4PJOC

Minimal u1 snrnp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
b'GSGSVKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein Sm D3
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing
total genus 14
structure length 86
sequence length 86
chains with identical sequence Q, c, q
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoC00
3QO3A 4M78D 4DQ2A 4F7UA 1TH7A 4C92A 4HA8A 4C92D 5GAOr 4PJOD 4MMLA 3SWNC 5GAOm 5CAIA 3JB9D 2JN0A 4MMKA 1KQ1A 4M7DA 2DKGA 4M75F 5LJ5d 5GAOq 1LOJA 3L2ZA 5GMKj 4QVCA 2YLCA 2E41A 4EMHA 1I81A 5GAN3 4PJOB 1JRIA 3V8KA 4M77D 3SWNA 3JCMd 1KQ2A 4J6XA 4V2SA 4M75C 5GAN4 4EMKB 2YHTA 4M77E 5GMKh 4J5YA 3JCMQ 3RKYA 1M5Q1 3QUIA 1D3BB 5GANf 3FJPA 5DY9A 5GAN2 3V8LA 4M77B 2ZGWA 4C8QG 4M75A 3FIFA 5GMKe 2VC8A 1H641 3RERA 2EWNA 4XTWA 2RB6A 4M7AE 3HFNA 5LJ3h 4M78E 4M7DD 3RIRA 4HT9A 4PJOE 4C92E 1HXDA 4HT8A 4A54A 3M4GA 4C8QF 1HK9A 3JB9I 4J6YA 4M7AB 1I4K1 4X9CA 3RKWA 4M78B 1WQ7A 4N0AC 4NOYA 2DZCA 2E64A 3EFSA 2RD1A 3JCMc 4C92B 5GANd 5GAN8 5LJ3e 5GAMj 5GAMg 3BY7A 3AHUA 2Y90A 2YLBA 4XU0A 4C8QC 2I2LA 4M7AG 2QTXA 1BIBA 4JRIA 4M78G 1MGQA 4PNOA 4PJOG 3JCMh 4Y91A 4C92G 2RA2A 1WPYA 2DEQA 1YCYA 4N0AA 5GAOp 3JB9G 5GAMh 5LJ3j 5LJ3g 5GAOl 1JBMA 2FB7A 4XTZA 2RM4A 3L1AA 3V7CA 4M75D 4M7AF 4C8QA 1Y96B 4EMGA 1WNLA 3JCMe 4M78F 4PJOF 3QSUA 2E65A 4A53A 3PGGA 4C92F 3V7RA 5LJ3f 1D3BA 4M77G 5GAMe 1B34B 3JB9F 4RCCA 4F7UE 3JCMP 1N9SA 5GAN7 3JCMW 3SB2A 3BDUA 4NL3A 5GMKl 3HFOA 2DXTA 4M78C 4PJOC 4XTXA 4M7DE 4JLIA 1U1TA 3JCMg 4F7UB 1BIAA 4J6WA 3JB9J 5LJ5h 3HSBA 2DJZA 1LNXA 4M77F 4XTVA 3FB9A 2DTOA 4EMKC 4JRKA 2EJFA 4M7DB 5GANh 5I21A 3JB9H 4JUVA 3EFRA 3BW1A 3JCMX 3JCMJ 4F7UG 2FYKA 2VXEA 5LJ3d 4M78A 4QVDA 4PJOA 5GAMf 5LJ5e 4M77C 1WQWA 4XTYA 3RUXA 5GAN6 4M7DG 3SWNB 5GANe 2EAYA 4WF2A 4EMKA 1N9RA 4NL2A 3BFMA 1LJOA 2VXFA 4X9DA 4XTUA 4C8QD 2E1HA 2DZ9A 4F7UF 5GMKi 3JCMV 5LJ5j 5LJ5g 4M75E 1I8FA 2EJ9A 3INZA 4OP0A 1I5LA 4M77A 4C8QE 4M7AD 2DTIA 1M8VA 4M7DF 4XU1A 5GMKm 3RESA 5GANg 5GANj 4M7AC 2CGHA 2HNIA 3JCMb 5GAN5 3VU3C 1Y96A 2DVEA 1X01A 4M75B 3RKXA 4XU2A 4C92C 5GAMd 4C8QB 5LJ5f 5GAOn 2DXUA 3V7SA 1B34A 2E10A 2EJGA 3QHSA 4XU3A 2DTHA 3GIBA 4M7DC 3JCMf 4RCBA 2K57A 4M75G 4XQ3A 4M7AA 1U1SA 3V8JA
chains in the Genus database with same CATH superfamily
4RTUA 1BI2A 1VYVA 4C92D 3CXCP 1C0MA 5CAIA 2JMAA 2LT4A 2MPXC 2ED0A 1YI2T 2YUQA 5IAYA 1VQ4Q 2DJQA 1M27C 2CUDA 1JRIA 3ASKA 1OPLA 1UJYA 1M8MA 4KULA 4BI3A 2MAMA 2CUBA 3I55A 1JEGA 3EH1A 1XTDA 4ELYC 4BB7A 3HL8A 1M2VA 1VQ8T 3X26B 3M5AA 2AZSA 1MUZA 7AT1B 4A54A 3JB9I 3UPUA 1HK9A 3RKWA 5GANd 1KIKA 2RK2A 5LL6S 1WX6A 1RABB 3VUZA 2PNIA 2ENMA 3OYGA 1BIBA 2DMOA 1ABOA 2M51A 3J7AF 3VV0A 4JZ3A 4OB2B 3JRZA 2DL5A 1YWPA 2VGNA 2VKNA 2YSQA 1ZLMA 2LJ1A 3EGDA 4J9CA 1B34B 4ESRA 2X3WD 2EGAA 5FWCA 1WFWA 3SB2A 3TCJA 5GMKl 1XOVA 3CPWA 1E7OA 2JS2A 3UDCA 1OZ2A 4DOVA 2FG0A 2EJFA 3NPFA 1PSEA 5KCHA 3JCMX 1QCFA 1QVGS 3CCVT 1VQ4A 4RTVA 4XTYA 1MMNA 2QQSA 1H8KA 1ZX6A 4EMKA 5L8RE 3I5SA 3JCMV 3A98A 1UGPB 2QI2A 1B07A 2KRMA 5CO7A 2QEXT 1NPRA 4C8QB 3S6WA 2DE0X 2GGRA 1W2BA 3M56A 3ULRB 4M7AA 2HEQA 4F7UA 4BE2A 2COYA 1TH7A 1T3SA 1KQ1A 1QVGP 4LUEA 2VWFA 1KHCA 4ZTJA 2DILA 4B9XA 4DOWA 2CSIA 3JCMd 2KXDA 1G83A 4AFUC 2RF0A 3C0CA 1ARKA 2K3XA 3G4ST 1UB4A 5KYYA 4DBHA 4M75A 5GMKe 3NGPA 3X25B 4PFOA 1M3BA 1UDLA 3FLGA 5IH2A 2RHUA 3OS0A 1CKBA 1PWTA 2COWA 4IUVA 4J6YA 3CPWP 4NOYA 1U8RA 3T9NA 2L2PA 3RBBB 1JO8A 3GLXA 4E2FB 1K76A 3UA7A 1JXOA 3L2RA 1TOVA 2JXBA 4FU6A 1PKSA 5GAOp 4NS5A 1Q7YR 5LJ3g 2R57A 2NLUA 2RQWA 4Z8AA 3I56T 3S3NA 1VYTA 2E65A 2ZCFB 2ED1A 1D1AA 2NUZA 1ZSZB 1AZGB 2CS7A 3H41A 2O9VA 3E9FA 1W2BP 3JB9H 1Z9ZA 3JV3A 3OYJA 1VQ5T 4J8OA 5GAN6 4J9FA 4FYVB 5GANe 4DBRA 2NUPA 4J9DA 1YWOA 4MZPA 2GTJA 1K9AA 1EX4A 2VUBA 5LJ5j 2J7IA 4R55A 2OTJQ 2H3JA 3GF5A 1JU5C 3OMCA 3RKXA 2OAUA 3V7SA 1H3ZA 3VRYA 5IXBA 3VS6A 1YITQ 1R0CB 1IHVA 1WJSA 2V1QA 4HA8A 3PMTA 3UATA 4M7DA 5A0GA 2IG0A 1M1GA 4J7IA 5GMKj 5KYXB 1RAHB 2QA4Q 2XMFA 1QVFA 1GBRA 4J6XA 4QT7A 4V2SA 3CCJT 2VGMA 3J81E 1Y0MA 1OI1A 4O5VA 1MHNA 1WJQA 4RTYA 2R5AA 2DA9A 3V8LA 2ZGWA 1WHGA 1BB9A 2L3RA 3FIFA 5HY6A 4XTWA 3HRSA 2VB6A 4K11A 2AT1B 1NYGA 2F5KA 3QJYA 1Y71A 2E5QA 1CSKA 4CRIA 4RKUE 2HKNA 3L2VA 2O4XA 2HL3A 4QQGA 2RHZA 2HBPA 3QYGB 1D1BA 2OTJA 2L3QA 3OA6A 3M54A 2LCSA 4EMGA 3JCMe 1QVFS 4HCKA 2EQKA 4E7LA 1O9SA 1YITA 4BE0A 2CZ0B 4QQ6A 3M53A 5KYWB 4LUDA 4JUVA 3E2UA 4M78A 2CKKA 3GOXA 3CD6Q 2KVQG 1G3TA 2QA4A 1G8XA 2EAYA 4GY5A 1KC8C 4F7UF 2DZ9A 3QYHB 4L59A 3FJ5A 1N8RR 2YT6A 4DEXA 2X4XA 2CGHA 1E6GA 3EH2A 3L2QA 1QVFP 2DVEA 2BZ8A 4ATOA 1LPLA 2CP0A 2G6FX 1ZBJA 4F14A 3WVEB 4J9HA 1Y7XA 2YRDA 2DIQA 2R5MA 2RQTA 3QZ5B 4C92A 4ANJA 5HK0A 2XI9A 3H6ZA 4DBFA 1K8AR 4R0KA 5AT1B 4M75F 1NLOC 5GAOq 2Z0WA 1VQOQ 3VS7A 2A37A 2PU9B 3H0FA 4XAXB 1ACMB 2KQWA 5D6YA 1GCQA 1W1FA 5J3BA 2VV5A 2DPPB 3QUIA 1N8RU 2PVGB 1AZEA 1N27A 1PC0A 4ZN1A 3QBYA 2J06A 2X9HA 4C5EA 4LE9A 3KFVA 2M9UA 3CCRT 2V8IA 2H8HA 2K5IA 2LMJA 4J9BA 4PL6A 3CD6A 4EIKA 4C8QC 1ZUKA 2EKHA 3NFCA 2VYTA 4Y91A 4DEYA 2KT8A 3A8GB 4ZNXA 1D0ZA 1GL5A 1S72T 4M75D 4UC4A 2BZXA 2DEUA 5GAMe 4E47A 2EYQA 3L2UA 3OYDA 1Y07A 2AKKA 3R6NA 1HSQA 1PG5B 4BD3A 1NLPC 2D9TA 4LNPA 1W4SA 4C0FA 3Q1JA 2VXEA 2LQNA 4MZMA 1VQOA 4WTOB 2OI3A 3NMZC 1YJ9T 3SHWA 3QDRB 5CQXA 2LTOA 3M58A 1TUDA 1PKTA 1K4US 1M2OA 4OP0A 3QPHA 4M77A 1MNEA 4LDXA 4LDYA 4M7DF 5I2SA 2HNIA 4QVZA 3SFMA 3VS3A 4ZGJB 3TEEA 1UECA 5KYUB 1YHQT 2F2WA 1WLPB 2E10A 2OAWA 1VQKT 1RAGB 2CT3A 3NTIA 1BCOA 4MZTA 1K9MR 3QWXX 2XDBA 2P0PA 4EDUA 4QVCA 2J6OA 2KRSA 1ZSZC 1VQ7T 1RACB 1VQ6Q 2FZGB 2A36A 1BBZA 4IKFA 1IRXA 2F2VA 4BDYA 1SSHA 2XD0A 2GFAA 3I35A 1H641 1NG2A 4II1A 4M7AE 2QAZA 4M7DD 2HCKA 2CP5A 1NEGA 2EBPA 1RAAB 2QGGA 1Q7YC 5LJ3e 2DK3A 5GAMj 1K9MU 3G6EQ 3MHXA 1GRIA 2I2LA 2J6FA 1X6GA 1YCYA 1NM7A 1QLYA 2RQVA 2D0QB 4XK8E 2MWPA 2P4TA 1YJWQ 2FEIA 4M78F 1WDXA 1SEMA 3LGLA 4TVRA 1M9SA 2FO0A 4RCCA 3A8MB 1YIJQ 1YCSB 1YFNA 2RH2A 3HFOA 4PJLA 3ME9A 1AWJA 2C0IA 4PJOC 4JZ4A 3VJPA 1VQ9T 3H0HA 3EFRA 4PK4A 3BW1A 2QASA 3PTAA 1WZOA 4WF2A 4XTUA 1VQ6A 2K2VA 1RUWA 2PUKB 3CC4T 3PIOA 1OX8A 2PVOB 1I5LA 4HVUA 2DTIA 3CCUT 1D09B 4ZGEB 1Y96A 2L0AA 1VQMQ 2RK1A 4OMNA 1MV0B 1O75A 1UTIA 4RCBA 2K57A 4IURA 1VQLQ 1K73R 4DQ2A 2I0NA 4M78D 3G1JA 4VUBA 3G6EA 2DKGA 5LJ5d 2JM8A 2KK4A 3OYFA 2LC4A 4L5GA 5GAN3 2QQAA 1WI7A 3OQ5A 1YJWA 1KD1R 1AHJB 2H3EB 2JT4A 4A4GA 3EG9A 1YIJA 2SEMA 2ZPBB 3CC2T 4C8QG 2KGTA 2CP2A 4MDWA 4CC3A 3RERA 2BE9B 3OB9A 1YI2Q 4PJOE 4FT2A 1R77A 1IB8A 5EC7A 2LVMA 1K73U 3GNGA 2YUNA 3VS1A 1ZA2B 5GAN8 4L6V5 4M7AG 1AWWA 4JRIA 3LGFA 2RA2A 4BY6B 3QKJA 3JB9G 2K3BA 1E6HA 2BE7D 2DYBA 2KXCA 1H92A 1VQMA 1VQ8Q 2QQBA 1KD1U 4C0ZA 2PVDB 1X69A 3EGXA 3JCMW 1VQLA 2KMTA 2CZ1B 4OGEA 3OS2A 2KI7A 4FCYA 4M77F 3M0SA 2FL7A 4HCBA 4JLGA 1KC8U 2F5TX 4OB3B 1ZUYA 2ROLA 1RLQC 4PLLA 3PT9A 4LDWA 3VKIA 1OYXA 5I2MA 1Q81R 4IIOA 5CR2A 1B34A 2EJGA 3EGDB 1YI2A 2DTHA 3CCET 3CCVQ 2ZPFB 5ECAA 1G2BA 2RQRA 2K5LA 4CC4B 2JN0A 2K5FA 1ZQ1A 1I07A 2ABLA 1HJDA 3CCLT 1X2KA 4EMHA 3V8KA 5FWBA 4M77D 1UGRB 2RI2A 2QEXQ 2O01E 3OW2A 4LD9K 5IHKA 4EMKB 1VQ8A 1W70A 2FVUA 1D3BB 1F1BB 3CEYA 4A4FA 4X34A 2KNBB 2DVJA 4A4HA 1AT1B 3VYGA 2DERA 2RJCA 3EG1A 2MMPA 3CC7T 1BKBA 1Q81U 2QQ9A 3CPWS 5IN1A 2E3HA 2E6NA 3C4SA 3ER0A 4HT9A 1Y57A 4C92E 2M16A 4HT8A 2LP5A 1UE9A 3M4GA 4M7AB 2LQWA 1X6OA 3M9QA 1YNZA 1W6XA 3FC3A 2MK5A 2CYZB 4PJOG 2V26A 2KE9A 4ZN3A 3G4SQ 4N0AA 5GAOl 3MEVA 3V7CA 4KGXB 4BACA 5C0MA 3OYNA 2B8AA 2D0NA 1KFZA 4OB1B 5DM7R 1AEYA 1M90C 3PVLA 5KYYB 2CP7A 1W2BS 3CCVA 4FYXB 5LJ5h 3HSBA 2IPOB 4GBQA 3I9QA 1X27A 4FIBA 2XDDA 2QDLA 2OTLT 3I56Q 2QEXA 1SHGA 4NL2A 1EZZB 2A28A 4J9GA 5L23A 1M8VA 4AFZC 3M0PA 3CMET 1WXBA 1OULA 2AKLA 3OW2P 3UA6A 2DXUA 1M1FA 1WHHA 2V8JA 3CBPA 2C06A 1K1ZA 4QW2A 1QWEA 3QO3A 3EG3A 3A8LB 3EHQA 3M55A 4AMCA 4MMLA 3SWNC 1IO6A 9ATCB 1M1KC 3L2ZA 2P0KA 3G4SA 2FPEA 3CCSQ 2FRYA 2NUPB 4RG2A 2PZ1A 4M77E 4J5YA 4B6MA 5I22A 4N4HA 1S1NA 2K4YA 3OYYA 5CCAA 1VOMA 2DX1A 3FDRA 2X51A 2LRQA 1EIFA 3CCMT 5HK3A 1NJIC 1PHTA 1M30A 4P5NA 1TU0B 2JVVA 2C0TA 5KE3A 3RIRA 1I0CA 3FRNA 2E6ZA 4JDSA 2DIGA 2CREA 1I4K1 4X9CA 3MP8A 3TSZA 3JCMc 4PJOB 3CBMA 1RAEB 2CP3A 2RD1A 1Q82R 2JJ9A 2COZA 3CCJQ 4HXJA 3I56A 4JS4A 3HPWA 4XU0A 1X75C 1Q86U 1MGQA 4C92G 4HVVA 2YXYA 1K0SA 1GBQA 4PFPA 2EYYA 1QMCA 2JTMA 4KGZB 1D0XA 5CKHA 3LYIA 4KH0B 1NPPA 2DF6A 2YUPA 3CCQT 2DFUA 5EG2A 4NL3A 3D7SB 2V8KA 3M4YA 2GCXA 4E7KA 1JQQA 2A3LA 2GTOA 2BTTA 5GAMf 5D6WA 2RI5A 3OYLA 1Q82U 1AVZC 5DLQE 1C6VX 3CCSA 1U5SA 3THKA 2O31A 2DM1A 3OSVA 4RTZA 2O4XB 3HTRA 5GANj 1KHIA 3JCMb 2JMCA 4Y92A 1FXXA 1FX7A 4FM4B 2KBTA 2M0OA 1TTHB 2B86A 1U1SA 2K9GA 1FMKA 1VQPT 2HZYA 4D8KA 4BY6C 4WCIA 3RMSA 1BI0A 5CKFA 4JJDA 2LNHB 5KYWA 1D0YA 3M0UA 3CCJA 2J05A 4Z88A 1B3QA 2EW3A 3GNFB 4KRTA 3P8BB 5I11A 1QW1A 5A0DA 2DLPA 3LX7A 2QG9B 3I5RA 2L3SA 2XU8A 5FRMA 4E6RA 4KT0E 2WACA 2HQEA 3OYIA 5GAN2 2RO0A 1N5ZA 1NYFA 3LH0A 1SHFA 2FHDA 1OEBA 2EQIA 2AK5A 4BE1A 5M9OA 2DZCA 4C92B 1VIFA 1KQSA 2EYZA 1RLPC 4OMOA 2F1LA 3QWYA 3ZFJA 3IQLA 4FW2A 4B9WA 2EQUA 2LNVA 2DBMA 1JBMA 1G3YA 3VS0A 4D8DA 4OMQA 2MIOA 3A8OB 5LJ3f 2G3RA 1N9SA 2HSPA 3CCRQ 5CIUA 4R56A 3GBQA 4E7JA 1LVKA 3M0TA 1G3WA 4OGCA 1TG0A 4EMKC 5I21A 4BI8B 1M3CA 4LXCA 1Q95G 4CI0C 1S72Q 5FLXE 3PFSA 4YTLA 5CKDA 1P92A 1N9RA 4FT4A 1KQSS 2KDSA 3C94A 1TUCA 5LJ5g 3HRTA 2EJ9A 3U23A 4M7AC 2K79A 2MI6A 5FU6B 3MP1A 3CMAT 1YP5A 1WHLA 3URGA 4EPCA 1YJ9Q 2DXCA 2DNUA 2ZPGB 1VUBA 2ESWA 4AT1B 5A0LA 1RI9A 1IGQA 5HCKA 4C0DC 4M75C 3QXEB 1KQSP 1YHQQ 2C0OA 3OSSC 2DYIA 3EFOB 3PE0A 1M3AA 5AYFA 4M77B 2LX9A 3M57A 2X4JA 5DLOA 3CCRA 1X6BA 2D8HA 3QG1A 2FPFA 3JSCA 2NUTA 1V1CA 2HD0A 4C0GA 3G71T 4A4KA 2L8DA 4M4ZA 1VQ7Q 1S72A 4A4EA 2DETA 2LJ0A 1Z9QA 1QVPA 1MMDA 3TU4K 2EGCA 4JJNK 1NE8A 4A53A 1M90U 2JTFA 3FEOA 4F7UE 2GBQA 2CH4W 2LDMA 2EYWA 4HCZA 1PCXA 4IUQA 5GJWB 1QP2A 1UUEA 1WHKA 1YJ9A 5FRNA 2DD5A 4JRKA 1TS9A 2X4YA 3EHRA 2EKOA 1MV3A 3BE3A 2KR3A 2MYSA 4HCCA 3SWNB 1JJ2A 2DL4A 1JXMA 1YHQA 4X1VA 2EGEA 4OF1A 2KRNA 4M75E 1OV3A 4XU1A 3TVTA 1VQNT 1FWZA 1X01A 5KH6A 2MWOA 2F2XA 1YJNT 1VQ9Q 1OU8A 1V76A 4M7DC 2GNCA 4RTXA 4XQ3A 3MP6A 2LCCA 4KUIA 4JJBA 2E4HA 1M1KU 1IGUA 2IVWA 1VQ7A 4BDZA 3REBB 3C12A 1U06A 2HSEB 2D8JA 1U3OA 1WA7A 3RMQA 2OJ2A 1M4ZA 1IXDA 3CCUQ 2PUOB 2A0FB 1UJ0A 1ZSGA 1JJ2S 2X4WA 2RHIA 3DB4A 1RAIB 4KBMB 1IZ6A 2VC8A 3I55T 2EWNA 4AG1C 1RADB 2DXBA 3MEWA 1NZ9A 3ZL7C 2EQJA 4IUUA 5C6SA 2E64A 4FW1A 2Y90A 3EG2A 1VIEA 5LJ3j 3CC2Q 2FB7A 3H0IA 2AZVA 5IHNA 1JJ2P 2RI3A 1VQ9A 1HD3A 2KROA 4LDUA 2JNGA 3BDUA 1PD1A 3OY9A 4M78C 4M7DE 1U1TA 2CZ6B 1KC8R 2MOXA 1YBYA 4LDVA 2F69A 4FSXA 2LT1A 4F7UG 2FYKA 2BZYA 3RR6A 3CC4A 2PTKA 2LQKA 1R8OB 1T3LA 2RNAA 3CCUA 2L5QA 2M1HA 2VXFA 3L2WA 1VQ4T 3RESA 1QQJA 2RQUA 3VU3C 4AFQC 4C92C 3OBYA 3UF4A 1IHWA 1M2VB 3X20B 3EGXB 2HQHA 2JUFA 4M75G 4D6WA 1N8RC 1WGSA 1NBEB 1XQHA 2KYBA 5GAOm 1QVGA 6AT1B 2BKDN 2KYMA 3NTHA 3G7ZA 1GCQC 1H3HA 1X2QA 3M59A 2E41A 2K3YA 2AIRB 3VS5A 4C5GA 3CC2A 1AWOA 2JZ2A 1TSFA 2EFIA 2ZAEA 3JCMQ 4GLMA 1K8AC 3CCEQ 5GANf 3FJPA 3LLRA 1JB0E 3H9NA 5FROA 1OQKA 5CKBA 2RB6A 2WSFE 2HQXA 4M78E 1FMVA 3F70A 3CCLQ 5KE2A 1QP3A 1WQ7A 2O9SA 1ZA1B 2LQ8A 4N4GA 5GAMg 3MEUA 5FU6C 3E9GA 4JJCA 3REAB 4PNOA 2DRKA 2D6FA 3N5BB 3OYAA 3ZBDA 4XTZA 3L1AA 1UFFA 1RL2A 3CC7Q 4IUPA 4RTWA 4C8QA 3NTKA 3J80E 4J9IA 1KJWA 3PGGA 3DB3A 3V7RA 3DLLA 1D3BA 1OZ3A 4F04B 2DD4A 2DXTA 2QYZA 4F7UB 2DJZA 2RMOA 2WSEE 2O88A 1PRLC 2MF2A 2FRWA 5LJ5e 4M77C 2XKOC 1K0XA 1N6AA 4M7DG 5J26A 5FW9A 8ATCB 1PM3A 3VRZA 4X9DA 5GAN5 1LJOA 1KSWA 2DL3A 2E1HA 1XJWB 3OW2S 3META 4MDXA 4RUGA 3CCEA 2HMAA 3QDFA 3VS4A 2V1RA 1G3SA 2CZ7B 4C0DB 1T0JA 4M75B 2KSSA 4CC2A 2DL7A 2E70A 2JTEA 3HRUA 1TWBA 2MCNA 3GIBA 4XU3A 3VS2A 3OS1A 3JCMf 1OOTA 3CCLA 2EYXA 4RG8A 5HKCA 2OTLQ 4DA4A 4PJJA 5J39A 2P4RA 2YRCA 1UEBA 2YLCA 4J83A 2PQWA 3CMEQ 2GQVA 2P84A 1AD5A 1VYUA 3SD4A 2YWWA 4Z02A 3CC7A 1OX9A 5GMKh 1K9MC 2XICA 2P0QA 2J6KA 1D1CA 1C1AA 5DY9A 3O5ZA 1ZSZA 1BI1A 1VQ5Q 2FZKB 1ZBXA 4QKUA 3HFNA 1LCKA 1G5VA 1QCNA 2LX7A 4IIMA 1HXDA 1Q86R 3LH5A 4FYYB 4PKCC 2ROTA 1UGQB 1SF9A 1UGSB 1SG5A 3NHNA 4ZGDB 2KAFA 2XHCA 4M78G 2D1XA 2NYSA 4FL6A 1WPYA 3OS5A 2QDYB 3O8VA 3KUFA 3CCMQ 5KCOA 4OMPA 4F16A 4GLKA 4JRPA 3TREA 4JS5A 3JCMP 5GAN7 1Q7YU 2OTJT 1HYOA 5D7UA 2CSQA 3CCST 3A1PA 2L89A 4J6WA 2OTLA 1SRMA 1FYNA 3FB9A 3ZEHA 4OMMA 4M7DB 5GANh 3OYKA 3R6OA 2K6DA 1YITT 2XIDA 4ME7A 1RAFB 4KH1B 5KYXA 4PJOA 2E3IA 3CMEA 1PSFA 1OU9A 5CK9A 2CP6A 5IXFA 1WJRA 4RTTA 3CCQQ 3INZA 2HDAA 3LWHA 4LD6A 4ZTFA 1BK2A 2QA4T 1VQ5A 1I5OB 5GAMd 1VA7A 1NEBA 1GXIE 1I1JA 3QJ6A 1ZUUA 2RJEA 1QKXA 4E7IA 2LCLA 2ZPEB 2KEAA 3OYBA 1XNIA 2X35A 4J9EA 3RNJA 3WXMB 3S3OA 4BUGA 4OMFB 4KGVB 4CC7A 3MCAB 2DO3A 2QTVA 3MJXA 1KQ2A 1K73C 1UG1A 3CCMA 4JRQA 4PFZA 3MO8A 2QQRA 4FSSA 1M5Q1 1PNJA 2K2MA 3S3MA 1VQPQ 4OB0B 1WXTA 4Z89A 2BUDA 2FPDA 1R0BG 4F17A 5FU7B 1WYXA 1KD1C 4C8QF 4M78B 4Q5WA 1OPKA 2VVKA 2LJ3A 3X24B 1FMWA 3AHUA 2RJDA 1GFDA 2Y4YA 3JCMh 2EVRA 2JW4A 3EG0A 3CCQA 2YRVA 2OX7A 3CD6T 3M0QA 3L42A 4M7AF 3UWNA 1IREB 4M77G 3JB9F 3AT1B 1GFCA 2FZCB 3CBOA 3EAEA 1B7TA 2HBWA 4OMLA 1EFNA 2WSCE 2E12A 1LNXA 2A7YA 3VUBA 1QCOA 3CQTA 2M0YA 2SRCA 3RDVA 2EQMA 3A5ZB 1AOJA 5LJ3d 4QVDA 5D6XA 1KK7A 3EGUA 4BI4A 1TUGB 1ZHIA 4C8QD 1GCPA 1SKUB 1VQOT 4IUTA 4OVAA 1VQPA 2RHYA 2HL5C 2EPDA 2X3XD 2JS0A 1BYMA 3C95A 5IHIA 1V29B 4O6JA 4M7AD 2QK0A 3V8JA 1DJ7B 2CT4A 3JB9D 1UGVA 2JOYA 1Q81C 1LOJA 8AT1B 2HAXA 1I81A 3A8HB 1SPKA 5CKEA 2JM9A 1K8AU 2AHJB 4E7SA 3OBWA 1A0NB 2YHTA 3SEMA 3MPUB 3M0RA 2KT1A 5A2QE 2O2OA 2QXFA 3RKYA 3CMAQ 4FYWB 2ECZA 2RHXA 2M02A 3DLMA 4N4IA 2RJFA 4ELZC 4N0AC 3EFSA 2R58A 1QKWA 4PLIA 1PD0A 3MEAA 1QWFA 1M90R 3E1SA 2DL8A 2GF7A 1VQKQ 1AWXA 3HP9A 4HVWA 3UT1A 2Y4XA 5GAMh 1SSFA 4E7HA 2ATCB 4RMOA 5KYUA 4PJOF 3EFOA 5CQYA 1J3TA 3KXTA 3G71Q 4AG2C 2DRMA 2RPNA 3OYCA 3QIIA 4XTVA 1RI0A 2DTOA 4A63B 2RN8A 3CPFA 2NUTB 4DBQA 3KBGA 1WQWA 3RUXA 1MMAA 1WIEA 3X28B 5GMKi 2EIFA 3HKSA 3H8ZA 3PVQA 2NWMA 3CMAA 3P8HA 1I8FA 3OYHA 1X43A 2L3PA 3E19A 4C8QE 2K7AA 3P8DA 3TSWA 5GANg 3HHTB 1M1KR 1MNDA 5GAOn 1VQ6T 3TQ7P 2YDLA 1TXQA 3MKDA 4PJNA 4LN2A 3LW5E 1T0HA 4J7FA 4PJOD 5GAOr 1UHCA 1BCMA 4E7ZA 4MMKA 4HKEA 3BDLA 5GJVB 3GPLA 2KY9A 3PMIA 1VQKA 3LWIA 1NJIR 3QZ9B 3SWNA 1VQNQ 5KYNA 2XG8D 5GAN4 3G6ET 1YJNQ 1YN8A 3PIPA 1SRLA 1Q86C 2LZ6B 3G71A 2YUOA 1MMGA 3CXCA 2DBKA 5CVIA 1YJWT 3GP8A 4QQDA 5LJ3h 4ORZA 1YIJT 3CC4Q 3VYHB 4KUDK 2ZPIB 4AFSC 1UHFA 3OYMA 1ABQA 2CDTA 3BY7A 2YLBA 1WXUA 3WVDB 2QTXA 4C5IA 2QGFB 4PJMA 2DEQA 4C5HA 1NJIU 2RM4A 2ZPHB 3I55Q 3PNWC 1CKAA 1Y96B 3JAME 1Q82C 1WNLA 3QSUA 3OMGA 4C92F 1WHMA 2GFUA 4JPBW 2W10A 4XTXA 4JLIA 3JCMg 1BIAA 3JB9J 1VQMT 3CXCS 2ZZDA 1PRMC 2DAQA 3JCMJ 1VQLT 2E5KA 2IIMA 3SDZA 3DKMA 2XK0A 1VQNA 3BFMA 1YJNA 1KG1A 2CH4A 5FU7C 1BU1A 1WHJA 3EG9B 5GMKm 2HKQB 4XU2A 5LJ5f 2GQIA 5IT9E 2XDPA 4Y28E 2VASA 3QHSA 2A08A 3OYEA 1BI3A 2BIVA 2W0ZA
chains in the Genus database with same CATH topology
4RG8A 4BY6C 1BI2A 5HKCA 4MZTA 4C92D 3RMSA 4DA4A 1BI0A 5CKFA 5CAIA 2XDBA 3CCJA 2LT4A 1YI2T 5J39A 2P0PA 3GNFB 3P8BB 4EDUA 5IAYA 1UEBA 1QW1A 5A0DA 4QVCA 2YLCA 3LX7A 4J83A 2PQWA 1JRIA 3ASKA 2GQVA 4KULA 4BI3A 1VQ7T 2XU8A 5FRMA 2MAMA 3SD4A 4Z02A 3I55A 3CC7A 4KT0E 5GMKh 1K9MC 2XICA 2WACA 2HQEA 3OYIA 2P0QA 4IKFA 5DY9A 1XTDA 5GAN2 4ELYC 2RO0A 1BI1A 4BDYA 4BB7A 3HL8A 2XD0A 2GFAA 1H641 1ZBXA 4II1A 3LH0A 4M7AE 3HFNA 1VQ8T 1G5VA 4M7DD 2FHDA 3X26B 3M5AA 1HXDA 4A54A 3JB9I 3UPUA 1HK9A 4BE1A 3RKWA 5M9OA 4PKCC 5GANd 2RK2A 2DZCA 5LL6S 4C92B 1Q7YC 1VIFA 3VUZA 1UGQB 5LJ3e 2DK3A 1UGSB 5GAMj 1KQSA 1K9MU 3MHXA 4ZGDB 3OYGA 2I2LA 3ZFJA 2KAFA 1BIBA 2XHCA 3J7AF 4M78G 3VV0A 4B9WA 4FL6A 1WPYA 2EQUA 1YCYA 3OS5A 4OB2B 3JRZA 2LNVA 2QDYB 2D0QB 1JBMA 3KUFA 1G3YA 3O8VA 5KCOA 4XK8E 2VGNA 2MWPA 2P4TA 4GLKA 4JRPA 4M78F 3A8OB 5LJ3f 3LGLA 3TREA 4TVRA 1M9SA 4JS5A 2G3RA 1B34B 4RCCA 3A8MB 3JCMP 1N9SA 5GAN7 3SB2A 3TCJA 1Q7YU 5GMKl 2OTJT 1XOVA 2RH2A 3HFOA 3ME9A 3CPWA 5CIUA 3UDCA 3CCST 4PJOC 4R56A 2L89A 1OZ2A 4E7JA 4DOVA 4J6WA 1G3WA 4OGCA 2OTLA 3VJPA 3FB9A 3ZEHA 1VQ9T 4EMKC 2EJFA 4M7DB 5GANh 5I21A 1PSEA 4BI8B 3EFRA 5KCHA 3BW1A 3OYKA 3JCMX 3R6OA 1YITT 1QVGS 2XIDA 4ME7A 3CCVT 4PJOA 3PTAA 4CI0C 1VQ4A 5FLXE 3PFSA 4XTYA 3CMEA 2QQSA 1PSFA 4YTLA 4WF2A 4EMKA 5CK9A 5CKDA 5L8RE 1P92A 1N9RA 4FT4A 4XTUA 1VQ6A 2K2VA 1KQSS 2KDSA 1WJRA 2PUKB 3C94A 3JCMV 3CC4T 5LJ5g 3HRTA 1UGPB 2EJ9A 2PVOB 2QI2A 3INZA 3PIOA 1I5LA 2DTIA 3LWHA 3CCUT 4LD6A 4ZTFA 4ZGEB 4M7AC 2QA4T 1VQ5A 5CO7A 2MI6A 2QEXT 1Y96A 5GAMd 5FU6B 1NPRA 2RK1A 3S6WA 4C8QB 1O75A 1GXIE 3QJ6A 1W2BA 3M56A 3MP1A 3CMAT 2RJEA 4RCBA 2K57A 4IURA 4E7IA 4M7AA 2LCLA 2ZPEB 4DQ2A 4M78D 4F7UA 3URGA 1TH7A 4BE2A 4EPCA 3OYBA 2DXCA 1KQ1A 4VUBA 2ZPGB 3G6EA 1XNIA 2DKGA 2X35A 5LJ5d 1VUBA 3WXMB 3S3OA 4BUGA 2KK4A 1KHCA 4OMFB 3OYFA 2LC4A 3MCAB 2DO3A 4L5GA 5A0LA 2QQAA 5GAN3 4B9XA 4DOWA 4ZTJA 3JCMd 1KQ2A 1K73C 4C0DC 4M75C 3QXEB 3CCMA 4JRQA 3MO8A 3OQ5A 1YJWA 2QQRA 3OSSC 1M5Q1 1AHJB 2K3XA 5AYFA 4A4GA 3G4ST 4M77B 1UB4A 3S3MA 1YIJA 2LX9A 2ZPBB 3M57A 4OB0B 3CC2T 4C8QG 2X4JA 4M75A 5DLOA 3CCRA 2BUDA 4MDWA 5GMKe 3RERA 3X25B 3QG1A 3OB9A 3FLGA 4PJOE 3OS0A 2RHUA 4FT2A 5FU7B 4IUVA 1KD1C 3JSCA 4C8QF 4J6YA 3G71T 2HD0A 2LVMA 4C0GA 1K73U 3GNGA 4A4KA 4M78B 4NOYA 2L8DA 4Q5WA 1U8RA 3T9NA 1S72A 4A4EA 5GAN8 3X24B 3GLXA 3AHUA 2RJDA 4L6V5 4M7AG 2Y4YA 3L2RA 4JRIA 4FU6A 3JCMh 3LGFA 1QVPA 2RA2A 4BY6B 3QKJA 4NS5A 5GAOp 3CCQA 3TU4K 3JB9G 5LJ3g 2R57A 2YRVA 3CD6T 2NLUA 3I56T 3L42A 4JJNK 4M7AF 3UWNA 1NE8A 3S3NA 1VQMA 1IREB 2E65A 2QQBA 4A53A 1KD1U 1M90U 2ZCFB 4C0ZA 4M77G 2PVDB 2JTFA 3FEOA 3JB9F 4F7UE 3JCMW 2LDMA 4HCZA 1VQLA 3CBOA 2KMTA 3EAEA 4IUQA 2CZ1B 1QP2A 2CS7A 4OGEA 3OS2A 1YJ9A 2WSCE 2E12A 1LNXA 2A7YA 4M77F 5FRNA 3VUBA 2DD5A 2FL7A 4JRKA 3E9FA 3JB9H 2EQMA 2X4YA 3A5ZB 3OYJA 5LJ3d 1VQ5T 4QVDA 2EKOA 4HCBA 4J8OA 4JLGA 1KC8U 5GAN6 4HCCA 5D6XA 3SWNB 2F5TX 4OB3B 5GANe 4BI4A 1JJ2A 1ZHIA 4C8QD 1YHQA 4MZPA 2VUBA 4OF1A 5LJ5j 4M75E 4R55A 1VQOT 4PLLA 4IUTA 3PT9A 2H3JA 4LDWA 1OYXA 4OVAA 2RHYA 3GF5A 4XU1A 3VKIA 1VQPA 1VQNT 1FWZA 1X01A 3OMCA 3RKXA 5KH6A 2MWOA 5I2MA 1YJNT 1BYMA 2OAUA 3V7SA 1H3ZA 5CR2A 1B34A 3C95A 2EJGA 4M7DC 1YI2A 2DTHA 3CCET 1V29B 1WJSA 4O6JA 4XQ3A 2ZPFB 4M7AD 3V8JA 3MP6A 2LCCA 4KUIA 4HA8A 1M1KU 1DJ7B 2K5LA 2IVWA 1VQ7A 4BDZA 3C12A 3PMTA 3JB9D 2JN0A 2K5FA 1ZQ1A 4M7DA 5A0GA 2JOYA 1Q81C 2IG0A 1M1GA 1LOJA 4J7IA 2HAXA 5GMKj 3CCLT 3RMQA 4EMHA 1M4ZA 1I81A 3A8HB 3V8KA 4M77D 1UGRB 2RI2A 5CKEA 1QVFA 2O01E 2PUOB 4J6XA 1K8AU 3OW2A 4V2SA 2AHJB 4LD9K 3CCJT 2VGMA 3OBWA 4EMKB 2YHTA 3J81E 5A2QE 1VQ8A 1OI1A 2QXFA 3RKYA 1JJ2S 2X4WA 2FVUA 3CEYA 1D3BB 1MHNA 2RHIA 4O5VA 4X34A 1WJQA 4A4HA 4A4FA 2R5AA 3V8LA 2ZGWA 3DB4A 3VYGA 2RJCA 4KBMB 1IZ6A 2L3RA 3FIFA 5HY6A 2MMPA 2VC8A 3I55T 3CC7T 2EWNA 1BKBA 1Q81U 2DXBA 2QQ9A 4XTWA 3CPWS 2RHXA 5IN1A 3DLMA 2E6NA 3C4SA 3ER0A 3HRSA 4HT9A 4C92E 2M16A 3MEWA 1NZ9A 4N4IA 4HT8A 2RJFA 3M4GA 2F5KA 4M7AB 2EQJA 4ELZC 4IUUA 4N0AC 5C6SA 2E64A 3EFSA 2R58A 1X6OA 3QJYA 4PLIA 1Y71A 2E5QA 3M9QA 2Y90A 3MEAA 3FC3A 4CRIA 2CYZB 4PJOG 4RKUE 3E1SA 2GF7A 3L2VA 4ZN3A 2O4XA 4QQGA 2RHZA 4N0AA 3HP9A 2HBPA 1VIEA 3UT1A 2Y4XA 3QYGB 5LJ3j 5GAMh 1SSFA 5GAOl 4E7HA 2FB7A 2OTJA 3MEVA 3V7CA 3OA6A 3M54A 4EMGA 4RMOA 3JCMe 1QVFS 4PJOF 4BACA 5CQYA 5C0MA 3OYNA 2RI3A 2EQKA 2B8AA 1VQ9A 3KXTA 4OB1B 5DM7R 4E7LA 4LDUA 2JNGA 3BDUA 1M90C 1O9SA 1YITA 3OY9A 4BE0A 1W2BS 3CCVA 2CZ0B 4M78C 4QQ6A 4M7DE 1U1TA 2CZ6B 3M53A 3OYCA 5LJ5h 3HSBA 3QIIA 4XTVA 1RI0A 1YBYA 4LDVA 2DTOA 2F69A 4FSXA 2LT1A 4FIBA 4JUVA 3CPFA 4F7UG 2FYKA 3CC4A 4M78A 2XDDA 3KBGA 2CKKA 2LQKA 1R8OB 1WQWA 3GOXA 3CCUA 3RUXA 2KVQG 1G3TA 2QA4A 2OTLT 2QEXA 2EAYA 2L5QA 2M1HA 4GY5A 1KC8C 4NL2A 3X28B 5GMKi 2VXFA 2EIFA 4F7UF 2DZ9A 3HKSA 3QYHB 4L59A 3H8ZA 3CMAA 3P8HA 1I8FA 3OYHA 3L2WA 1VQ4T 1M8VA 4C8QE 3E19A 3CMET 3P8DA 3RESA 5GANg 2X4XA 3HHTB 2CGHA 3L2QA 3VU3C 2DVEA 4C92C 4ATOA 3OBYA 5GAOn 2DXUA 1VQ6T 1M1FA 3X20B 2V8JA 3CBPA 2C06A 3WVEB 2JUFA 4M75G 4QW2A 4PJOD 1Y7XA 3LW5E 4D6WA 4J7FA 1WGSA 3QO3A 1N8RC 3A8LB 1XQHA 2DIQA 2R5MA 3M55A 3QZ5B 4C92A 5GAOr 5HK0A 2XI9A 4MMLA 3SWNC 3H6ZA 5GAOm 1QVGA 2BKDN 4MMKA 1M1KC 4HKEA 4M75F 3NTHA 5GAOq 3BDLA 3G7ZA 3L2ZA 3M59A 2P0KA 2E41A 2KY9A 3PMIA 3GPLA 2K3YA 3LWIA 3G4SA 1VQKA 3QZ9B 4C5GA 3SWNA 2PU9B 3CC2A 2JZ2A 4XAXB 2XG8D 5GAN4 2EFIA 3G6ET 4RG2A 4M77E 2KQWA 4J5YA 5D6YA 3JCMQ 1K8AC 5J3BA 2VV5A 4N4HA 2DPPB 2K4YA 3OYYA 3QUIA 5CCAA 5GANf 3PIPA 1N8RU 3FJPA 2PVGB 3LLRA 1N27A 1JB0E 1Q86C 4ZN1A 3QBYA 3FDRA 3G71A 3CXCA 2LRQA 1EIFA 5FROA 5HK3A 3CCMT 1NJIC 5CKBA 4C5EA 5CVIA 1YJWT 3GP8A 2RB6A 2WSFE 4P5NA 2HQXA 2JVVA 4QQDA 5LJ3h 5KE3A 4M78E 2M9UA 3RIRA 3CCLA 3FRNA 3F70A 2E6ZA 1YIJT 4JDSA 2DIGA 3VYHB 1I4K1 5KE2A 4KUDK 2ZPIB 4X9CA 3MP8A 3CCRT 3JCMc 1QP3A 2V8IA 1WQ7A 2K5IA 3CBMA 3OYMA 2RD1A 4PJOB 4PL6A 3CD6A 2LQ8A 4N4GA 5GAMg 3BY7A 3MEUA 2YLBA 3I56A 5FU6C 3E9GA 3HPWA 4XU0A 4C8QC 3WVDB 4JS4A 2QTXA 4C5IA 1X75C 3NFCA 1Q86U 1MGQA 4PNOA 2VYTA 4Y91A 4C92G 2DEQA 3A8GB 2D6FA 3N5BB 4C5HA 1NJIU 3OYAA 1S72T 3ZBDA 4XTZA 2RM4A 3L1AA 2ZPHB 1RL2A 2JTMA 4IUPA 3PNWC 4M75D 4UC4A 4C8QA 1Y96B 3JAME 1Q82C 1WNLA 3NTKA 3J80E 3QSUA 3OMGA 3PGGA 4C92F 3DB3A 5CKHA 3V7RA 1D3BA 1OZ3A 3DLLA 5GAMe 3LYIA 4E47A 1NPPA 2EYQA 3L2UA 3OYDA 3CCQT 5EG2A 4NL3A 2GFUA 2DD4A 1Y07A 2V8KA 2DXTA 3M4YA 4XTXA 2GCXA 4JLIA 3JCMg 4F7UB 4BD3A 1BIAA 2D9TA 3JB9J 4E7KA 1VQMT 1W4SA 2DJZA 2WSEE 3CXCS 4C0FA 2A3LA 2ZZDA 2MF2A 2DAQA 3Q1JA 3JCMJ 2VXEA 1VQLT 5GAMf 5LJ5e 4MZMA 2RI5A 4M77C 5D6WA 1VQOA 3OYLA 1Q82U 2XKOC 5DLQE 1N6AA 3SDZA 5J26A 1YJ9T 4M7DG 3DKMA 2XK0A 1VQNA 3CCSA 3QDRB 5CQXA 2LTOA 3M58A 4X9DA 3BFMA 1LJOA 5GAN5 1YJNA 2E1HA 1KG1A 3OW2S 3META 4MDXA 3OSVA 4OP0A 2O4XB 3QPHA 5FU7C 3CCEA 4M77A 4LDXA 4LDYA 4M7DF 5I2SA 5GMKm 5GANj 1G3SA 1KHIA 2CZ7B 2HNIA 4C0DB 3JCMb 4M75B 2KSSA 1FXXA 4QVZA 4XU2A 3SFMA 5LJ5f 5IT9E 2E70A 2XDPA 3HRUA 3TEEA 1FX7A 4ZGJB 1YHQT 4Y28E 2E10A 4FM4B 3QHSA 4XU3A 3GIBA 1VQKT 3OYEA 2M0OA 3OS1A 1BI3A 3JCMf 3NTIA 2BIVA 1U1SA 1VQPT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QO3 A;  4M78 D;  4DQ2 A;  4F7U A;  1TH7 A;  4C92 A;  4HA8 A;  4C92 D;  5GAO r;  4PJO D;  4MML A;  3SWN C;  5GAO m;  5CAI A;  3JB9 D;  2JN0 A;  4MMK A;  1KQ1 A;  4M7D A;  2DKG A;  4M75 F;  5LJ5 d;  5GAO q;  1LOJ A;  3L2Z A;  5GMK j;  4QVC A;  2YLC A;  2E41 A;  4EMH A;  1I81 A;  5GAN 3;  4PJO B;  1JRI A;  3V8K A;  4M77 D;  3SWN A;  3JCM d;  1KQ2 A;  4J6X A;  4V2S A;  4M75 C;  5GAN 4;  4EMK B;  2YHT A;  4M77 E;  5GMK h;  4J5Y A;  3JCM Q;  3RKY A;  1M5Q 1;  3QUI A;  1D3B B;  5GAN f;  3FJP A;  5DY9 A;  5GAN 2;  3V8L A;  4M77 B;  2ZGW A;  4C8Q G;  4M75 A;  3FIF A;  5GMK e;  2VC8 A;  1H64 1;  3RER A;  2EWN A;  4XTW A;  2RB6 A;  4M7A E;  3HFN A;  5LJ3 h;  4M78 E;  4M7D D;  3RIR A;  4HT9 A;  4PJO E;  4C92 E;  1HXD A;  4HT8 A;  4A54 A;  3M4G A;  4C8Q F;  1HK9 A;  3JB9 I;  4J6Y A;  4M7A B;  1I4K 1;  4X9C A;  3RKW A;  4M78 B;  1WQ7 A;  4N0A C;  4NOY A;  2DZC A;  2E64 A;  3EFS A;  2RD1 A;  3JCM c;  4C92 B;  5GAN d;  5GAN 8;  5LJ3 e;  5GAM j;  5GAM g;  3BY7 A;  3AHU A;  2Y90 A;  2YLB A;  4XU0 A;  4C8Q C;  2I2L A;  4M7A G;  2QTX A;  1BIB A;  4JRI A;  4M78 G;  1MGQ A;  4PNO A;  4PJO G;  3JCM h;  4Y91 A;  4C92 G;  2RA2 A;  1WPY A;  2DEQ A;  1YCY A;  4N0A A;  5GAO p;  3JB9 G;  5GAM h;  5LJ3 j;  5LJ3 g;  5GAO l;  1JBM A;  2FB7 A;  4XTZ A;  2RM4 A;  3L1A A;  3V7C A;  4M75 D;  4M7A F;  4C8Q A;  1Y96 B;  4EMG A;  1WNL A;  3JCM e;  4M78 F;  4PJO F;  3QSU A;  2E65 A;  4A53 A;  3PGG A;  4C92 F;  3V7R A;  5LJ3 f;  1D3B A;  4M77 G;  5GAM e;  1B34 B;  3JB9 F;  4RCC A;  4F7U E;  3JCM P;  1N9S A;  5GAN 7;  3JCM W;  3SB2 A;  3BDU A;  4NL3 A;  5GMK l;  3HFO A;  2DXT A;  4M78 C;  4PJO C;  4XTX A;  4M7D E;  4JLI A;  1U1T A;  3JCM g;  4F7U B;  1BIA A;  4J6W A;  3JB9 J;  5LJ5 h;  3HSB A;  2DJZ A;  1LNX A;  4M77 F;  4XTV A;  3FB9 A;  2DTO A;  4EMK C;  4JRK A;  2EJF A;  4M7D B;  5GAN h;  5I21 A;  3JB9 H;  4JUV A;  3EFR A;  3BW1 A;  3JCM X;  3JCM J;  4F7U G;  2FYK A;  2VXE A;  5LJ3 d;  4M78 A;  4QVD A;  4PJO A;  5GAM f;  5LJ5 e;  4M77 C;  1WQW A;  4XTY A;  3RUX A;  5GAN 6;  4M7D G;  3SWN B;  5GAN e;  2EAY A;  4WF2 A;  4EMK A;  1N9R A;  4NL2 A;  3BFM A;  1LJO A;  2VXF A;  4X9D A;  4XTU A;  4C8Q D;  2E1H A;  2DZ9 A;  4F7U F;  5GMK i;  3JCM V;  5LJ5 j;  5LJ5 g;  4M75 E;  1I8F A;  2EJ9 A;  3INZ A;  4OP0 A;  1I5L A;  4M77 A;  4C8Q E;  4M7A D;  2DTI A;  1M8V A;  4M7D F;  4XU1 A;  5GMK m;  3RES A;  5GAN g;  5GAN j;  4M7A C;  2CGH A;  2HNI A;  3JCM b;  5GAN 5;  3VU3 C;  1Y96 A;  2DVE A;  1X01 A;  4M75 B;  3RKX A;  4XU2 A;  4C92 C;  5GAM d;  4C8Q B;  5LJ5 f;  5GAO n;  2DXU A;  3V7S A;  1B34 A;  2E10 A;  2EJG A;  3QHS A;  4XU3 A;  2DTH A;  3GIB A;  4M7D C;  3JCM f;  4RCB A;  2K57 A;  4M75 G;  4XQ3 A;  4M7A A;  1U1S A;  3V8J A; 
#chains in the Genus database with same CATH topology
 4RTU A;  1BI2 A;  1VYV A;  4C92 D;  3CXC P;  1C0M A;  5CAI A;  2JMA A;  2LT4 A;  2MPX C;  2ED0 A;  1YI2 T;  2YUQ A;  5IAY A;  1VQ4 Q;  2DJQ A;  1M27 C;  2CUD A;  1JRI A;  3ASK A;  1OPL A;  1UJY A;  1M8M A;  4KUL A;  4BI3 A;  2MAM A;  2CUB A;  3I55 A;  1JEG A;  3EH1 A;  1XTD A;  4ELY C;  4BB7 A;  3HL8 A;  1M2V A;  1VQ8 T;  3X26 B;  3M5A A;  2AZS A;  1MUZ A;  7AT1 B;  4A54 A;  3JB9 I;  3UPU A;  1HK9 A;  3RKW A;  5GAN d;  1KIK A;  2RK2 A;  5LL6 S;  1WX6 A;  1RAB B;  3VUZ A;  2PNI A;  2ENM A;  3OYG A;  1BIB A;  2DMO A;  1ABO A;  2M51 A;  3J7A F;  3VV0 A;  4JZ3 A;  4OB2 B;  3JRZ A;  2DL5 A;  1YWP A;  2VGN A;  2VKN A;  2YSQ A;  1ZLM A;  2LJ1 A;  3EGD A;  4J9C A;  1B34 B;  4ESR A;  2X3W D;  2EGA A;  5FWC A;  1WFW A;  3SB2 A;  3TCJ A;  5GMK l;  1XOV A;  3CPW A;  1E7O A;  2JS2 A;  3UDC A;  1OZ2 A;  4DOV A;  2FG0 A;  2EJF A;  3NPF A;  1PSE A;  5KCH A;  3JCM X;  1QCF A;  1QVG S;  3CCV T;  1VQ4 A;  4RTV A;  4XTY A;  1MMN A;  2QQS A;  1H8K A;  1ZX6 A;  4EMK A;  5L8R E;  3I5S A;  3JCM V;  3A98 A;  1UGP B;  2QI2 A;  1B07 A;  2KRM A;  5CO7 A;  2QEX T;  1NPR A;  4C8Q B;  3S6W A;  2DE0 X;  2GGR A;  1W2B A;  3M56 A;  3ULR B;  4M7A A;  2HEQ A;  4F7U A;  4BE2 A;  2COY A;  1TH7 A;  1T3S A;  1KQ1 A;  1QVG P;  4LUE A;  2VWF A;  1KHC A;  4ZTJ A;  2DIL A;  4B9X A;  4DOW A;  2CSI A;  3JCM d;  2KXD A;  1G83 A;  4AFU C;  2RF0 A;  3C0C A;  1ARK A;  2K3X A;  3G4S T;  1UB4 A;  5KYY A;  4DBH A;  4M75 A;  5GMK e;  3NGP A;  3X25 B;  4PFO A;  1M3B A;  1UDL A;  3FLG A;  5IH2 A;  2RHU A;  3OS0 A;  1CKB A;  1PWT A;  2COW A;  4IUV A;  4J6Y A;  3CPW P;  4NOY A;  1U8R A;  3T9N A;  2L2P A;  3RBB B;  1JO8 A;  3GLX A;  4E2F B;  1K76 A;  3UA7 A;  1JXO A;  3L2R A;  1TOV A;  2JXB A;  4FU6 A;  1PKS A;  5GAO p;  4NS5 A;  1Q7Y R;  5LJ3 g;  2R57 A;  2NLU A;  2RQW A;  4Z8A A;  3I56 T;  3S3N A;  1VYT A;  2E65 A;  2ZCF B;  2ED1 A;  1D1A A;  2NUZ A;  1ZSZ B;  1AZG B;  2CS7 A;  3H41 A;  2O9V A;  3E9F A;  1W2B P;  3JB9 H;  1Z9Z A;  3JV3 A;  3OYJ A;  1VQ5 T;  4J8O A;  5GAN 6;  4J9F A;  4FYV B;  5GAN e;  4DBR A;  2NUP A;  4J9D A;  1YWO A;  4MZP A;  2GTJ A;  1K9A A;  1EX4 A;  2VUB A;  5LJ5 j;  2J7I A;  4R55 A;  2OTJ Q;  2H3J A;  3GF5 A;  1JU5 C;  3OMC A;  3RKX A;  2OAU A;  3V7S A;  1H3Z A;  3VRY A;  5IXB A;  3VS6 A;  1YIT Q;  1R0C B;  1IHV A;  1WJS A;  2V1Q A;  4HA8 A;  3PMT A;  3UAT A;  4M7D A;  5A0G A;  2IG0 A;  1M1G A;  4J7I A;  5GMK j;  5KYX B;  1RAH B;  2QA4 Q;  2XMF A;  1QVF A;  1GBR A;  4J6X A;  4QT7 A;  4V2S A;  3CCJ T;  2VGM A;  3J81 E;  1Y0M A;  1OI1 A;  4O5V A;  1MHN A;  1WJQ A;  4RTY A;  2R5A A;  2DA9 A;  3V8L A;  2ZGW A;  1WHG A;  1BB9 A;  2L3R A;  3FIF A;  5HY6 A;  4XTW A;  3HRS A;  2VB6 A;  4K11 A;  2AT1 B;  1NYG A;  2F5K A;  3QJY A;  1Y71 A;  2E5Q A;  1CSK A;  4CRI A;  4RKU E;  2HKN A;  3L2V A;  2O4X A;  2HL3 A;  4QQG A;  2RHZ A;  2HBP A;  3QYG B;  1D1B A;  2OTJ A;  2L3Q A;  3OA6 A;  3M54 A;  2LCS A;  4EMG A;  3JCM e;  1QVF S;  4HCK A;  2EQK A;  4E7L A;  1O9S A;  1YIT A;  4BE0 A;  2CZ0 B;  4QQ6 A;  3M53 A;  5KYW B;  4LUD A;  4JUV A;  3E2U A;  4M78 A;  2CKK A;  3GOX A;  3CD6 Q;  2KVQ G;  1G3T A;  2QA4 A;  1G8X A;  2EAY A;  4GY5 A;  1KC8 C;  4F7U F;  2DZ9 A;  3QYH B;  4L59 A;  3FJ5 A;  1N8R R;  2YT6 A;  4DEX A;  2X4X A;  2CGH A;  1E6G A;  3EH2 A;  3L2Q A;  1QVF P;  2DVE A;  2BZ8 A;  4ATO A;  1LPL A;  2CP0 A;  2G6F X;  1ZBJ A;  4F14 A;  3WVE B;  4J9H A;  1Y7X A;  2YRD A;  2DIQ A;  2R5M A;  2RQT A;  3QZ5 B;  4C92 A;  4ANJ A;  5HK0 A;  2XI9 A;  3H6Z A;  4DBF A;  1K8A R;  4R0K A;  5AT1 B;  4M75 F;  1NLO C;  5GAO q;  2Z0W A;  1VQO Q;  3VS7 A;  2A37 A;  2PU9 B;  3H0F A;  4XAX B;  1ACM B;  2KQW A;  5D6Y A;  1GCQ A;  1W1F A;  5J3B A;  2VV5 A;  2DPP B;  3QUI A;  1N8R U;  2PVG B;  1AZE A;  1N27 A;  1PC0 A;  4ZN1 A;  3QBY A;  2J06 A;  2X9H A;  4C5E A;  4LE9 A;  3KFV A;  2M9U A;  3CCR T;  2V8I A;  2H8H A;  2K5I A;  2LMJ A;  4J9B A;  4PL6 A;  3CD6 A;  4EIK A;  4C8Q C;  1ZUK A;  2EKH A;  3NFC A;  2VYT A;  4Y91 A;  4DEY A;  2KT8 A;  3A8G B;  4ZNX A;  1D0Z A;  1GL5 A;  1S72 T;  4M75 D;  4UC4 A;  2BZX A;  2DEU A;  5GAM e;  4E47 A;  2EYQ A;  3L2U A;  3OYD A;  1Y07 A;  2AKK A;  3R6N A;  1HSQ A;  1PG5 B;  4BD3 A;  1NLP C;  2D9T A;  4LNP A;  1W4S A;  4C0F A;  3Q1J A;  2VXE A;  2LQN A;  4MZM A;  1VQO A;  4WTO B;  2OI3 A;  3NMZ C;  1YJ9 T;  3SHW A;  3QDR B;  5CQX A;  2LTO A;  3M58 A;  1TUD A;  1PKT A;  1K4U S;  1M2O A;  4OP0 A;  3QPH A;  4M77 A;  1MNE A;  4LDX A;  4LDY A;  4M7D F;  5I2S A;  2HNI A;  4QVZ A;  3SFM A;  3VS3 A;  4ZGJ B;  3TEE A;  1UEC A;  5KYU B;  1YHQ T;  2F2W A;  1WLP B;  2E10 A;  2OAW A;  1VQK T;  1RAG B;  2CT3 A;  3NTI A;  1BCO A;  4MZT A;  1K9M R;  3QWX X;  2XDB A;  2P0P A;  4EDU A;  4QVC A;  2J6O A;  2KRS A;  1ZSZ C;  1VQ7 T;  1RAC B;  1VQ6 Q;  2FZG B;  2A36 A;  1BBZ A;  4IKF A;  1IRX A;  2F2V A;  4BDY A;  1SSH A;  2XD0 A;  2GFA A;  3I35 A;  1H64 1;  1NG2 A;  4II1 A;  4M7A E;  2QAZ A;  4M7D D;  2HCK A;  2CP5 A;  1NEG A;  2EBP A;  1RAA B;  2QGG A;  1Q7Y C;  5LJ3 e;  2DK3 A;  5GAM j;  1K9M U;  3G6E Q;  3MHX A;  1GRI A;  2I2L A;  2J6F A;  1X6G A;  1YCY A;  1NM7 A;  1QLY A;  2RQV A;  2D0Q B;  4XK8 E;  2MWP A;  2P4T A;  1YJW Q;  2FEI A;  4M78 F;  1WDX A;  1SEM A;  3LGL A;  4TVR A;  1M9S A;  2FO0 A;  4RCC A;  3A8M B;  1YIJ Q;  1YCS B;  1YFN A;  2RH2 A;  3HFO A;  4PJL A;  3ME9 A;  1AWJ A;  2C0I A;  4PJO C;  4JZ4 A;  3VJP A;  1VQ9 T;  3H0H A;  3EFR A;  4PK4 A;  3BW1 A;  2QAS A;  3PTA A;  1WZO A;  4WF2 A;  4XTU A;  1VQ6 A;  2K2V A;  1RUW A;  2PUK B;  3CC4 T;  3PIO A;  1OX8 A;  2PVO B;  1I5L A;  4HVU A;  2DTI A;  3CCU T;  1D09 B;  4ZGE B;  1Y96 A;  2L0A A;  1VQM Q;  2RK1 A;  4OMN A;  1MV0 B;  1O75 A;  1UTI A;  4RCB A;  2K57 A;  4IUR A;  1VQL Q;  1K73 R;  4DQ2 A;  2I0N A;  4M78 D;  3G1J A;  4VUB A;  3G6E A;  2DKG A;  5LJ5 d;  2JM8 A;  2KK4 A;  3OYF A;  2LC4 A;  4L5G A;  5GAN 3;  2QQA A;  1WI7 A;  3OQ5 A;  1YJW A;  1KD1 R;  1AHJ B;  2H3E B;  2JT4 A;  4A4G A;  3EG9 A;  1YIJ A;  2SEM A;  2ZPB B;  3CC2 T;  4C8Q G;  2KGT A;  2CP2 A;  4MDW A;  4CC3 A;  3RER A;  2BE9 B;  3OB9 A;  1YI2 Q;  4PJO E;  4FT2 A;  1R77 A;  1IB8 A;  5EC7 A;  2LVM A;  1K73 U;  3GNG A;  2YUN A;  3VS1 A;  1ZA2 B;  5GAN 8;  4L6V 5;  4M7A G;  1AWW A;  4JRI A;  3LGF A;  2RA2 A;  4BY6 B;  3QKJ A;  3JB9 G;  2K3B A;  1E6H A;  2BE7 D;  2DYB A;  2KXC A;  1H92 A;  1VQM A;  1VQ8 Q;  2QQB A;  1KD1 U;  4C0Z A;  2PVD B;  1X69 A;  3EGX A;  3JCM W;  1VQL A;  2KMT A;  2CZ1 B;  4OGE A;  3OS2 A;  2KI7 A;  4FCY A;  4M77 F;  3M0S A;  2FL7 A;  4HCB A;  4JLG A;  1KC8 U;  2F5T X;  4OB3 B;  1ZUY A;  2ROL A;  1RLQ C;  4PLL A;  3PT9 A;  4LDW A;  3VKI A;  1OYX A;  5I2M A;  1Q81 R;  4IIO A;  5CR2 A;  1B34 A;  2EJG A;  3EGD B;  1YI2 A;  2DTH A;  3CCE T;  3CCV Q;  2ZPF B;  5ECA A;  1G2B A;  2RQR A;  2K5L A;  4CC4 B;  2JN0 A;  2K5F A;  1ZQ1 A;  1I07 A;  2ABL A;  1HJD A;  3CCL T;  1X2K A;  4EMH A;  3V8K A;  5FWB A;  4M77 D;  1UGR B;  2RI2 A;  2QEX Q;  2O01 E;  3OW2 A;  4LD9 K;  5IHK A;  4EMK B;  1VQ8 A;  1W70 A;  2FVU A;  1D3B B;  1F1B B;  3CEY A;  4A4F A;  4X34 A;  2KNB B;  2DVJ A;  4A4H A;  1AT1 B;  3VYG A;  2DER A;  2RJC A;  3EG1 A;  2MMP A;  3CC7 T;  1BKB A;  1Q81 U;  2QQ9 A;  3CPW S;  5IN1 A;  2E3H A;  2E6N A;  3C4S A;  3ER0 A;  4HT9 A;  1Y57 A;  4C92 E;  2M16 A;  4HT8 A;  2LP5 A;  1UE9 A;  3M4G A;  4M7A B;  2LQW A;  1X6O A;  3M9Q A;  1YNZ A;  1W6X A;  3FC3 A;  2MK5 A;  2CYZ B;  4PJO G;  2V26 A;  2KE9 A;  4ZN3 A;  3G4S Q;  4N0A A;  5GAO l;  3MEV A;  3V7C A;  4KGX B;  4BAC A;  5C0M A;  3OYN A;  2B8A A;  2D0N A;  1KFZ A;  4OB1 B;  5DM7 R;  1AEY A;  1M90 C;  3PVL A;  5KYY B;  2CP7 A;  1W2B S;  3CCV A;  4FYX B;  5LJ5 h;  3HSB A;  2IPO B;  4GBQ A;  3I9Q A;  1X27 A;  4FIB A;  2XDD A;  2QDL A;  2OTL T;  3I56 Q;  2QEX A;  1SHG A;  4NL2 A;  1EZZ B;  2A28 A;  4J9G A;  5L23 A;  1M8V A;  4AFZ C;  3M0P A;  3CME T;  1WXB A;  1OUL A;  2AKL A;  3OW2 P;  3UA6 A;  2DXU A;  1M1F A;  1WHH A;  2V8J A;  3CBP A;  2C06 A;  1K1Z A;  4QW2 A;  1QWE A;  3QO3 A;  3EG3 A;  3A8L B;  3EHQ A;  3M55 A;  4AMC A;  4MML A;  3SWN C;  1IO6 A;  9ATC B;  1M1K C;  3L2Z A;  2P0K A;  3G4S A;  2FPE A;  3CCS Q;  2FRY A;  2NUP B;  4RG2 A;  2PZ1 A;  4M77 E;  4J5Y A;  4B6M A;  5I22 A;  4N4H A;  1S1N A;  2K4Y A;  3OYY A;  5CCA A;  1VOM A;  2DX1 A;  3FDR A;  2X51 A;  2LRQ A;  1EIF A;  3CCM T;  5HK3 A;  1NJI C;  1PHT A;  1M30 A;  4P5N A;  1TU0 B;  2JVV A;  2C0T A;  5KE3 A;  3RIR A;  1I0C A;  3FRN A;  2E6Z A;  4JDS A;  2DIG A;  2CRE A;  1I4K 1;  4X9C A;  3MP8 A;  3TSZ A;  3JCM c;  4PJO B;  3CBM A;  1RAE B;  2CP3 A;  2RD1 A;  1Q82 R;  2JJ9 A;  2COZ A;  3CCJ Q;  4HXJ A;  3I56 A;  4JS4 A;  3HPW A;  4XU0 A;  1X75 C;  1Q86 U;  1MGQ A;  4C92 G;  4HVV A;  2YXY A;  1K0S A;  1GBQ A;  4PFP A;  2EYY A;  1QMC A;  2JTM A;  4KGZ B;  1D0X A;  5CKH A;  3LYI A;  4KH0 B;  1NPP A;  2DF6 A;  2YUP A;  3CCQ T;  2DFU A;  5EG2 A;  4NL3 A;  3D7S B;  2V8K A;  3M4Y A;  2GCX A;  4E7K A;  1JQQ A;  2A3L A;  2GTO A;  2BTT A;  5GAM f;  5D6W A;  2RI5 A;  3OYL A;  1Q82 U;  1AVZ C;  5DLQ E;  1C6V X;  3CCS A;  1U5S A;  3THK A;  2O31 A;  2DM1 A;  3OSV A;  4RTZ A;  2O4X B;  3HTR A;  5GAN j;  1KHI A;  3JCM b;  2JMC A;  4Y92 A;  1FXX A;  1FX7 A;  4FM4 B;  2KBT A;  2M0O A;  1TTH B;  2B86 A;  1U1S A;  2K9G A;  1FMK A;  1VQP T;  2HZY A;  4D8K A;  4BY6 C;  4WCI A;  3RMS A;  1BI0 A;  5CKF A;  4JJD A;  2LNH B;  5KYW A;  1D0Y A;  3M0U A;  3CCJ A;  2J05 A;  4Z88 A;  1B3Q A;  2EW3 A;  3GNF B;  4KRT A;  3P8B B;  5I11 A;  1QW1 A;  5A0D A;  2DLP A;  3LX7 A;  2QG9 B;  3I5R A;  2L3S A;  2XU8 A;  5FRM A;  4E6R A;  4KT0 E;  2WAC A;  2HQE A;  3OYI A;  5GAN 2;  2RO0 A;  1N5Z A;  1NYF A;  3LH0 A;  1SHF A;  2FHD A;  1OEB A;  2EQI A;  2AK5 A;  4BE1 A;  5M9O A;  2DZC A;  4C92 B;  1VIF A;  1KQS A;  2EYZ A;  1RLP C;  4OMO A;  2F1L A;  3QWY A;  3ZFJ A;  3IQL A;  4FW2 A;  4B9W A;  2EQU A;  2LNV A;  2DBM A;  1JBM A;  1G3Y A;  3VS0 A;  4D8D A;  4OMQ A;  2MIO A;  3A8O B;  5LJ3 f;  2G3R A;  1N9S A;  2HSP A;  3CCR Q;  5CIU A;  4R56 A;  3GBQ A;  4E7J A;  1LVK A;  3M0T A;  1G3W A;  4OGC A;  1TG0 A;  4EMK C;  5I21 A;  4BI8 B;  1M3C A;  4LXC A;  1Q95 G;  4CI0 C;  1S72 Q;  5FLX E;  3PFS A;  4YTL A;  5CKD A;  1P92 A;  1N9R A;  4FT4 A;  1KQS S;  2KDS A;  3C94 A;  1TUC A;  5LJ5 g;  3HRT A;  2EJ9 A;  3U23 A;  4M7A C;  2K79 A;  2MI6 A;  5FU6 B;  3MP1 A;  3CMA T;  1YP5 A;  1WHL A;  3URG A;  4EPC A;  1YJ9 Q;  2DXC A;  2DNU A;  2ZPG B;  1VUB A;  2ESW A;  4AT1 B;  5A0L A;  1RI9 A;  1IGQ A;  5HCK A;  4C0D C;  4M75 C;  3QXE B;  1KQS P;  1YHQ Q;  2C0O A;  3OSS C;  2DYI A;  3EFO B;  3PE0 A;  1M3A A;  5AYF A;  4M77 B;  2LX9 A;  3M57 A;  2X4J A;  5DLO A;  3CCR A;  1X6B A;  2D8H A;  3QG1 A;  2FPF A;  3JSC A;  2NUT A;  1V1C A;  2HD0 A;  4C0G A;  3G71 T;  4A4K A;  2L8D A;  4M4Z A;  1VQ7 Q;  1S72 A;  4A4E A;  2DET A;  2LJ0 A;  1Z9Q A;  1QVP A;  1MMD A;  3TU4 K;  2EGC A;  4JJN K;  1NE8 A;  4A53 A;  1M90 U;  2JTF A;  3FEO A;  4F7U E;  2GBQ A;  2CH4 W;  2LDM A;  2EYW A;  4HCZ A;  1PCX A;  4IUQ A;  5GJW B;  1QP2 A;  1UUE A;  1WHK A;  1YJ9 A;  5FRN A;  2DD5 A;  4JRK A;  1TS9 A;  2X4Y A;  3EHR A;  2EKO A;  1MV3 A;  3BE3 A;  2KR3 A;  2MYS A;  4HCC A;  3SWN B;  1JJ2 A;  2DL4 A;  1JXM A;  1YHQ A;  4X1V A;  2EGE A;  4OF1 A;  2KRN A;  4M75 E;  1OV3 A;  4XU1 A;  3TVT A;  1VQN T;  1FWZ A;  1X01 A;  5KH6 A;  2MWO A;  2F2X A;  1YJN T;  1VQ9 Q;  1OU8 A;  1V76 A;  4M7D C;  2GNC A;  4RTX A;  4XQ3 A;  3MP6 A;  2LCC A;  4KUI A;  4JJB A;  2E4H A;  1M1K U;  1IGU A;  2IVW A;  1VQ7 A;  4BDZ A;  3REB B;  3C12 A;  1U06 A;  2HSE B;  2D8J A;  1U3O A;  1WA7 A;  3RMQ A;  2OJ2 A;  1M4Z A;  1IXD A;  3CCU Q;  2PUO B;  2A0F B;  1UJ0 A;  1ZSG A;  1JJ2 S;  2X4W A;  2RHI A;  3DB4 A;  1RAI B;  4KBM B;  1IZ6 A;  2VC8 A;  3I55 T;  2EWN A;  4AG1 C;  1RAD B;  2DXB A;  3MEW A;  1NZ9 A;  3ZL7 C;  2EQJ A;  4IUU A;  5C6S A;  2E64 A;  4FW1 A;  2Y90 A;  3EG2 A;  1VIE A;  5LJ3 j;  3CC2 Q;  2FB7 A;  3H0I A;  2AZV A;  5IHN A;  1JJ2 P;  2RI3 A;  1VQ9 A;  1HD3 A;  2KRO A;  4LDU A;  2JNG A;  3BDU A;  1PD1 A;  3OY9 A;  4M78 C;  4M7D E;  1U1T A;  2CZ6 B;  1KC8 R;  2MOX A;  1YBY A;  4LDV A;  2F69 A;  4FSX A;  2LT1 A;  4F7U G;  2FYK A;  2BZY A;  3RR6 A;  3CC4 A;  2PTK A;  2LQK A;  1R8O B;  1T3L A;  2RNA A;  3CCU A;  2L5Q A;  2M1H A;  2VXF A;  3L2W A;  1VQ4 T;  3RES A;  1QQJ A;  2RQU A;  3VU3 C;  4AFQ C;  4C92 C;  3OBY A;  3UF4 A;  1IHW A;  1M2V B;  3X20 B;  3EGX B;  2HQH A;  2JUF A;  4M75 G;  4D6W A;  1N8R C;  1WGS A;  1NBE B;  1XQH A;  2KYB A;  5GAO m;  1QVG A;  6AT1 B;  2BKD N;  2KYM A;  3NTH A;  3G7Z A;  1GCQ C;  1H3H A;  1X2Q A;  3M59 A;  2E41 A;  2K3Y A;  2AIR B;  3VS5 A;  4C5G A;  3CC2 A;  1AWO A;  2JZ2 A;  1TSF A;  2EFI A;  2ZAE A;  3JCM Q;  4GLM A;  1K8A C;  3CCE Q;  5GAN f;  3FJP A;  3LLR A;  1JB0 E;  3H9N A;  5FRO A;  1OQK A;  5CKB A;  2RB6 A;  2WSF E;  2HQX A;  4M78 E;  1FMV A;  3F70 A;  3CCL Q;  5KE2 A;  1QP3 A;  1WQ7 A;  2O9S A;  1ZA1 B;  2LQ8 A;  4N4G A;  5GAM g;  3MEU A;  5FU6 C;  3E9G A;  4JJC A;  3REA B;  4PNO A;  2DRK A;  2D6F A;  3N5B B;  3OYA A;  3ZBD A;  4XTZ A;  3L1A A;  1UFF A;  1RL2 A;  3CC7 Q;  4IUP A;  4RTW A;  4C8Q A;  3NTK A;  3J80 E;  4J9I A;  1KJW A;  3PGG A;  3DB3 A;  3V7R A;  3DLL A;  1D3B A;  1OZ3 A;  4F04 B;  2DD4 A;  2DXT A;  2QYZ A;  4F7U B;  2DJZ A;  2RMO A;  2WSE E;  2O88 A;  1PRL C;  2MF2 A;  2FRW A;  5LJ5 e;  4M77 C;  2XKO C;  1K0X A;  1N6A A;  4M7D G;  5J26 A;  5FW9 A;  8ATC B;  1PM3 A;  3VRZ A;  4X9D A;  5GAN 5;  1LJO A;  1KSW A;  2DL3 A;  2E1H A;  1XJW B;  3OW2 S;  3MET A;  4MDX A;  4RUG A;  3CCE A;  2HMA A;  3QDF A;  3VS4 A;  2V1R A;  1G3S A;  2CZ7 B;  4C0D B;  1T0J A;  4M75 B;  2KSS A;  4CC2 A;  2DL7 A;  2E70 A;  2JTE A;  3HRU A;  1TWB A;  2MCN A;  3GIB A;  4XU3 A;  3VS2 A;  3OS1 A;  3JCM f;  1OOT A;  3CCL A;  2EYX A;  4RG8 A;  5HKC A;  2OTL Q;  4DA4 A;  4PJJ A;  5J39 A;  2P4R A;  2YRC A;  1UEB A;  2YLC A;  4J83 A;  2PQW A;  3CME Q;  2GQV A;  2P84 A;  1AD5 A;  1VYU A;  3SD4 A;  2YWW A;  4Z02 A;  3CC7 A;  1OX9 A;  5GMK h;  1K9M C;  2XIC A;  2P0Q A;  2J6K A;  1D1C A;  1C1A A;  5DY9 A;  3O5Z A;  1ZSZ A;  1BI1 A;  1VQ5 Q;  2FZK B;  1ZBX A;  4QKU A;  3HFN A;  1LCK A;  1G5V A;  1QCN A;  2LX7 A;  4IIM A;  1HXD A;  1Q86 R;  3LH5 A;  4FYY B;  4PKC C;  2ROT A;  1UGQ B;  1SF9 A;  1UGS B;  1SG5 A;  3NHN A;  4ZGD B;  2KAF A;  2XHC A;  4M78 G;  2D1X A;  2NYS A;  4FL6 A;  1WPY A;  3OS5 A;  2QDY B;  3O8V A;  3KUF A;  3CCM Q;  5KCO A;  4OMP A;  4F16 A;  4GLK A;  4JRP A;  3TRE A;  4JS5 A;  3JCM P;  5GAN 7;  1Q7Y U;  2OTJ T;  1HYO A;  5D7U A;  2CSQ A;  3CCS T;  3A1P A;  2L89 A;  4J6W A;  2OTL A;  1SRM A;  1FYN A;  3FB9 A;  3ZEH A;  4OMM A;  4M7D B;  5GAN h;  3OYK A;  3R6O A;  2K6D A;  1YIT T;  2XID A;  4ME7 A;  1RAF B;  4KH1 B;  5KYX A;  4PJO A;  2E3I A;  3CME A;  1PSF A;  1OU9 A;  5CK9 A;  2CP6 A;  5IXF A;  1WJR A;  4RTT A;  3CCQ Q;  3INZ A;  2HDA A;  3LWH A;  4LD6 A;  4ZTF A;  1BK2 A;  2QA4 T;  1VQ5 A;  1I5O B;  5GAM d;  1VA7 A;  1NEB A;  1GXI E;  1I1J A;  3QJ6 A;  1ZUU A;  2RJE A;  1QKX A;  4E7I A;  2LCL A;  2ZPE B;  2KEA A;  3OYB A;  1XNI A;  2X35 A;  4J9E A;  3RNJ A;  3WXM B;  3S3O A;  4BUG A;  4OMF B;  4KGV B;  4CC7 A;  3MCA B;  2DO3 A;  2QTV A;  3MJX A;  1KQ2 A;  1K73 C;  1UG1 A;  3CCM A;  4JRQ A;  4PFZ A;  3MO8 A;  2QQR A;  4FSS A;  1M5Q 1;  1PNJ A;  2K2M A;  3S3M A;  1VQP Q;  4OB0 B;  1WXT A;  4Z89 A;  2BUD A;  2FPD A;  1R0B G;  4F17 A;  5FU7 B;  1WYX A;  1KD1 C;  4C8Q F;  4M78 B;  4Q5W A;  1OPK A;  2VVK A;  2LJ3 A;  3X24 B;  1FMW A;  3AHU A;  2RJD A;  1GFD A;  2Y4Y A;  3JCM h;  2EVR A;  2JW4 A;  3EG0 A;  3CCQ A;  2YRV A;  2OX7 A;  3CD6 T;  3M0Q A;  3L42 A;  4M7A F;  3UWN A;  1IRE B;  4M77 G;  3JB9 F;  3AT1 B;  1GFC A;  2FZC B;  3CBO A;  3EAE A;  1B7T A;  2HBW A;  4OML A;  1EFN A;  2WSC E;  2E12 A;  1LNX A;  2A7Y A;  3VUB A;  1QCO A;  3CQT A;  2M0Y A;  2SRC A;  3RDV A;  2EQM A;  3A5Z B;  1AOJ A;  5LJ3 d;  4QVD A;  5D6X A;  1KK7 A;  3EGU A;  4BI4 A;  1TUG B;  1ZHI A;  4C8Q D;  1GCP A;  1SKU B;  1VQO T;  4IUT A;  4OVA A;  1VQP A;  2RHY A;  2HL5 C;  2EPD A;  2X3X D;  2JS0 A;  1BYM A;  3C95 A;  5IHI A;  1V29 B;  4O6J A;  4M7A D;  2QK0 A;  3V8J A;  1DJ7 B;  2CT4 A;  3JB9 D;  1UGV A;  2JOY A;  1Q81 C;  1LOJ A;  8AT1 B;  2HAX A;  1I81 A;  3A8H B;  1SPK A;  5CKE A;  2JM9 A;  1K8A U;  2AHJ B;  4E7S A;  3OBW A;  1A0N B;  2YHT A;  3SEM A;  3MPU B;  3M0R A;  2KT1 A;  5A2Q E;  2O2O A;  2QXF A;  3RKY A;  3CMA Q;  4FYW B;  2ECZ A;  2RHX A;  2M02 A;  3DLM A;  4N4I A;  2RJF A;  4ELZ C;  4N0A C;  3EFS A;  2R58 A;  1QKW A;  4PLI A;  1PD0 A;  3MEA A;  1QWF A;  1M90 R;  3E1S A;  2DL8 A;  2GF7 A;  1VQK Q;  1AWX A;  3HP9 A;  4HVW A;  3UT1 A;  2Y4X A;  5GAM h;  1SSF A;  4E7H A;  2ATC B;  4RMO A;  5KYU A;  4PJO F;  3EFO A;  5CQY A;  1J3T A;  3KXT A;  3G71 Q;  4AG2 C;  2DRM A;  2RPN A;  3OYC A;  3QII A;  4XTV A;  1RI0 A;  2DTO A;  4A63 B;  2RN8 A;  3CPF A;  2NUT B;  4DBQ A;  3KBG A;  1WQW A;  3RUX A;  1MMA A;  1WIE A;  3X28 B;  5GMK i;  2EIF A;  3HKS A;  3H8Z A;  3PVQ A;  2NWM A;  3CMA A;  3P8H A;  1I8F A;  3OYH A;  1X43 A;  2L3P A;  3E19 A;  4C8Q E;  2K7A A;  3P8D A;  3TSW A;  5GAN g;  3HHT B;  1M1K R;  1MND A;  5GAO n;  1VQ6 T;  3TQ7 P;  2YDL A;  1TXQ A;  3MKD A;  4PJN A;  4LN2 A;  3LW5 E;  1T0H A;  4J7F A;  4PJO D;  5GAO r;  1UHC A;  1BCM A;  4E7Z A;  4MMK A;  4HKE A;  3BDL A;  5GJV B;  3GPL A;  2KY9 A;  3PMI A;  1VQK A;  3LWI A;  1NJI R;  3QZ9 B;  3SWN A;  1VQN Q;  5KYN A;  2XG8 D;  5GAN 4;  3G6E T;  1YJN Q;  1YN8 A;  3PIP A;  1SRL A;  1Q86 C;  2LZ6 B;  3G71 A;  2YUO A;  1MMG A;  3CXC A;  2DBK A;  5CVI A;  1YJW T;  3GP8 A;  4QQD A;  5LJ3 h;  4ORZ A;  1YIJ T;  3CC4 Q;  3VYH B;  4KUD K;  2ZPI B;  4AFS C;  1UHF A;  3OYM A;  1ABQ A;  2CDT A;  3BY7 A;  2YLB A;  1WXU A;  3WVD B;  2QTX A;  4C5I A;  2QGF B;  4PJM A;  2DEQ A;  4C5H A;  1NJI U;  2RM4 A;  2ZPH B;  3I55 Q;  3PNW C;  1CKA A;  1Y96 B;  3JAM E;  1Q82 C;  1WNL A;  3QSU A;  3OMG A;  4C92 F;  1WHM A;  2GFU A;  4JPB W;  2W10 A;  4XTX A;  4JLI A;  3JCM g;  1BIA A;  3JB9 J;  1VQM T;  3CXC S;  2ZZD A;  1PRM C;  2DAQ A;  3JCM J;  1VQL T;  2E5K A;  2IIM A;  3SDZ A;  3DKM A;  2XK0 A;  1VQN A;  3BFM A;  1YJN A;  1KG1 A;  2CH4 A;  5FU7 C;  1BU1 A;  1WHJ A;  3EG9 B;  5GMK m;  2HKQ B;  4XU2 A;  5LJ5 f;  2GQI A;  5IT9 E;  2XDP A;  4Y28 E;  2VAS A;  3QHS A;  2A08 A;  3OYE A;  1BI3 A;  2BIV A;  2W0Z A; 
#chains in the Genus database with same CATH homology
 4RG8 A;  4BY6 C;  1BI2 A;  5HKC A;  4MZT A;  4C92 D;  3RMS A;  4DA4 A;  1BI0 A;  5CKF A;  5CAI A;  2XDB A;  3CCJ A;  2LT4 A;  1YI2 T;  5J39 A;  2P0P A;  3GNF B;  3P8B B;  4EDU A;  5IAY A;  1UEB A;  1QW1 A;  5A0D A;  4QVC A;  2YLC A;  3LX7 A;  4J83 A;  2PQW A;  1JRI A;  3ASK A;  2GQV A;  4KUL A;  4BI3 A;  1VQ7 T;  2XU8 A;  5FRM A;  2MAM A;  3SD4 A;  4Z02 A;  3I55 A;  3CC7 A;  4KT0 E;  5GMK h;  1K9M C;  2XIC A;  2WAC A;  2HQE A;  3OYI A;  2P0Q A;  4IKF A;  5DY9 A;  1XTD A;  5GAN 2;  4ELY C;  2RO0 A;  1BI1 A;  4BDY A;  4BB7 A;  3HL8 A;  2XD0 A;  2GFA A;  1H64 1;  1ZBX A;  4II1 A;  3LH0 A;  4M7A E;  3HFN A;  1VQ8 T;  1G5V A;  4M7D D;  2FHD A;  3X26 B;  3M5A A;  1HXD A;  4A54 A;  3JB9 I;  3UPU A;  1HK9 A;  4BE1 A;  3RKW A;  5M9O A;  4PKC C;  5GAN d;  2RK2 A;  2DZC A;  5LL6 S;  4C92 B;  1Q7Y C;  1VIF A;  3VUZ A;  1UGQ B;  5LJ3 e;  2DK3 A;  1UGS B;  5GAM j;  1KQS A;  1K9M U;  3MHX A;  4ZGD B;  3OYG A;  2I2L A;  3ZFJ A;  2KAF A;  1BIB A;  2XHC A;  3J7A F;  4M78 G;  3VV0 A;  4B9W A;  4FL6 A;  1WPY A;  2EQU A;  1YCY A;  3OS5 A;  4OB2 B;  3JRZ A;  2LNV A;  2QDY B;  2D0Q B;  1JBM A;  3KUF A;  1G3Y A;  3O8V A;  5KCO A;  4XK8 E;  2VGN A;  2MWP A;  2P4T A;  4GLK A;  4JRP A;  4M78 F;  3A8O B;  5LJ3 f;  3LGL A;  3TRE A;  4TVR A;  1M9S A;  4JS5 A;  2G3R A;  1B34 B;  4RCC A;  3A8M B;  3JCM P;  1N9S A;  5GAN 7;  3SB2 A;  3TCJ A;  1Q7Y U;  5GMK l;  2OTJ T;  1XOV A;  2RH2 A;  3HFO A;  3ME9 A;  3CPW A;  5CIU A;  3UDC A;  3CCS T;  4PJO C;  4R56 A;  2L89 A;  1OZ2 A;  4E7J A;  4DOV A;  4J6W A;  1G3W A;  4OGC A;  2OTL A;  3VJP A;  3FB9 A;  3ZEH A;  1VQ9 T;  4EMK C;  2EJF A;  4M7D B;  5GAN h;  5I21 A;  1PSE A;  4BI8 B;  3EFR A;  5KCH A;  3BW1 A;  3OYK A;  3JCM X;  3R6O A;  1YIT T;  1QVG S;  2XID A;  4ME7 A;  3CCV T;  4PJO A;  3PTA A;  4CI0 C;  1VQ4 A;  5FLX E;  3PFS A;  4XTY A;  3CME A;  2QQS A;  1PSF A;  4YTL A;  4WF2 A;  4EMK A;  5CK9 A;  5CKD A;  5L8R E;  1P92 A;  1N9R A;  4FT4 A;  4XTU A;  1VQ6 A;  2K2V A;  1KQS S;  2KDS A;  1WJR A;  2PUK B;  3C94 A;  3JCM V;  3CC4 T;  5LJ5 g;  3HRT A;  1UGP B;  2EJ9 A;  2PVO B;  2QI2 A;  3INZ A;  3PIO A;  1I5L A;  2DTI A;  3LWH A;  3CCU T;  4LD6 A;  4ZTF A;  4ZGE B;  4M7A C;  2QA4 T;  1VQ5 A;  5CO7 A;  2MI6 A;  2QEX T;  1Y96 A;  5GAM d;  5FU6 B;  1NPR A;  2RK1 A;  3S6W A;  4C8Q B;  1O75 A;  1GXI E;  3QJ6 A;  1W2B A;  3M56 A;  3MP1 A;  3CMA T;  2RJE A;  4RCB A;  2K57 A;  4IUR A;  4E7I A;  4M7A A;  2LCL A;  2ZPE B;  4DQ2 A;  4M78 D;  4F7U A;  3URG A;  1TH7 A;  4BE2 A;  4EPC A;  3OYB A;  2DXC A;  1KQ1 A;  4VUB A;  2ZPG B;  3G6E A;  1XNI A;  2DKG A;  2X35 A;  5LJ5 d;  1VUB A;  3WXM B;  3S3O A;  4BUG A;  2KK4 A;  1KHC A;  4OMF B;  3OYF A;  2LC4 A;  3MCA B;  2DO3 A;  4L5G A;  5A0L A;  2QQA A;  5GAN 3;  4B9X A;  4DOW A;  4ZTJ A;  3JCM d;  1KQ2 A;  1K73 C;  4C0D C;  4M75 C;  3QXE B;  3CCM A;  4JRQ A;  3MO8 A;  3OQ5 A;  1YJW A;  2QQR A;  3OSS C;  1M5Q 1;  1AHJ B;  2K3X A;  5AYF A;  4A4G A;  3G4S T;  4M77 B;  1UB4 A;  3S3M A;  1YIJ A;  2LX9 A;  2ZPB B;  3M57 A;  4OB0 B;  3CC2 T;  4C8Q G;  2X4J A;  4M75 A;  5DLO A;  3CCR A;  2BUD A;  4MDW A;  5GMK e;  3RER A;  3X25 B;  3QG1 A;  3OB9 A;  3FLG A;  4PJO E;  3OS0 A;  2RHU A;  4FT2 A;  5FU7 B;  4IUV A;  1KD1 C;  3JSC A;  4C8Q F;  4J6Y A;  3G71 T;  2HD0 A;  2LVM A;  4C0G A;  1K73 U;  3GNG A;  4A4K A;  4M78 B;  4NOY A;  2L8D A;  4Q5W A;  1U8R A;  3T9N A;  1S72 A;  4A4E A;  5GAN 8;  3X24 B;  3GLX A;  3AHU A;  2RJD A;  4L6V 5;  4M7A G;  2Y4Y A;  3L2R A;  4JRI A;  4FU6 A;  3JCM h;  3LGF A;  1QVP A;  2RA2 A;  4BY6 B;  3QKJ A;  4NS5 A;  5GAO p;  3CCQ A;  3TU4 K;  3JB9 G;  5LJ3 g;  2R57 A;  2YRV A;  3CD6 T;  2NLU A;  3I56 T;  3L42 A;  4JJN K;  4M7A F;  3UWN A;  1NE8 A;  3S3N A;  1VQM A;  1IRE B;  2E65 A;  2QQB A;  4A53 A;  1KD1 U;  1M90 U;  2ZCF B;  4C0Z A;  4M77 G;  2PVD B;  2JTF A;  3FEO A;  3JB9 F;  4F7U E;  3JCM W;  2LDM A;  4HCZ A;  1VQL A;  3CBO A;  2KMT A;  3EAE A;  4IUQ A;  2CZ1 B;  1QP2 A;  2CS7 A;  4OGE A;  3OS2 A;  1YJ9 A;  2WSC E;  2E12 A;  1LNX A;  2A7Y A;  4M77 F;  5FRN A;  3VUB A;  2DD5 A;  2FL7 A;  4JRK A;  3E9F A;  3JB9 H;  2EQM A;  2X4Y A;  3A5Z B;  3OYJ A;  5LJ3 d;  1VQ5 T;  4QVD A;  2EKO A;  4HCB A;  4J8O A;  4JLG A;  1KC8 U;  5GAN 6;  4HCC A;  5D6X A;  3SWN B;  2F5T X;  4OB3 B;  5GAN e;  4BI4 A;  1JJ2 A;  1ZHI A;  4C8Q D;  1YHQ A;  4MZP A;  2VUB A;  4OF1 A;  5LJ5 j;  4M75 E;  4R55 A;  1VQO T;  4PLL A;  4IUT A;  3PT9 A;  2H3J A;  4LDW A;  1OYX A;  4OVA A;  2RHY A;  3GF5 A;  4XU1 A;  3VKI A;  1VQP A;  1VQN T;  1FWZ A;  1X01 A;  3OMC A;  3RKX A;  5KH6 A;  2MWO A;  5I2M A;  1YJN T;  1BYM A;  2OAU A;  3V7S A;  1H3Z A;  5CR2 A;  1B34 A;  3C95 A;  2EJG A;  4M7D C;  1YI2 A;  2DTH A;  3CCE T;  1V29 B;  1WJS A;  4O6J A;  4XQ3 A;  2ZPF B;  4M7A D;  3V8J A;  3MP6 A;  2LCC A;  4KUI A;  4HA8 A;  1M1K U;  1DJ7 B;  2K5L A;  2IVW A;  1VQ7 A;  4BDZ A;  3C12 A;  3PMT A;  3JB9 D;  2JN0 A;  2K5F A;  1ZQ1 A;  4M7D A;  5A0G A;  2JOY A;  1Q81 C;  2IG0 A;  1M1G A;  1LOJ A;  4J7I A;  2HAX A;  5GMK j;  3CCL T;  3RMQ A;  4EMH A;  1M4Z A;  1I81 A;  3A8H B;  3V8K A;  4M77 D;  1UGR B;  2RI2 A;  5CKE A;  1QVF A;  2O01 E;  2PUO B;  4J6X A;  1K8A U;  3OW2 A;  4V2S A;  2AHJ B;  4LD9 K;  3CCJ T;  2VGM A;  3OBW A;  4EMK B;  2YHT A;  3J81 E;  5A2Q E;  1VQ8 A;  1OI1 A;  2QXF A;  3RKY A;  1JJ2 S;  2X4W A;  2FVU A;  3CEY A;  1D3B B;  1MHN A;  2RHI A;  4O5V A;  4X34 A;  1WJQ A;  4A4H A;  4A4F A;  2R5A A;  3V8L A;  2ZGW A;  3DB4 A;  3VYG A;  2RJC A;  4KBM B;  1IZ6 A;  2L3R A;  3FIF A;  5HY6 A;  2MMP A;  2VC8 A;  3I55 T;  3CC7 T;  2EWN A;  1BKB A;  1Q81 U;  2DXB A;  2QQ9 A;  4XTW A;  3CPW S;  2RHX A;  5IN1 A;  3DLM A;  2E6N A;  3C4S A;  3ER0 A;  3HRS A;  4HT9 A;  4C92 E;  2M16 A;  3MEW A;  1NZ9 A;  4N4I A;  4HT8 A;  2RJF A;  3M4G A;  2F5K A;  4M7A B;  2EQJ A;  4ELZ C;  4IUU A;  4N0A C;  5C6S A;  2E64 A;  3EFS A;  2R58 A;  1X6O A;  3QJY A;  4PLI A;  1Y71 A;  2E5Q A;  3M9Q A;  2Y90 A;  3MEA A;  3FC3 A;  4CRI A;  2CYZ B;  4PJO G;  4RKU E;  3E1S A;  2GF7 A;  3L2V A;  4ZN3 A;  2O4X A;  4QQG A;  2RHZ A;  4N0A A;  3HP9 A;  2HBP A;  1VIE A;  3UT1 A;  2Y4X A;  3QYG B;  5LJ3 j;  5GAM h;  1SSF A;  5GAO l;  4E7H A;  2FB7 A;  2OTJ A;  3MEV A;  3V7C A;  3OA6 A;  3M54 A;  4EMG A;  4RMO A;  3JCM e;  1QVF S;  4PJO F;  4BAC A;  5CQY A;  5C0M A;  3OYN A;  2RI3 A;  2EQK A;  2B8A A;  1VQ9 A;  3KXT A;  4OB1 B;  5DM7 R;  4E7L A;  4LDU A;  2JNG A;  3BDU A;  1M90 C;  1O9S A;  1YIT A;  3OY9 A;  4BE0 A;  1W2B S;  3CCV A;  2CZ0 B;  4M78 C;  4QQ6 A;  4M7D E;  1U1T A;  2CZ6 B;  3M53 A;  3OYC A;  5LJ5 h;  3HSB A;  3QII A;  4XTV A;  1RI0 A;  1YBY A;  4LDV A;  2DTO A;  2F69 A;  4FSX A;  2LT1 A;  4FIB A;  4JUV A;  3CPF A;  4F7U G;  2FYK A;  3CC4 A;  4M78 A;  2XDD A;  3KBG A;  2CKK A;  2LQK A;  1R8O B;  1WQW A;  3GOX A;  3CCU A;  3RUX A;  2KVQ G;  1G3T A;  2QA4 A;  2OTL T;  2QEX A;  2EAY A;  2L5Q A;  2M1H A;  4GY5 A;  1KC8 C;  4NL2 A;  3X28 B;  5GMK i;  2VXF A;  2EIF A;  4F7U F;  2DZ9 A;  3HKS A;  3QYH B;  4L59 A;  3H8Z A;  3CMA A;  3P8H A;  1I8F A;  3OYH A;  3L2W A;  1VQ4 T;  1M8V A;  4C8Q E;  3E19 A;  3CME T;  3P8D A;  3RES A;  5GAN g;  2X4X A;  3HHT B;  2CGH A;  3L2Q A;  3VU3 C;  2DVE A;  4C92 C;  4ATO A;  3OBY A;  5GAO n;  2DXU A;  1VQ6 T;  1M1F A;  3X20 B;  2V8J A;  3CBP A;  2C06 A;  3WVE B;  2JUF A;  4M75 G;  4QW2 A;  4PJO D;  1Y7X A;  3LW5 E;  4D6W A;  4J7F A;  1WGS A;  3QO3 A;  1N8R C;  3A8L B;  1XQH A;  2DIQ A;  2R5M A;  3M55 A;  3QZ5 B;  4C92 A;  5GAO r;  5HK0 A;  2XI9 A;  4MML A;  3SWN C;  3H6Z A;  5GAO m;  1QVG A;  2BKD N;  4MMK A;  1M1K C;  4HKE A;  4M75 F;  3NTH A;  5GAO q;  3BDL A;  3G7Z A;  3L2Z A;  3M59 A;  2P0K A;  2E41 A;  2KY9 A;  3PMI A;  3GPL A;  2K3Y A;  3LWI A;  3G4S A;  1VQK A;  3QZ9 B;  4C5G A;  3SWN A;  2PU9 B;  3CC2 A;  2JZ2 A;  4XAX B;  2XG8 D;  5GAN 4;  2EFI A;  3G6E T;  4RG2 A;  4M77 E;  2KQW A;  4J5Y A;  5D6Y A;  3JCM Q;  1K8A C;  5J3B A;  2VV5 A;  4N4H A;  2DPP B;  2K4Y A;  3OYY A;  3QUI A;  5CCA A;  5GAN f;  3PIP A;  1N8R U;  3FJP A;  2PVG B;  3LLR A;  1N27 A;  1JB0 E;  1Q86 C;  4ZN1 A;  3QBY A;  3FDR A;  3G71 A;  3CXC A;  2LRQ A;  1EIF A;  5FRO A;  5HK3 A;  3CCM T;  1NJI C;  5CKB A;  4C5E A;  5CVI A;  1YJW T;  3GP8 A;  2RB6 A;  2WSF E;  4P5N A;  2HQX A;  2JVV A;  4QQD A;  5LJ3 h;  5KE3 A;  4M78 E;  2M9U A;  3RIR A;  3CCL A;  3FRN A;  3F70 A;  2E6Z A;  1YIJ T;  4JDS A;  2DIG A;  3VYH B;  1I4K 1;  5KE2 A;  4KUD K;  2ZPI B;  4X9C A;  3MP8 A;  3CCR T;  3JCM c;  1QP3 A;  2V8I A;  1WQ7 A;  2K5I A;  3CBM A;  3OYM A;  2RD1 A;  4PJO B;  4PL6 A;  3CD6 A;  2LQ8 A;  4N4G A;  5GAM g;  3BY7 A;  3MEU A;  2YLB A;  3I56 A;  5FU6 C;  3E9G A;  3HPW A;  4XU0 A;  4C8Q C;  3WVD B;  4JS4 A;  2QTX A;  4C5I A;  1X75 C;  3NFC A;  1Q86 U;  1MGQ A;  4PNO A;  2VYT A;  4Y91 A;  4C92 G;  2DEQ A;  3A8G B;  2D6F A;  3N5B B;  4C5H A;  1NJI U;  3OYA A;  1S72 T;  3ZBD A;  4XTZ A;  2RM4 A;  3L1A A;  2ZPH B;  1RL2 A;  2JTM A;  4IUP A;  3PNW C;  4M75 D;  4UC4 A;  4C8Q A;  1Y96 B;  3JAM E;  1Q82 C;  1WNL A;  3NTK A;  3J80 E;  3QSU A;  3OMG A;  3PGG A;  4C92 F;  3DB3 A;  5CKH A;  3V7R A;  1D3B A;  1OZ3 A;  3DLL A;  5GAM e;  3LYI A;  4E47 A;  1NPP A;  2EYQ A;  3L2U A;  3OYD A;  3CCQ T;  5EG2 A;  4NL3 A;  2GFU A;  2DD4 A;  1Y07 A;  2V8K A;  2DXT A;  3M4Y A;  4XTX A;  2GCX A;  4JLI A;  3JCM g;  4F7U B;  4BD3 A;  1BIA A;  2D9T A;  3JB9 J;  4E7K A;  1VQM T;  1W4S A;  2DJZ A;  2WSE E;  3CXC S;  4C0F A;  2A3L A;  2ZZD A;  2MF2 A;  2DAQ A;  3Q1J A;  3JCM J;  2VXE A;  1VQL T;  5GAM f;  5LJ5 e;  4MZM A;  2RI5 A;  4M77 C;  5D6W A;  1VQO A;  3OYL A;  1Q82 U;  2XKO C;  5DLQ E;  1N6A A;  3SDZ A;  5J26 A;  1YJ9 T;  4M7D G;  3DKM A;  2XK0 A;  1VQN A;  3CCS A;  3QDR B;  5CQX A;  2LTO A;  3M58 A;  4X9D A;  3BFM A;  1LJO A;  5GAN 5;  1YJN A;  2E1H A;  1KG1 A;  3OW2 S;  3MET A;  4MDX A;  3OSV A;  4OP0 A;  2O4X B;  3QPH A;  5FU7 C;  3CCE A;  4M77 A;  4LDX A;  4LDY A;  4M7D F;  5I2S A;  5GMK m;  5GAN j;  1G3S A;  1KHI A;  2CZ7 B;  2HNI A;  4C0D B;  3JCM b;  4M75 B;  2KSS A;  1FXX A;  4QVZ A;  4XU2 A;  3SFM A;  5LJ5 f;  5IT9 E;  2E70 A;  2XDP A;  3HRU A;  3TEE A;  1FX7 A;  4ZGJ B;  1YHQ T;  4Y28 E;  2E10 A;  4FM4 B;  3QHS A;  4XU3 A;  3GIB A;  1VQK T;  3OYE A;  2M0O A;  3OS1 A;  1BI3 A;  3JCM f;  3NTI A;  2BIV A;  1U1S A;  1VQP T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...