4PIKA

Crystal structure of banana lectin bound to dimannose
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
140
structure length
140
Chain Sequence
AIKVGAWGGNGGSAFDMGPAYRIISVKIFSGDVVDGVDVTFTYYGKTETRHYGGSGGTPHEIVLQEGEYLVGMAGEVANYHGAVVLGKLGFSTNKKAYGPFGNTGGTPFSLPIAAGKISGFFGRGGKFLDAIGVYLEPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering a Therapeutic Lectin by Uncoupling Mitogenicity from Antiviral Activity.
pubmed doi rcsb
molecule keywords Ripening-associated protein
molecule tags Sugar binding protein
source organism Musa acuminata
total genus 24
structure length 140
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 4pikA00
4R6NA 1UGYC 1WS5A 1J4TA 5BN6E 1WS5C 1C3KA 2BN0A 4R6PA 5J4XA 4PIKA 3P8SA 2HYQA 3LL0A 3VZEA 1OUWA 3LKYA 5AV7A 3MITA 1J4UA 3R52A 1KUJA 1X1VA 1JOTA 5J51A 3LLZA 4AKDA 1KU8A 4PITA 3LL1A 3WOCA 3VY6A 1ZGRA 2GUEA 1ZGSA 3R50A 1UH1A 4GX7A 4DDNA 2NUOA 3R51A 4AKCA 1TOQA 1VBOA 1UGXA 3VZGA 4PIFA 1WS4C 1XXQA 2HYRA 3WOBA 1XXRA 4AKBA 1M26A 4AK4A 5J50A 2BMZA 3LM1A 3O44A 3AQGA 4PIUA 5JM1A 1J4SA 4R6OA 1UGWA 3LL2A 4MQ0A 3MIVA 1WS4A 3APAA 3MIUA 2GTYA 1C3NA 1UGWC 3LLYA 4R6RA 2JZ4A 1PXDA 2BMYA 4WOGA 1JACA 2NU5A 1C3MA 2GUDA 2GUCA 3VY7A 2GUXA 3VZFA 1UH0A 1TP8A 5J4TA 1XEZA 4R6QA 1VBPA 1UGYA 5EXGA
chains in the Genus database with same CATH superfamily
4R6NA 1UGYC 1CIYA 1WS5A 1J4TA 5BN6E 4QX1A 1WS5C 1C3KA 2BN0A 4R6PA 5J4XA 4PIKA 4QX2A 3P8SA 2HYQA 4W8JA 3LL0A 3VZEA 2QP2A 1OUWA 3LKYA 5AV7A 3MITA 1J4UA 3R52A 1KUJA 1X1VA 1JOTA 1I5PA 5J51A 4D8MA 3EB7A 3LLZA 4AKDA 1KU8A 1VMOA 4PITA 3LL1A 3WOCA 3VY6A 1ZGRA 2GUEA 1ZGSA 3R50A 1UH1A 3TOWA 4GX7A 4DDNA 1JI6A 2NUOA 3R51A 4AKCA 1TOQA 1VBOA 1UGXA 2C9KA 4QX0A 4ARXA 3VZGA 4PIFA 1WS4C 4QX3A 1XXQA 2HYRA 3WOBA 1XXRA 4AKBA 1M26A 4AK4A 5J50A 2BMZA 3LM1A 3O44A 3AQGA 4PIUA 5JM1A 1J4SA 4R6OA 1UGWA 3LL2A 4MQ0A 3MIVA 1WS4A 3APAA 3MIUA 2GTYA 1C3NA 1UGWC 3LLYA 4R6RA 2JZ4A 1PXDA 4ARYA 2BMYA 4WOGA 1JACA 2NU5A 1C3MA 2GUDA 2GUCA 3VY7A 2GUXA 3VZFA 1DLCA 1W99A 1UH0A 1TP8A 5J4TA 1XEZA 4R6QA 1VBPA 4MOAA 1UGYA 5EXGA
chains in the Genus database with same CATH topology
4R6NA 1UGYC 1WS5A 1J4TA 5BN6E 1WS5C 1C3KA 2BN0A 4R6PA 5J4XA 4PIKA 3P8SA 2HYQA 3LL0A 3VZEA 1OUWA 3LKYA 5AV7A 3MITA 1J4UA 3R52A 1KUJA 1X1VA 1JOTA 5J51A 3LLZA 4AKDA 1KU8A 4PITA 3LL1A 3WOCA 3VY6A 1ZGRA 2GUEA 1ZGSA 3R50A 1UH1A 4GX7A 4DDNA 2NUOA 3R51A 4AKCA 1TOQA 1VBOA 1UGXA 3VZGA 4PIFA 1WS4C 1XXQA 2HYRA 3WOBA 1XXRA 4AKBA 1M26A 4AK4A 5J50A 2BMZA 3LM1A 3O44A 3AQGA 4PIUA 5JM1A 1J4SA 4R6OA 1UGWA 3LL2A 4MQ0A 3MIVA 1WS4A 3APAA 3MIUA 2GTYA 1C3NA 1UGWC 3LLYA 4R6RA 2JZ4A 1PXDA 2BMYA 4WOGA 1JACA 2NU5A 1C3MA 2GUDA 2GUCA 3VY7A 2GUXA 3VZFA 1UH0A 1TP8A 5J4TA 1XEZA 4R6QA 1VBPA 1UGYA 5EXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R6N A;  1UGY C;  1WS5 A;  1J4T A;  5BN6 E;  1WS5 C;  1C3K A;  2BN0 A;  4R6P A;  5J4X A;  4PIK A;  3P8S A;  2HYQ A;  3LL0 A;  3VZE A;  1OUW A;  3LKY A;  5AV7 A;  3MIT A;  1J4U A;  3R52 A;  1KUJ A;  1X1V A;  1JOT A;  5J51 A;  3LLZ A;  4AKD A;  1KU8 A;  4PIT A;  3LL1 A;  3WOC A;  3VY6 A;  1ZGR A;  2GUE A;  1ZGS A;  3R50 A;  1UH1 A;  4GX7 A;  4DDN A;  2NUO A;  3R51 A;  4AKC A;  1TOQ A;  1VBO A;  1UGX A;  3VZG A;  4PIF A;  1WS4 C;  1XXQ A;  2HYR A;  3WOB A;  1XXR A;  4AKB A;  1M26 A;  4AK4 A;  5J50 A;  2BMZ A;  3LM1 A;  3O44 A;  3AQG A;  4PIU A;  5JM1 A;  1J4S A;  4R6O A;  1UGW A;  3LL2 A;  4MQ0 A;  3MIV A;  1WS4 A;  3APA A;  3MIU A;  2GTY A;  1C3N A;  1UGW C;  3LLY A;  4R6R A;  2JZ4 A;  1PXD A;  2BMY A;  4WOG A;  1JAC A;  2NU5 A;  1C3M A;  2GUD A;  2GUC A;  3VY7 A;  2GUX A;  3VZF A;  1UH0 A;  1TP8 A;  5J4T A;  1XEZ A;  4R6Q A;  1VBP A;  1UGY A;  5EXG A; 
#chains in the Genus database with same CATH topology
 4R6N A;  1UGY C;  1CIY A;  1WS5 A;  1J4T A;  5BN6 E;  4QX1 A;  1WS5 C;  1C3K A;  2BN0 A;  4R6P A;  5J4X A;  4PIK A;  4QX2 A;  3P8S A;  2HYQ A;  4W8J A;  3LL0 A;  3VZE A;  2QP2 A;  1OUW A;  3LKY A;  5AV7 A;  3MIT A;  1J4U A;  3R52 A;  1KUJ A;  1X1V A;  1JOT A;  1I5P A;  5J51 A;  4D8M A;  3EB7 A;  3LLZ A;  4AKD A;  1KU8 A;  1VMO A;  4PIT A;  3LL1 A;  3WOC A;  3VY6 A;  1ZGR A;  2GUE A;  1ZGS A;  3R50 A;  1UH1 A;  3TOW A;  4GX7 A;  4DDN A;  1JI6 A;  2NUO A;  3R51 A;  4AKC A;  1TOQ A;  1VBO A;  1UGX A;  2C9K A;  4QX0 A;  4ARX A;  3VZG A;  4PIF A;  1WS4 C;  4QX3 A;  1XXQ A;  2HYR A;  3WOB A;  1XXR A;  4AKB A;  1M26 A;  4AK4 A;  5J50 A;  2BMZ A;  3LM1 A;  3O44 A;  3AQG A;  4PIU A;  5JM1 A;  1J4S A;  4R6O A;  1UGW A;  3LL2 A;  4MQ0 A;  3MIV A;  1WS4 A;  3APA A;  3MIU A;  2GTY A;  1C3N A;  1UGW C;  3LLY A;  4R6R A;  2JZ4 A;  1PXD A;  4ARY A;  2BMY A;  4WOG A;  1JAC A;  2NU5 A;  1C3M A;  2GUD A;  2GUC A;  3VY7 A;  2GUX A;  3VZF A;  1DLC A;  1W99 A;  1UH0 A;  1TP8 A;  5J4T A;  1XEZ A;  4R6Q A;  1VBP A;  4MOA A;  1UGY A;  5EXG A; 
#chains in the Genus database with same CATH homology
 4R6N A;  1UGY C;  1WS5 A;  1J4T A;  5BN6 E;  1WS5 C;  1C3K A;  2BN0 A;  4R6P A;  5J4X A;  4PIK A;  3P8S A;  2HYQ A;  3LL0 A;  3VZE A;  1OUW A;  3LKY A;  5AV7 A;  3MIT A;  1J4U A;  3R52 A;  1KUJ A;  1X1V A;  1JOT A;  5J51 A;  3LLZ A;  4AKD A;  1KU8 A;  4PIT A;  3LL1 A;  3WOC A;  3VY6 A;  1ZGR A;  2GUE A;  1ZGS A;  3R50 A;  1UH1 A;  4GX7 A;  4DDN A;  2NUO A;  3R51 A;  4AKC A;  1TOQ A;  1VBO A;  1UGX A;  3VZG A;  4PIF A;  1WS4 C;  1XXQ A;  2HYR A;  3WOB A;  1XXR A;  4AKB A;  1M26 A;  4AK4 A;  5J50 A;  2BMZ A;  3LM1 A;  3O44 A;  3AQG A;  4PIU A;  5JM1 A;  1J4S A;  4R6O A;  1UGW A;  3LL2 A;  4MQ0 A;  3MIV A;  1WS4 A;  3APA A;  3MIU A;  2GTY A;  1C3N A;  1UGW C;  3LLY A;  4R6R A;  2JZ4 A;  1PXD A;  2BMY A;  4WOG A;  1JAC A;  2NU5 A;  1C3M A;  2GUD A;  2GUC A;  3VY7 A;  2GUX A;  3VZF A;  1UH0 A;  1TP8 A;  5J4T A;  1XEZ A;  4R6Q A;  1VBP A;  1UGY A;  5EXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...