 2R3CA 1YJ9P 4BRYB 3RK2D 1L4AD 2ZYLA 2KB7P 3KZIE 3H1HG 3PRJA 3AE2C 2KNCA 3G71P 3AEFC 1SQPD 2HPCA 3L73D 3BCCJ 1LTTC 4ZKPA 3V2NA 1LNQA 2L91A 1SLQA 5KLVD 2J59M 2OYHB 1VQNP 1BCCD 2JWAA 1EG9A 1O7HA 2A45G 3VOPA 3TNUB 2WVRA 2LXBA 4HM4A 3USSA 1G8JB 5AW5B 1JTHB 2MKVA 3AEDC 5CCHC 1IFMA 2H7HA 1IFJA 1PIXA 1Q82Q 4JF7A 2YFJA 1L0NG 1NTMD 3H1HE 3L72D 2ZT9B 3P8MC 3AE9C 1RHZB 2NWFA 1IC2A 1NTMK 1WT6A 1H89A 2Q6QA 4NBFD 4IOIH 1QL1A 3Q5RA 4Z1MH 5AVZB 3AECC 3KHUA 1FZFA 1KQFB 2WPVB 2FYUK 1L0ND 4IFFA 2BASA 2W90A 3FWNA 4H44D 1KYOD 5KKZB 4QUPA 2YNYA 4JQ0D 4EYYQ 2O01N 5EFWB 2BMRA 4GT1A 1O7WA 2B88A 3AZCA 1M1JB 1NOHA 2GA1A 3FXDA 3HTKB 1G2CB 1PP9J 3BRTB 2XV5A 3AEBC 1VDFA 2KK7A 1RE4C 1T2KC 3CCJP 1PV3A 3LW5H 1LJ2A 4DJGA 3AE8C 3HUSA 1WMKA 5AW4B 3AE3C 2Y0DA 1SQBE 1L0LJ 3TDKA 4UB6H 1Q90C 2Y9YA 1P84I 1HJ0A 3L73E 1SQPJ 5B66H 2FYUD 1NTKD 1USDA 1NTMJ 1SQXJ 1J1DC 3R4YA 2BEQD 1S9KD 1RQUA 2K9JA 1OFCX 3OW2O 1BGYJ 4XA4A 1M1JA 1FZAA 4WB4A 1Q90D 2GM4A 1JY3P 1OW6A 1OWAA 4NPEA 1S3JA 1NTZJ 3HD7B 1YJWP 2FFDA 4WBAA 1LTIC 3WUVA 5AVTB 3LIDA 2WSEJ 2YKPA 1J1EC 4U3FE 3U59A 1IFIA 3CCUP 1JY2P 3MZWB 4PV1B 2E74C 2XDJA 3E1IA 1NU1K 2QIWA 3BVHA 3CL3D 2OTJP 2ZVNB 3L4FA 2XU6A 1SQPE 2ZT9C 2AXTE 4H0LD 2HODA 3H32B 1JY3N 3TNUA 1N73A 1XTCC 1FAVA 3RK2C 2FYNB 2IZ1A 2E74D 4KHXA 4EOTA 3F5HA 4IFDK 5AVRB 3H1LD 3G6EP 3T97B 3B71A 1Q2NA 3UIAA 3CXHI 1S4XA 4QMAA 2B87B 1L0NJ 1N73C 3G9RA 2HMKA 5APVA 2Y0EA 1BDCA 4L74A 1NTKJ 1SQBD 1SQXE 3II6A 4A7PA 2DW3A 1KMIZ 3L70J 3GHGC 3SWKA 2QM7A 1PGOA 1ZLLA 1FJKA 1NWQA 1ZRTE 3CC7P 5AVQB 2P58A 2G3AA 1ZMEC 4I1LA 2XZRA 5APTA 3LW5J 2PGDA 2HR3A 2G8YA 1BSNA 2Z5IA 1VF5C 4PD4I 1GL2B 3L74J 3CCSP 3D89A 2J5UA 2IBZE 3L70E 1VF5D 4N6JA 2N1TB 1FJPA 1EDKA 3AE6C 4OGQC 4R4MA 2HMOA 3WUUA 2NZ2A 1ZR2A 2VRSA 5AW2B 2Q9IA 1FDOA 3KYQA 3KDPB 1GMJA 3G4SP 5KLVE 3TK1A 5CBNA 4LLHA 1BCCE 1JO5A 1LTSC 4H13D 3OA7A 3LIEA 4DT0A 2ZYDA 2W27A 1OXZA 4GOEA 1VQKP 4N3YB 3N0QA 2O1KA 2KS1A 4AUWA 1X22A 2HFED 3IR9A 3H1JG 1NU1D 2C0XA 3WU2E 1GTWA 2HMLA 3GW6A 1KB9I 2IX7C 3E7KA 5AW8B 4QDFA 5CHXA 2IPPA 1VQ6P 2FYUJ 2XR8A 1GW4A 2KOGA 1FZCB 2A06D 3PTZA 1KC8Q 1EXIA 1VQLP 2AEFA 3CWBD 3ITKA 4LC1A 1FDMA 1LWUC 4M3LA 3GG2A 2NPSD 3CX5H 2QJYC 4AIVA 1OVUA 2YXQB 3FOUA 4QCKA 1ZRTD 4I7ZB 2QSIA 2OYIB 1ZOYC 3P8CD 4YXWH 1U7JA 1EZVD 2JDIH 1KN7A 1W5CE 3QH9A 1GL2A 3Q5PA 1FZBA 1T8ZA 4L75A 2RMZA 5CJ4A 4XE5B 3V2PA 2IBZD 1L4AC 1KILE 3H1KD 1PP9D 3HRNA 3C9IA 1FE6A 2LKMA 1M90Q 1HUCA 3H1HD 3D6YA 3MUDA 4OGQB 1JY2O 1YITP 2Y9ZA 1HGVA 3HE5A 1H88A 2WSCJ 2BCCE 1N86A 5B5EE 2XSOA 1SFCB 5AW1B 1VQ4P 2FYZA 5AW9B 1IFPA 3WUTA 1L0NE 3VMZA 3L74G 3O6QB 2J58A 2Q5UA 1A02J 1KYOE 1X0TA 3AEAC 4HKZH 2NUKA 2XNDH 1M57D 1SQQD 1IO4A 3W67A 3GB4A 2R32A 3ZDMA 3VP8A 2ZJSE 1NDOA 2QA4P 1KB9D 3L72G 5AVXB 4NBDD 1KILC 1Y8AA 1MFZA 3H1IJ 4HM7A 3SFEC 1FOSE 3CCRP 1R8EA 3JSVC 1SQQJ 3E1RA 2D2CD 3GKEA 1ZR4A 2N1TD 2O01H 3CXHD 1RE3A 3M0DC 2CPBA 1BE3J 2Z4EA 2A06E 1N73B 3VMHD 2XSHA 3H32A 1KD1Q 1ZXGA 5CBOA 2HODB 2QM8A 1HF9A 1URQA 2YXRB 3L35A 2P1JA 4K3AA 1RE4A 1L0LD 2WMMA 1RQVA 1W2EA 2K9YA 3OJAB 1SQVE 4MN4C 1KILA 2IYOA 2QJPC 4GIFA 1OVRA 1EDJA 1NTZE 2KYVA 1GK4A 2KSJA 2FFDB 1QLED 1PP9G 3H1JD 3I56P 2FBWC 1YBKA 1KILD 4W80A 2NPSC 3RK3C 3Q3DA 3B5NB 2FXOA 4W7YA 3EFGA 4B86A 3Q1MA 1SJGA 2YIUC 1W2BO 3CCEP 5GTHH 4H44B 4OH8B 2KIKA 2ITAA 4L76A 1AVOA 1GL2C 2CK3H 5CCHA 1JUNA 1L2PA 5CXMA 2KI7B 1LT9C 1JOCA 3C8VA 1PGQA 2ZVOB 3VMXA 1PPJD 1O7GA 3GZXA 2PAJA 2E5TA 4IL6X 2DE5D 4H0LB 3RGUA 3VMYA 1JNMA 1BGYD 3OAKA 4NBHD 4JYBA 2KLVA 2QJYB 1FBMA 5K5GB 4NBAD 3L75J 1J1DB 2R5DA 2ZAEB 3H1LE 4WY4B 1PPJG 5APQA 2JJLA 4HB1A 1GU5A 3A0BH 5BOKA 1KB9H 1YJNP 1OW7A 1HJBA 4AQRD 2P67A 2OQQA 3AE5C 1DD3A 1SQVD 1NTKE 3CWBG 4Y99B 1H8AA 1MUUA 1T3UA 4EI2A 1SQQG 1OX3A 3PJSK 5AW3B 2WPQA 3CCVP 2YFIA 2QEXP 3CCLP 3P7KA 1EDIA 3CX5I 5APYA 1SQPG 4ASWA 3H1LG 5CMZA 2FXPA 1LT9B 3VTPC 1H0TB 3GHGA 1CZQA 2Y0CA 4TT3H 3HE4B 1RFSA 1KYOI 1FU1A 2YFLA 3VN0A 3TGUJ 4D6TJ 2B1XA 5AVSB 2E5YA 2H88C 3CWBJ 1RIEA 1Z56A 1VQ5P 1IZNB 1RF0C 2OYHA 3JCUE 1L0LG 4NBCD 5APWA 5CCHD 3H1KJ 3CXHH 4QUQA 1AJYA 3PP5A 3CC4P 1EQ7A 1L0LE 2W8ZA 1JY2N 4I7ZC 3V4WA 1EXJA 1NTMG 1S5LH 1NYHA 2JKVA 3L75E 3MUDC 2K1AA 1O7NA 4BRYA 2W6JH 2KXPB 2DE7D 4HM3A 1H0TA 1PP9E 2WTYA 1LT9A 2AXCA 1AQ5A 1URQC 3L72E 5L8RJ 5AW7B 4WY4D 2C0WA 4IFMA 1M56D 2WZ7A 5KAIE 2YO3A 2FYNC 3AEGC 4PD4H 1VQ9P 2CPSA 3MIWA 3CWBE 3CMAP 3H1ID 1VM9A 3GTSA 4N78E 2I7FA 2OYIA 3EFFK 2M8RA 4QDDA 1JM1A 3V2RA 3CX5E 4UB8E 1USEA 1FDIA 4H44C 3H1JJ 2E43A 3GLMA 4OVNF 5M1BA 1QX8A 3RL0B 2SPZA 4NBBD 1BGYE 3M9QA 4QDCA 3Q2YA 2WT7B 3L70D 2FKWB 1U57A 1RF1C 2YKQA 1J1EB 3H1IG 3BRVB 3M9BA 2Q1KA 1O7MA 1GW3A 3V2QA 3H1HJ 5TISE 2FFDC 1S2EA 1PGJA 3M0AA 3NXSA 2V4HA 3TGUE 4C46A 2W83C 4EMJB 4QURA 2QJPB 1BE3D 1NH4A 1S9KE 1EZVE 2NVEA 1GU4A 1IJDB 5CCGD 2H8PD 3B5NA 2JO1A 3L74E 3ABVC 1E5WA 3KPEA 3VMGD 4ZKUA 2NVGA 5CCGC 1YTZI 1IFDA 1KB9E 1D7MA 5BU5A 2NUMA 1X9VA 1SS1A 3NTNA 3H6PA 1JB0J 2M3BA 3C0DA 4JPZB 2W6BA 2M5AB 4JBZA 3SFDC 1A02F 4D6TG 4NPFX 1L0NK 2PFXA 3M91A 2FY8A 1KTMA 3CI9A 4GKGA 1LP1B 1MKMA 1OZHA 4HM5A 2LXCB 1URQB 1QEXA 2WSEH 3CCQP 4AAYB 2OTLP 2L5GB 4H13C 4WVZA 2B9BA 3Q5SA 1CW5A 1NAFA 2PP6A 3MHVA 4GDOA 4AYCA 2IBZG 5KJ7D 3RK3B 1CI6B 3D71A 3TYYA 1ZP0C 1SFCC 2C9NY 3HD7C 4HH2A 2M0BA 1RF0A 2I1JA 2AEMA 4HKVA 1LTJA 2JZAA 1DIPA 2DE6D 2ZYAA 1YQ3C 4PJ0E 1LTJB 2JWDA 2R3SA 3O6QA 4PD4E 1KQSO 3H25A 5E79H 1NYKA 1SVFA 1KYOH 1WRGA 3T97A 1WQLA 1SFCA 1IK9A 2V7QJ 1R5LA 2IFNA 1HWTC 2ZXEB 1SQXG 3HE5B 5CJ0A 4Y99C 3SWFA 5DJTB 2QJKC 1NJIQ 1M8OB 2I1KA 3PHLA 3H1IE 2KLUA 1Q86Q 3I5CA 3A7OA 4DOJA 2E75C 3L74D 4HM8A 3C1LA 2E75D 4W7ZA 2HMMA 2KUBA 1LGHB 2MJZA 3R2PA 1SQVK 1X79B 1S5LE 3GF7A 3AE4C 1T6AA 1BCCJ 1Q7YQ 4R4LA 3CXHE 1M1JC 1DEEG 5TISH 3GZYA 1G1JA 2IYPA 2QRXA 2Z5HA 1SQBK 4ZNCA 4OWFA 1K8AQ 3CCMP 1LT1A 1URQD 3HD7A 1R5SA 1SQBJ 1FZEA 2E76D 1N8RQ 2GUSA 3BASA 4HJGH 1MZ9A 1NTKG 4TLFA 2K3RA 3QWOC 3NFQA 3H1KE 1EC5A 1CSBA 5KJ7A 1YHQP 1ZV8A 2AEJA 2ZT9D 4UB6E 5KLVG 1G8KB 1RH5B 2RKLA 1OIPA 2E74B 1HVVA 1L0LK 2RN0A 3EQ2A 3L75G 1K05A 2WSCH 2BCCJ 3BCCG 1NTME 3L71E 4I6MC 1SQVG 3L71G 2WT7A 4PD4D 5APSA 5BU8B 2HMNA 3L70G 1FC2C 4P1BH 2E4QA 4NB8D 1BCCG 2XKMA 3GMAA 4PJ0H 5DJUB 2Q7CA 5BVZA 1SFCD 5HL4A 3KZIH 1NTKK 2NPSB 5KAFH 1N7LA 2JP3A 1ULIA 1NAYA 1PPJE 3VYIA 2YMYA 2IFMA 2N1TA 3HUSC 1X8YA 1OVVA 3V6IA 3RBZA 5TJHA 1VQ8P 3H1LJ 4HM2A 3D70A 2E42A 1LWUB 3RBXA 2C9LY 3RL0D 1K04A 2GBWA 5GTIE 4HYTB 4H0LC 1VQOP 2R44A 2YO2A 1AVYA 2D2CC 1KFMA 3TGUD 1QGKB 3WMM0 4O9BA 1Q81Q 1GK6A 1YIJP 4KJMA 5KAIH 1JTHA 3L73G 3M9HA 1NTZD 3M0DA 2YIUB 1RY3A 2QE7H 2B87A 2QPZA 1HTLC 2HYNA 4EDFA 3D6ZA 4HM6A 1AV1A 3GCEA 1BSHA 3CX5D 1OMIA 1JEKA 3O8ZA 1JCDA 3CD6P 3I55P 2Q3WA 1NHLA 2P10A 2OARA 2JEEA 3PLNA 1FQTA 3HE4A 2B24A 1YTZT 3M06A 4D6TE 1DX7A 1NO4A 3U1CA 3AEEC 2KZIA 3GHGB 2H89C 3MTUE 4KT0J 1O7PA 3GTEA 1AA0A 3CC2P 1NVOA 1FZCC 2WSSH 2N9BA 2BMOA 2BEZF 2XNXA 4U3FG 2NRGA 1BE3E 2W6AA 2BCCG 1LWUA 2QG4A 3RK3E 1P84D 3H1JE 4L73A 2IDBA 4RKUJ 1J2JB 1KZUB 2ZYGA 4NPDA 2JO6A 2K9JB 5KLVJ 1N7SC 4WY4A 3VMID 1BDDA 2NPSA 2QVAA 5KTBA 2OYOA 3TGUG 3S9OA 3KQGA 3WU2H 5AEWA 3F89A 5H2FE 2KP8A 3GL0A 3VMAA 1FS0E 3A0BE 3GOBA 1S72P 1BE3G 2NVFA 4N78D 2A06G 1NU1J 3L72J 4RESB 4U7JA 3HUSB 1GDTA 1AFOA 2HMJA 3A0HE 1ZN5A 1P84H 2AXTH 4BXLA 1VF5B 1Y47A 2I8DA 3HD7D 5KLIB 2KSEA 1T2KD 2WSFJ 3B4SA 5KLIC 3L73J 1QVGO 4P1CH 4IL6H 2H43A 5CCGA 1G2CA 2OYIC 3HTKA 5AVVB 3IFMA 3CPWO 1PL5A 4BWNA 2BMQA 1LTBC
chains in the Genus database with same CATH topology
1BE3E 3H1LE 2E76D 1SQPE 4H0LD 4OGQD 3L75E 2HMOA 3TGUE 1O7NA 1SQVE 3DQYA 2GBXA 4HKVA 2DE7D 3H1JE 2JZAA 1P84E 4HM1A 5BOKA 4HM3A 2DE6D 3EQQA 4EMJB 4NB9D 2E74D 5KLVE 2QJPC 3H1KE 1PP9E 1EG9A 1O7HA 1NU1E 4QURA 1BCCE 1NTZE 4H13D 1SQBE 2ZT9D 3L72E 1EZVE 2NVEA 1ULJA 1Q90C 2JO6A 4PD4E 1G8KB 3L73E 1UUVA 1NYKA 3N0QA 3VMID 1NTKE 4HM4A 3L74E 1WQLA 2QPZA 3VMGD 1G8JB 2BCCE 2NVGA 2XSOA 4HM6A 4HM0A 5AEWA 1NTME 2FYNC 1KB9E 3GL0A 2HMKA 3L71E 2YFIA 2YFJA 2QJKC 3GCEA 1L0NE 2YVJB 3GOBA 3H1HE 2HMLA 3H1IE 1SQXE 3CWBE 3BCCE 2HMNA 1KYOE 1SJGA 2NWFA 1SQQE 2NVFA 2NUKA 2YIUC 2XRXA 1VM9A 2NUMA 2FYUE 4P1BH 4QDFA 3GTSA 4HM8A 2E4QA 4NB8D 4NBFD 2XR8A 3GB4A 2I7FA 3C0DA 3GL2A 4NBED 2E75D 5HL4A 2Q3WA 2HMMA 1NDOA 1RFSA 5KKZC 4QDDA 4PV1D 2HMJA 1JM1A 4NBGD 5CXMA 2YFLA 3CX5E 1ZRTE 4NBDD 2B1XA 1FQTA 1ULIA 1PPJE 4H44D 2B24A 4QUPA 1RIEA 4HM7A 4D6TE 1O7GA 3GZXA 3EN1A 1VCKA 2BMRA 4HM5A 2DE5D 3CXHE 4NBBD 4QDFB 4U3FE 2D2CD 1O7WA 5KLIC 3GKEA 3VCAA 1BGYE 4P1CH 4AAYB 2QJYC 3GZYA 2CKFA 2E4PA 3AZCA 4AIVA 1O7PA 3GTEA 4HM2A 4NBHD 4NBCD 4QDCA 5AEUA 2A06E 3VCPA 3VMHD 2XSHA 3FOUA 4HJLA 4QCKA 3D89A 2IBZE 3L70E 2BMQA 4QUQA 2ZYLA 4NBAD 1VF5D 2BMOA 1UUWA 2GBWA 1L0LE 1O7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BE3 E;  3H1L E;  2E76 D;  1SQP E;  4H0L D;  4OGQ D;  3L75 E;  2HMO A;  3TGU E;  1O7N A;  1SQV E;  3DQY A;  2GBX A;  4HKV A;  2DE7 D;  3H1J E;  2JZA A;  1P84 E;  4HM1 A;  5BOK A;  4HM3 A;  2DE6 D;  3EQQ A;  4EMJ B;  4NB9 D;  2E74 D;  5KLV E;  2QJP C;  3H1K E;  1PP9 E;  1EG9 A;  1O7H A;  1NU1 E;  4QUR A;  1BCC E;  1NTZ E;  4H13 D;  1SQB E;  2ZT9 D;  3L72 E;  1EZV E;  2NVE A;  1ULJ A;  1Q90 C;  2JO6 A;  4PD4 E;  1G8K B;  3L73 E;  1UUV A;  1NYK A;  3N0Q A;  3VMI D;  1NTK E;  4HM4 A;  3L74 E;  1WQL A;  2QPZ A;  3VMG D;  1G8J B;  2BCC E;  2NVG A;  2XSO A;  4HM6 A;  4HM0 A;  5AEW A;  1NTM E;  2FYN C;  1KB9 E;  3GL0 A;  2HMK A;  3L71 E;  2YFI A;  2YFJ A;  2QJK C;  3GCE A;  1L0N E;  2YVJ B;  3GOB A;  3H1H E;  2HML A;  3H1I E;  1SQX E;  3CWB E;  3BCC E;  2HMN A;  1KYO E;  1SJG A;  2NWF A;  1SQQ E;  2NVF A;  2NUK A;  2YIU C;  2XRX A;  1VM9 A;  2NUM A;  2FYU E;  4P1B H;  4QDF A;  3GTS A;  4HM8 A;  2E4Q A;  4NB8 D;  4NBF D;  2XR8 A;  3GB4 A;  2I7F A;  3C0D A;  3GL2 A;  4NBE D;  2E75 D;  5HL4 A;  2Q3W A;  2HMM A;  1NDO A;  1RFS A;  5KKZ C;  4QDD A;  4PV1 D;  2HMJ A;  1JM1 A;  4NBG D;  5CXM A;  2YFL A;  3CX5 E;  1ZRT E;  4NBD D;  2B1X A;  1FQT A;  1ULI A;  1PPJ E;  4H44 D;  2B24 A;  4QUP A;  1RIE A;  4HM7 A;  4D6T E;  1O7G A;  3GZX A;  3EN1 A;  1VCK A;  2BMR A;  4HM5 A;  2DE5 D;  3CXH E;  4NBB D;  4QDF B;  4U3F E;  2D2C D;  1O7W A;  5KLI C;  3GKE A;  3VCA A;  1BGY E;  4P1C H;  4AAY B;  2QJY C;  3GZY A;  2CKF A;  2E4P A;  3AZC A;  4AIV A;  1O7P A;  3GTE A;  4HM2 A;  4NBH D;  4NBC D;  4QDC A;  5AEU A;  2A06 E;  3VCP A;  3VMH D;  2XSH A;  3FOU A;  4HJL A;  4QCK A;  3D89 A;  2IBZ E;  3L70 E;  2BMQ A;  4QUQ A;  2ZYL A;  4NBA D;  1VF5 D;  2BMO A;  1UUW A;  2GBW A;  1L0L E;  1O7M A; 
#chains in the Genus database with same CATH topology
 3FXE A;  2IZ0 A;  1YQ4 C;  5GTH E;  3VP9 A;  4UB8 H;  1HGZ A;  3SWY A;  1BGY G;  5APU A;  4EIJ A;  1LTG C;  3SSU A;  4LGD E;  1HBW A;  3P32 A;  1MV8 A;  3G3Z A;  1EZV I;  1GZL A;  3EQQ A;  4DZO A;  4NB9 D;  1T3J A;  1AQT A;  1N7S A;  3P8C E;  3IF4 A;  4WY4 C;  1VPC A;  1KIL B;  2JR8 A;  3B5N D;  4DCK A;  4JYC A;  2O01 J;  1ZW0 A;  3TSI A;  2KZJ A;  3GF3 A;  2POH A;  1VL2 A;  5AW0 B;  1U7M A;  1NKZ B;  1NGM B;  1PFI A;  1VQP P;  3BCC E;  1SQX D;  2FYU E;  2YMK A;  2A45 I;  1EDL A;  1YYC A;  1FOS F;  5KKZ C;  4U3F J;  4NBG D;  3L71 J;  2HPC B;  3H1K G;  3L36 A;  3MD0 A;  4D6T D;  4RO0 A;  1SP4 A;  4ASV A;  1TU3 F;  2M3E A;  2KNC B;  3JCU H;  4IL6 E;  2WSF H;  2E76 B;  5AVW B;  1Y9B A;  2WPR A;  2R5B A;  3L75 D;  2E4P A;  2QJK B;  2OGU A;  3N4X A;  5AEU A;  3AE1 C;  1LTJ C;  1KFN A;  3RL0 g;  2Q3I A;  4C7R A;  4HJL A;  2A45 H;  2ZFC A;  3A0H H;  1PZQ A;  1CI6 A;  1DH3 A;  2FYU G;  2IBZ I;  1GL2 D;  4OGQ D;  1S5L X;  1L4A B;  1NTZ K;  2ZXX A;  3JC2 2;  3V4Q A;  4GOD A;  3TF5 A;  1FZG A;  4HM1 A;  1JM0 A;  4PV1 C;  3B8E B;  3FGA D;  3NMD A;  4XFJ A;  4YTP C;  1LP1 A;  3RL0 C;  5APX A;  1ULJ A;  2K37 A;  1IFN A;  3W68 A;  3N7N A;  1MFT A;  1KQL A;  2M5A A;  3AE7 C;  4Y28 J;  1N7S B;  1RF1 A;  4HM0 A;  1JCC A;  3CLQ A;  1M7L A;  4K35 A;  2E76 C;  2P7J A;  2YVJ B;  4C7N A;  4H13 B;  1UIX A;  2Q3E A;  1N7S D;  1SQQ E;  3MGN A;  5B66 E;  2XRX A;  5E79 E;  1E79 H;  1K9M Q;  1UII A;  1NU1 G;  3GL2 A;  4NBE D;  1GD2 E;  4PV1 D;  2D2C B;  5AVU B;  1G1I A;  3RK2 B;  1FZC A;  2WPS A;  3FWL A;  3EN1 A;  1VCK A;  4U3F D;  2UWJ E;  1SQV J;  3IAO A;  1SQQ K;  2WWW A;  4QDF B;  3A3Y B;  1KQG B;  4ZMD A;  5KLV K;  1SQX K;  1VQ7 P;  2N9Y B;  3V5B A;  4CPG A;  1SQP K;  2HLO A;  1UUW A;  4RJT A;  2KS1 B;  3PH0 A;  1DEB A;  1VQM P;  2V7Q H;  3DQY A;  1LTA C;  2GBX A;  5H2F H;  3CME P;  3L37 A;  3RK3 D;  1DD4 A;  1P84 E;  2GUV A;  5KAF E;  2OTK E;  1QL2 A;  1OW8 A;  2FXM A;  1NU1 E;  5C39 A;  1IK7 A;  2RH0 A;  2O1J A;  2LR2 A;  2N1T C;  3KXD A;  3FX0 A;  3K5B A;  1XTG B;  1NKN A;  2WQY C;  4C7N B;  1UUV A;  1K73 Q;  4YPC A;  4WWI A;  2P2U A;  3EWK A;  1RF1 B;  1JY3 O;  2BCC D;  3MP7 B;  4YXD C;  3L71 D;  2B89 A;  3BAT A;  5B5E H;  2O3J A;  3BCC D;  3S4R A;  5KJ7 C;  2WIT A;  2K88 A;  2PRR A;  3B5N C;  3A5T A;  4GOF A;  2HG5 D;  1SQB G;  1JMB A;  5GTI H;  2OYH C;  1RE3 C;  1KV4 A;  3S1K A;  2YKO A;  1EZV G;  1KOR A;  1S1C X;  1QVF O;  1NTZ G;  1L4A A;  3A2A A;  5AW6 B;  1HH0 A;  5AVY B;  2E75 B;  1N2D C;  1JMM A;  3IN6 A;  1PGP A;  4I2L C;  3U1A A;  3VCA A;  1M1K Q;  1YI2 P;  2CKF A;  3VCP A;  2R3C A;  1YJ9 P;  4BRY B;  3RK2 D;  1L4A D;  2ZYL A;  2KB7 P;  3KZI E;  3H1H G;  3PRJ A;  3AE2 C;  2KNC A;  3G71 P;  3AEF C;  1SQP D;  2HPC A;  3L73 D;  3BCC J;  1LTT C;  4ZKP A;  3V2N A;  1LNQ A;  2L91 A;  1SLQ A;  5KLV D;  2J59 M;  2OYH B;  1VQN P;  1BCC D;  2JWA A;  1EG9 A;  1O7H A;  2A45 G;  3VOP A;  3TNU B;  2WVR A;  2LXB A;  4HM4 A;  3USS A;  1G8J B;  5AW5 B;  1JTH B;  2MKV A;  3AED C;  5CCH C;  1IFM A;  2H7H A;  1IFJ A;  1PIX A;  1Q82 Q;  4JF7 A;  2YFJ A;  1L0N G;  1NTM D;  3H1H E;  3L72 D;  2ZT9 B;  3P8M C;  3AE9 C;  1RHZ B;  2NWF A;  1IC2 A;  1NTM K;  1WT6 A;  1H89 A;  2Q6Q A;  4NBF D;  4IOI H;  1QL1 A;  3Q5R A;  4Z1M H;  5AVZ B;  3AEC C;  3KHU A;  1FZF A;  1KQF B;  2WPV B;  2FYU K;  1L0N D;  4IFF A;  2BAS A;  2W90 A;  3FWN A;  4H44 D;  1KYO D;  5KKZ B;  4QUP A;  2YNY A;  4JQ0 D;  4EYY Q;  2O01 N;  5EFW B;  2BMR A;  4GT1 A;  1O7W A;  2B88 A;  3AZC A;  1M1J B;  1NOH A;  2GA1 A;  3FXD A;  3HTK B;  1G2C B;  1PP9 J;  3BRT B;  2XV5 A;  3AEB C;  1VDF A;  2KK7 A;  1RE4 C;  1T2K C;  3CCJ P;  1PV3 A;  3LW5 H;  1LJ2 A;  4DJG A;  3AE8 C;  3HUS A;  1WMK A;  5AW4 B;  3AE3 C;  2Y0D A;  1SQB E;  1L0L J;  3TDK A;  4UB6 H;  1Q90 C;  2Y9Y A;  1P84 I;  1HJ0 A;  3L73 E;  1SQP J;  5B66 H;  2FYU D;  1NTK D;  1USD A;  1NTM J;  1SQX J;  1J1D C;  3R4Y A;  2BEQ D;  1S9K D;  1RQU A;  2K9J A;  1OFC X;  3OW2 O;  1BGY J;  4XA4 A;  1M1J A;  1FZA A;  4WB4 A;  1Q90 D;  2GM4 A;  1JY3 P;  1OW6 A;  1OWA A;  4NPE A;  1S3J A;  1NTZ J;  3HD7 B;  1YJW P;  2FFD A;  4WBA A;  1LTI C;  3WUV A;  5AVT B;  3LID A;  2WSE J;  2YKP A;  1J1E C;  4U3F E;  3U59 A;  1IFI A;  3CCU P;  1JY2 P;  3MZW B;  4PV1 B;  2E74 C;  2XDJ A;  3E1I A;  1NU1 K;  2QIW A;  3BVH A;  3CL3 D;  2OTJ P;  2ZVN B;  3L4F A;  2XU6 A;  1SQP E;  2ZT9 C;  2AXT E;  4H0L D;  2HOD A;  3H32 B;  1JY3 N;  3TNU A;  1N73 A;  1XTC C;  1FAV A;  3RK2 C;  2FYN B;  2IZ1 A;  2E74 D;  4KHX A;  4EOT A;  3F5H A;  4IFD K;  5AVR B;  3H1L D;  3G6E P;  3T97 B;  3B71 A;  1Q2N A;  3UIA A;  3CXH I;  1S4X A;  4QMA A;  2B87 B;  1L0N J;  1N73 C;  3G9R A;  2HMK A;  5APV A;  2Y0E A;  1BDC A;  4L74 A;  1NTK J;  1SQB D;  1SQX E;  3II6 A;  4A7P A;  2DW3 A;  1KMI Z;  3L70 J;  3GHG C;  3SWK A;  2QM7 A;  1PGO A;  1ZLL A;  1FJK A;  1NWQ A;  1ZRT E;  3CC7 P;  5AVQ B;  2P58 A;  2G3A A;  1ZME C;  4I1L A;  2XZR A;  5APT A;  3LW5 J;  2PGD A;  2HR3 A;  2G8Y A;  1BSN A;  2Z5I A;  1VF5 C;  4PD4 I;  1GL2 B;  3L74 J;  3CCS P;  3D89 A;  2J5U A;  2IBZ E;  3L70 E;  1VF5 D;  4N6J A;  2N1T B;  1FJP A;  1EDK A;  3AE6 C;  4OGQ C;  4R4M A;  2HMO A;  3WUU A;  2NZ2 A;  1ZR2 A;  2VRS A;  5AW2 B;  2Q9I A;  1FDO A;  3KYQ A;  3KDP B;  1GMJ A;  3G4S P;  5KLV E;  3TK1 A;  5CBN A;  4LLH A;  1BCC E;  1JO5 A;  1LTS C;  4H13 D;  3OA7 A;  3LIE A;  4DT0 A;  2ZYD A;  2W27 A;  1OXZ A;  4GOE A;  1VQK P;  4N3Y B;  3N0Q A;  2O1K A;  2KS1 A;  4AUW A;  1X22 A;  2HFE D;  3IR9 A;  3H1J G;  1NU1 D;  2C0X A;  3WU2 E;  1GTW A;  2HML A;  3GW6 A;  1KB9 I;  2IX7 C;  3E7K A;  5AW8 B;  4QDF A;  5CHX A;  2IPP A;  1VQ6 P;  2FYU J;  2XR8 A;  1GW4 A;  2KOG A;  1FZC B;  2A06 D;  3PTZ A;  1KC8 Q;  1EXI A;  1VQL P;  2AEF A;  3CWB D;  3ITK A;  4LC1 A;  1FDM A;  1LWU C;  4M3L A;  3GG2 A;  2NPS D;  3CX5 H;  2QJY C;  4AIV A;  1OVU A;  2YXQ B;  3FOU A;  4QCK A;  1ZRT D;  4I7Z B;  2QSI A;  2OYI B;  1ZOY C;  3P8C D;  4YXW H;  1U7J A;  1EZV D;  2JDI H;  1KN7 A;  1W5C E;  3QH9 A;  1GL2 A;  3Q5P A;  1FZB A;  1T8Z A;  4L75 A;  2RMZ A;  5CJ4 A;  4XE5 B;  3V2P A;  2IBZ D;  1L4A C;  1KIL E;  3H1K D;  1PP9 D;  3HRN A;  3C9I A;  1FE6 A;  2LKM A;  1M90 Q;  1HUC A;  3H1H D;  3D6Y A;  3MUD A;  4OGQ B;  1JY2 O;  1YIT P;  2Y9Z A;  1HGV A;  3HE5 A;  1H88 A;  2WSC J;  2BCC E;  1N86 A;  5B5E E;  2XSO A;  1SFC B;  5AW1 B;  1VQ4 P;  2FYZ A;  5AW9 B;  1IFP A;  3WUT A;  1L0N E;  3VMZ A;  3L74 G;  3O6Q B;  2J58 A;  2Q5U A;  1A02 J;  1KYO E;  1X0T A;  3AEA C;  4HKZ H;  2NUK A;  2XND H;  1M57 D;  1SQQ D;  1IO4 A;  3W67 A;  3GB4 A;  2R32 A;  3ZDM A;  3VP8 A;  2ZJS E;  1NDO A;  2QA4 P;  1KB9 D;  3L72 G;  5AVX B;  4NBD D;  1KIL C;  1Y8A A;  1MFZ A;  3H1I J;  4HM7 A;  3SFE C;  1FOS E;  3CCR P;  1R8E A;  3JSV C;  1SQQ J;  3E1R A;  2D2C D;  3GKE A;  1ZR4 A;  2N1T D;  2O01 H;  3CXH D;  1RE3 A;  3M0D C;  2CPB A;  1BE3 J;  2Z4E A;  2A06 E;  1N73 B;  3VMH D;  2XSH A;  3H32 A;  1KD1 Q;  1ZXG A;  5CBO A;  2HOD B;  2QM8 A;  1HF9 A;  1URQ A;  2YXR B;  3L35 A;  2P1J A;  4K3A A;  1RE4 A;  1L0L D;  2WMM A;  1RQV A;  1W2E A;  2K9Y A;  3OJA B;  1SQV E;  4MN4 C;  1KIL A;  2IYO A;  2QJP C;  4GIF A;  1OVR A;  1EDJ A;  1NTZ E;  2KYV A;  1GK4 A;  2KSJ A;  2FFD B;  1QLE D;  1PP9 G;  3H1J D;  3I56 P;  2FBW C;  1YBK A;  1KIL D;  4W80 A;  2NPS C;  3RK3 C;  3Q3D A;  3B5N B;  2FXO A;  4W7Y A;  3EFG A;  4B86 A;  3Q1M A;  1SJG A;  2YIU C;  1W2B O;  3CCE P;  5GTH H;  4H44 B;  4OH8 B;  2KIK A;  2ITA A;  4L76 A;  1AVO A;  1GL2 C;  2CK3 H;  5CCH A;  1JUN A;  1L2P A;  5CXM A;  2KI7 B;  1LT9 C;  1JOC A;  3C8V A;  1PGQ A;  2ZVO B;  3VMX A;  1PPJ D;  1O7G A;  3GZX A;  2PAJ A;  2E5T A;  4IL6 X;  2DE5 D;  4H0L B;  3RGU A;  3VMY A;  1JNM A;  1BGY D;  3OAK A;  4NBH D;  4JYB A;  2KLV A;  2QJY B;  1FBM A;  5K5G B;  4NBA D;  3L75 J;  1J1D B;  2R5D A;  2ZAE B;  3H1L E;  4WY4 B;  1PPJ G;  5APQ A;  2JJL A;  4HB1 A;  1GU5 A;  3A0B H;  5BOK A;  1KB9 H;  1YJN P;  1OW7 A;  1HJB A;  4AQR D;  2P67 A;  2OQQ A;  3AE5 C;  1DD3 A;  1SQV D;  1NTK E;  3CWB G;  4Y99 B;  1H8A A;  1MUU A;  1T3U A;  4EI2 A;  1SQQ G;  1OX3 A;  3PJS K;  5AW3 B;  2WPQ A;  3CCV P;  2YFI A;  2QEX P;  3CCL P;  3P7K A;  1EDI A;  3CX5 I;  5APY A;  1SQP G;  4ASW A;  3H1L G;  5CMZ A;  2FXP A;  1LT9 B;  3VTP C;  1H0T B;  3GHG A;  1CZQ A;  2Y0C A;  4TT3 H;  3HE4 B;  1RFS A;  1KYO I;  1FU1 A;  2YFL A;  3VN0 A;  3TGU J;  4D6T J;  2B1X A;  5AVS B;  2E5Y A;  2H88 C;  3CWB J;  1RIE A;  1Z56 A;  1VQ5 P;  1IZN B;  1RF0 C;  2OYH A;  3JCU E;  1L0L G;  4NBC D;  5APW A;  5CCH D;  3H1K J;  3CXH H;  4QUQ A;  1AJY A;  3PP5 A;  3CC4 P;  1EQ7 A;  1L0L E;  2W8Z A;  1JY2 N;  4I7Z C;  3V4W A;  1EXJ A;  1NTM G;  1S5L H;  1NYH A;  2JKV A;  3L75 E;  3MUD C;  2K1A A;  1O7N A;  4BRY A;  2W6J H;  2KXP B;  2DE7 D;  4HM3 A;  1H0T A;  1PP9 E;  2WTY A;  1LT9 A;  2AXC A;  1AQ5 A;  1URQ C;  3L72 E;  5L8R J;  5AW7 B;  4WY4 D;  2C0W A;  4IFM A;  1M56 D;  2WZ7 A;  5KAI E;  2YO3 A;  2FYN C;  3AEG C;  4PD4 H;  1VQ9 P;  2CPS A;  3MIW A;  3CWB E;  3CMA P;  3H1I D;  1VM9 A;  3GTS A;  4N78 E;  2I7F A;  2OYI A;  3EFF K;  2M8R A;  4QDD A;  1JM1 A;  3V2R A;  3CX5 E;  4UB8 E;  1USE A;  1FDI A;  4H44 C;  3H1J J;  2E43 A;  3GLM A;  4OVN F;  5M1B A;  1QX8 A;  3RL0 B;  2SPZ A;  4NBB D;  1BGY E;  3M9Q A;  4QDC A;  3Q2Y A;  2WT7 B;  3L70 D;  2FKW B;  1U57 A;  1RF1 C;  2YKQ A;  1J1E B;  3H1I G;  3BRV B;  3M9B A;  2Q1K A;  1O7M A;  1GW3 A;  3V2Q A;  3H1H J;  5TIS E;  2FFD C;  1S2E A;  1PGJ A;  3M0A A;  3NXS A;  2V4H A;  3TGU E;  4C46 A;  2W83 C;  4EMJ B;  4QUR A;  2QJP B;  1BE3 D;  1NH4 A;  1S9K E;  1EZV E;  2NVE A;  1GU4 A;  1IJD B;  5CCG D;  2H8P D;  3B5N A;  2JO1 A;  3L74 E;  3ABV C;  1E5W A;  3KPE A;  3VMG D;  4ZKU A;  2NVG A;  5CCG C;  1YTZ I;  1IFD A;  1KB9 E;  1D7M A;  5BU5 A;  2NUM A;  1X9V A;  1SS1 A;  3NTN A;  3H6P A;  1JB0 J;  2M3B A;  3C0D A;  4JPZ B;  2W6B A;  2M5A B;  4JBZ A;  3SFD C;  1A02 F;  4D6T G;  4NPF X;  1L0N K;  2PFX A;  3M91 A;  2FY8 A;  1KTM A;  3CI9 A;  4GKG A;  1LP1 B;  1MKM A;  1OZH A;  4HM5 A;  2LXC B;  1URQ B;  1QEX A;  2WSE H;  3CCQ P;  4AAY B;  2OTL P;  2L5G B;  4H13 C;  4WVZ A;  2B9B A;  3Q5S A;  1CW5 A;  1NAF A;  2PP6 A;  3MHV A;  4GDO A;  4AYC A;  2IBZ G;  5KJ7 D;  3RK3 B;  1CI6 B;  3D71 A;  3TYY A;  1ZP0 C;  1SFC C;  2C9N Y;  3HD7 C;  4HH2 A;  2M0B A;  1RF0 A;  2I1J A;  2AEM A;  4HKV A;  1LTJ A;  2JZA A;  1DIP A;  2DE6 D;  2ZYA A;  1YQ3 C;  4PJ0 E;  1LTJ B;  2JWD A;  2R3S A;  3O6Q A;  4PD4 E;  1KQS O;  3H25 A;  5E79 H;  1NYK A;  1SVF A;  1KYO H;  1WRG A;  3T97 A;  1WQL A;  1SFC A;  1IK9 A;  2V7Q J;  1R5L A;  2IFN A;  1HWT C;  2ZXE B;  1SQX G;  3HE5 B;  5CJ0 A;  4Y99 C;  3SWF A;  5DJT B;  2QJK C;  1NJI Q;  1M8O B;  2I1K A;  3PHL A;  3H1I E;  2KLU A;  1Q86 Q;  3I5C A;  3A7O A;  4DOJ A;  2E75 C;  3L74 D;  4HM8 A;  3C1L A;  2E75 D;  4W7Z A;  2HMM A;  2KUB A;  1LGH B;  2MJZ A;  3R2P A;  1SQV K;  1X79 B;  1S5L E;  3GF7 A;  3AE4 C;  1T6A A;  1BCC J;  1Q7Y Q;  4R4L A;  3CXH E;  1M1J C;  1DEE G;  5TIS H;  3GZY A;  1G1J A;  2IYP A;  2QRX A;  2Z5H A;  1SQB K;  4ZNC A;  4OWF A;  1K8A Q;  3CCM P;  1LT1 A;  1URQ D;  3HD7 A;  1R5S A;  1SQB J;  1FZE A;  2E76 D;  1N8R Q;  2GUS A;  3BAS A;  4HJG H;  1MZ9 A;  1NTK G;  4TLF A;  2K3R A;  3QWO C;  3NFQ A;  3H1K E;  1EC5 A;  1CSB A;  5KJ7 A;  1YHQ P;  1ZV8 A;  2AEJ A;  2ZT9 D;  4UB6 E;  5KLV G;  1G8K B;  1RH5 B;  2RKL A;  1OIP A;  2E74 B;  1HVV A;  1L0L K;  2RN0 A;  3EQ2 A;  3L75 G;  1K05 A;  2WSC H;  2BCC J;  3BCC G;  1NTM E;  3L71 E;  4I6M C;  1SQV G;  3L71 G;  2WT7 A;  4PD4 D;  5APS A;  5BU8 B;  2HMN A;  3L70 G;  1FC2 C;  4P1B H;  2E4Q A;  4NB8 D;  1BCC G;  2XKM A;  3GMA A;  4PJ0 H;  5DJU B;  2Q7C A;  5BVZ A;  1SFC D;  5HL4 A;  3KZI H;  1NTK K;  2NPS B;  5KAF H;  1N7L A;  2JP3 A;  1ULI A;  1NAY A;  1PPJ E;  3VYI A;  2YMY A;  2IFM A;  2N1T A;  3HUS C;  1X8Y A;  1OVV A;  3V6I A;  3RBZ A;  5TJH A;  1VQ8 P;  3H1L J;  4HM2 A;  3D70 A;  2E42 A;  1LWU B;  3RBX A;  2C9L Y;  3RL0 D;  1K04 A;  2GBW A;  5GTI E;  4HYT B;  4H0L C;  1VQO P;  2R44 A;  2YO2 A;  1AVY A;  2D2C C;  1KFM A;  3TGU D;  1QGK B;  3WMM 0;  4O9B A;  1Q81 Q;  1GK6 A;  1YIJ P;  4KJM A;  5KAI H;  1JTH A;  3L73 G;  3M9H A;  1NTZ D;  3M0D A;  2YIU B;  1RY3 A;  2QE7 H;  2B87 A;  2QPZ A;  1HTL C;  2HYN A;  4EDF A;  3D6Z A;  4HM6 A;  1AV1 A;  3GCE A;  1BSH A;  3CX5 D;  1OMI A;  1JEK A;  3O8Z A;  1JCD A;  3CD6 P;  3I55 P;  2Q3W A;  1NHL A;  2P10 A;  2OAR A;  2JEE A;  3PLN A;  1FQT A;  3HE4 A;  2B24 A;  1YTZ T;  3M06 A;  4D6T E;  1DX7 A;  1NO4 A;  3U1C A;  3AEE C;  2KZI A;  3GHG B;  2H89 C;  3MTU E;  4KT0 J;  1O7P A;  3GTE A;  1AA0 A;  3CC2 P;  1NVO A;  1FZC C;  2WSS H;  2N9B A;  2BMO A;  2BEZ F;  2XNX A;  4U3F G;  2NRG A;  1BE3 E;  2W6A A;  2BCC G;  1LWU A;  2QG4 A;  3RK3 E;  1P84 D;  3H1J E;  4L73 A;  2IDB A;  4RKU J;  1J2J B;  1KZU B;  2ZYG A;  4NPD A;  2JO6 A;  2K9J B;  5KLV J;  1N7S C;  4WY4 A;  3VMI D;  1BDD A;  2NPS A;  2QVA A;  5KTB A;  2OYO A;  3TGU G;  3S9O A;  3KQG A;  3WU2 H;  5AEW A;  3F89 A;  5H2F E;  2KP8 A;  3GL0 A;  3VMA A;  1FS0 E;  3A0B E;  3GOB A;  1S72 P;  1BE3 G;  2NVF A;  4N78 D;  2A06 G;  1NU1 J;  3L72 J;  4RES B;  4U7J A;  3HUS B;  1GDT A;  1AFO A;  2HMJ A;  3A0H E;  1ZN5 A;  1P84 H;  2AXT H;  4BXL A;  1VF5 B;  1Y47 A;  2I8D A;  3HD7 D;  5KLI B;  2KSE A;  1T2K D;  2WSF J;  3B4S A;  5KLI C;  3L73 J;  1QVG O;  4P1C H;  4IL6 H;  2H43 A;  5CCG A;  1G2C A;  2OYI C;  3HTK A;  5AVV B;  3IFM A;  3CPW O;  1PL5 A;  4BWN A;  2BMQ A;  1LTB C; 
#chains in the Genus database with same CATH homology
 1BE3 E;  3H1L E;  2E76 D;  1SQP E;  4H0L D;  4OGQ D;  3L75 E;  2HMO A;  3TGU E;  1O7N A;  1SQV E;  3DQY A;  2GBX A;  4HKV A;  2DE7 D;  3H1J E;  2JZA A;  1P84 E;  4HM1 A;  5BOK A;  4HM3 A;  2DE6 D;  3EQQ A;  4EMJ B;  4NB9 D;  2E74 D;  5KLV E;  2QJP C;  3H1K E;  1PP9 E;  1EG9 A;  1O7H A;  1NU1 E;  4QUR A;  1BCC E;  1NTZ E;  4H13 D;  1SQB E;  2ZT9 D;  3L72 E;  1EZV E;  2NVE A;  1ULJ A;  1Q90 C;  2JO6 A;  4PD4 E;  1G8K B;  3L73 E;  1UUV A;  1NYK A;  3N0Q A;  3VMI D;  1NTK E;  4HM4 A;  3L74 E;  1WQL A;  2QPZ A;  3VMG D;  1G8J B;  2BCC E;  2NVG A;  2XSO A;  4HM6 A;  4HM0 A;  5AEW A;  1NTM E;  2FYN C;  1KB9 E;  3GL0 A;  2HMK A;  3L71 E;  2YFI A;  2YFJ A;  2QJK C;  3GCE A;  1L0N E;  2YVJ B;  3GOB A;  3H1H E;  2HML A;  3H1I E;  1SQX E;  3CWB E;  3BCC E;  2HMN A;  1KYO E;  1SJG A;  2NWF A;  1SQQ E;  2NVF A;  2NUK A;  2YIU C;  2XRX A;  1VM9 A;  2NUM A;  2FYU E;  4P1B H;  4QDF A;  3GTS A;  4HM8 A;  2E4Q A;  4NB8 D;  4NBF D;  2XR8 A;  3GB4 A;  2I7F A;  3C0D A;  3GL2 A;  4NBE D;  2E75 D;  5HL4 A;  2Q3W A;  2HMM A;  1NDO A;  1RFS A;  5KKZ C;  4QDD A;  4PV1 D;  2HMJ A;  1JM1 A;  4NBG D;  5CXM A;  2YFL A;  3CX5 E;  1ZRT E;  4NBD D;  2B1X A;  1FQT A;  1ULI A;  1PPJ E;  4H44 D;  2B24 A;  4QUP A;  1RIE A;  4HM7 A;  4D6T E;  1O7G A;  3GZX A;  3EN1 A;  1VCK A;  2BMR A;  4HM5 A;  2DE5 D;  3CXH E;  4NBB D;  4QDF B;  4U3F E;  2D2C D;  1O7W A;  5KLI C;  3GKE A;  3VCA A;  1BGY E;  4P1C H;  4AAY B;  2QJY C;  3GZY A;  2CKF A;  2E4P A;  3AZC A;  4AIV A;  1O7P A;  3GTE A;  4HM2 A;  4NBH D;  4NBC D;  4QDC A;  5AEU A;  2A06 E;  3VCP A;  3VMH D;  2XSH A;  3FOU A;  4HJL A;  4QCK A;  3D89 A;  2IBZ E;  3L70 E;  2BMQ A;  4QUQ A;  2ZYL A;  4NBA D;  1VF5 D;  2BMO A;  1UUW A;  2GBW A;  1L0L E;  1O7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...