4PJOD

Minimal u1 snrnp
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
98
Chain Sequence
b'EMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVSKPVNKDRYISKMFLRGDSVIVVLRNPLIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein Sm D3
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing
total genus 19
structure length 98
sequence length 107
chains with identical sequence R, d, r
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoD00
1LNXA 5DY9A 4A54A 5LJ5d 5LJ3j 5GAMg 4M77E 3FB9A 5CAIA 1I5LA 4PNOA 5LJ5h 4XTXA 5GAOr 4M78E 1B34A 3FJPA 1Y96A 4NL2A 4WF2A 3RUXA 4C8QF 4MMKA 1M8VA 3V8LA 4V2SA 4M7AG 5GAMj 4RCBA 3QSUA 4XTYA 3RESA 2I2LA 1U1SA 5GAN8 2E1HA 2VXFA 3VU3C 5LJ5f 3V7SA 3JCMP 4F7UF 4C92E 4XQ3A 4J6WA 3AHUA 2QTXA 4M7DE 1H641 4M75E 2EWNA 1D3BA 1KQ1A 3JCMX 2DEQA 3JB9I 4C8QD 4EMKC 4PJOE 3JCMb 1WQWA 4M77G 2DTIA 2FYKA 3V7RA 1KQ2A 3V8JA 4M78G 3RIRA 3V8KA 2VXEA 4X9DA 3M4GA 2DJZA 5GAOn 4EMKA 5GANh 1TH7A 3JCMW 4M7AC 4PJOB 2RM4A 5GMKj 5GAN7 2HNIA 4F7UE 5GAMh 1LJOA 2E10A 3QHSA 3JB9J 4M7AA 4JUVA 3L1AA 4XU1A 4HT8A 4M7AD 4M7DG 4QVCA 1JBMA 4M75G 4M77B 3SWNB 3JCMQ 3JCMJ 5GANe 1HXDA 4M78B 2EJ9A 4XTWA 3JCMe 5GAOp 4PJOG 2K57A 3V7CA 1WNLA 5GMKm 5GAMe 2DZCA 4J6XA 1X01A 3QO3A 4MMLA 4M77A 4C92B 4N0AC 4X9CA 4A53A 2DKGA 4M7AF 4M7DB 1LOJA 2DXTA 4M75B 4Y91A 4F7UG 5GAOm 1I81A 5LJ5g 4C8QE 2DXUA 4XTUA 5LJ3h 3JCMd 4QVDA 4XTZA 1I8FA 5GANd 3JB9D 4N0AA 3JCMh 4JRKA 5GAMd 3BFMA 3INZA 4PJOC 3GIBA 5LJ5j 1U1TA 4C92G 3BY7A 3QUIA 3JCMV 2E64A 2JN0A 4M77F 5GANf 3JCMf 3HSBA 4F7UB 3BDUA 5GMKi 2CGHA 5LJ3e 3HFOA 4M78F 2E41A 4PJOA 2EJGA 2YHTA 4M7AE 5GAMf 1MGQA 4M77C 4NOYA 3SWNC 5GAN5 3JB9F 2DTHA 5GAN2 4M78C 2DVEA 4XTVA 4C8QG 1B34B 1I4K1 1Y96B 2RB6A 2ZGWA 3SWNA 3BW1A 4JRIA 4M77D 2EAYA 4M75F 4M78A 1WPYA 4M78D 5LJ3d 4RCCA 4C92C 2FB7A 5GMKh 4M7DC 4PJOF 4M75C 5GANj 3EFSA 2YLCA 3FIFA 3RKWA 4DQ2A 1JRIA 3RERA 3RKXA 4OP0A 4EMGA 3HFNA 1D3BB 1YCYA 4C92A 4JLIA 3SB2A 4C8QB 1BIBA 4C92D 4NL3A 2VC8A 4J5YA 4XU2A 5GAN6 4M7DA 4M75A 3L2ZA 5GAN4 5LJ3f 4M7DD 4M75D 4J6YA 4C8QC 3JCMc 2Y90A 3PGGA 5GMKe 4HT9A 5GMKl 4XU3A 1N9RA 5LJ5e 3JB9H 2DZ9A 4PJOD 4EMKB 4HA8A 5GAOq 4C8QA 2RA2A 3EFRA 1BIAA 1WQ7A 1M5Q1 3RKYA 4XU0A 5I21A 5GAOl 2DTOA 4M7AB 5GAN3 5LJ3g 4C92F 2EJFA 4F7UA 1N9SA 2E65A 1HK9A 3JCMg 5GANg 4M7DF 2YLBA 3JB9G 2RD1A 4EMHA
chains in the Genus database with same CATH superfamily
3A98A 4QQ6A 2EW3A 4PNOA 1B34A 3FJPA 2K5IA 5CQXA 2VXFA 1SHFA 1K8AU 2JTFA 3H8ZA 3OY9A 2X3WD 1T0HA 1D1AA 1OQKA 2E4HA 1M3BA 3R6NA 4EMKC 3L2QA 2MAMA 3I35A 3OB9A 5CKBA 3CCUQ 4FYXB 2JUFA 3PVQA 1Y07A 1X2QA 4M7AC 2A28A 2LQKA 2F69A 2A3LA 2E5KA 5GAN7 1NLOC 1QCOA 2E10A 2RK2A 2HKNA 1PNJA 2JMAA 2H3JA 4QVCA 4LUEA 3SWNB 1X6GA 2KDSA 1VQKQ 2YUNA 1JQQA 4PJOG 3S3MA 1FMWA 1W2BA 4E2FB 4FT2A 3H0IA 2X35A 1T0JA 2EPDA 1MNEA 2OTLQ 3MEWA 1ARKA 2VGNA 4HCBA 2ZAEA 3VS2A 2DL4A 4C92G 2DAQA 1RUWA 5HKCA 3ER0A 2G6FX 3EGUA 3HFOA 1B7TA 2PVDB 1ZSGA 4M78C 2DVEA 2EYQA 1UG1A 3G6ET 1TUCA 2J06A 1MHNA 2AZVA 4M75C 4JZ3A 1YHQT 3CMAQ 4J6YA 4LN2A 2K4YA 3P8DA 2GQVA 2JTMA 5LJ5e 3OBYA 1E6HA 3WXMB 4OMFB 1K9AA 3CC4Q 1OU9A 1PM3A 1WZOA 4PJLA 2X4JA 1VQ9A 4B6MA 2M16A 2DL3A 2LT1A 2CP0A 1IB8A 4C0ZA 2OJ2A 2ZPEB 1YBYA 4OGEA 1W70A 5GAOr 1IHWA 1WI7A 4WF2A 1JB0E 1WLPB 3CD6Q 5GAMj 3G4SQ 2B86A 2RJFA 3WVDB 1VQ8Q 2DETA 2XKOC 3HRUA 3JCMX 2PU9B 2WSCE 3H9NA 3M0PA 4QVZA 2PVOB 2Z0WA 4IUTA 4XU1A 1SSFA 4BDYA 2C0IA 2P0QA 3TSZA 2P4RA 3V7CA 2GFAA 3QIIA 4J6XA 1G8XA 1SRMA 3P8BB 3DKMA 2LNHB 1R0CB 3MEUA 4KULA 2CP3A 4Y91A 1IHVA 1VQNQ 2LQ8A 2XG8D 2DXUA 2KAFA 4XTUA 4JS5A 2OTJA 4FYVB 5FU6B 3E19A 3INZA 3GIBA 2COWA 4AFZC 3EGDB 3BY7A 3T9NA 3E9FA 2MWPA 1VIFA 1KD1C 4M78F 3TQ7P 4HCCA 3PIOA 4N4GA 2DTHA 1VQ7T 2QA4T 5A0DA 3CCQQ 4DEYA 3LGLA 5CKFA 3SEMA 3I5SA 4M75F 2YSQA 1FWZA 3ME9A 4JJNK 2JVVA 2F1LA 2QQSA 3X24B 1VA7A 1G5VA 4Y92A 5C6SA 1PRMC 3SB2A 4C8QB 2DBKA 3OYFA 2ED1A 3L2UA 2KT8A 4VUBA 1D0XA 1R0BG 3LGFA 1KIKA 4KUIA 5FU7B 1KSWA 1VQMQ 4M7DF 3SD4A 2RD1A 2EIFA 3LLRA 2RNAA 1Y96A 2KVQG 3M9QA 1YJWA 5AT1B 1G3TA 4J9FA 2D9TA 2KXDA 5KE2A 5LJ5f 4F7UF 3HKSA 2LCLA 4J6WA 1PKTA 2EQUA 3OS2A 2GTJA 3VS0A 4JRQA 1QVPA 3M4YA 5KCHA 4A63B 1WHMA 1BBZA 1WQWA 1BI2A 1Q81U 3OW2S 5D6WA 3V7RA 4RTTA 2CT3A 3M4GA 4X34A 3CC2A 1AZGB 1FMKA 3QDFA 3RBBB 1W1FA 1WDXA 4M77B 4ORZA 1BU1A 5GAOp 2GTOA 1WHGA 1M2OA 3VV0A 1U8RA 2FRYA 2CP7A 1ZA1B 4M7DB 1QP2A 4J9DA 5GAOm 2P4TA 2NUTB 3JCMh 1ZBXA 2DIQA 2AK5A 5LL6S 2JN0A 4DOVA 2J6OA 1Q82C 4F7UB 2FPDA 3CCRQ 1UDLA 5GAN2 2DEUA 1OPLA 3OS0A 3UT1A 3CPWP 3SWNA 1RABB 1V76A 4M4ZA 4PJOF 4HCKA 2YLCA 1N27A 2HZYA 1VQ6T 2DF6A 3RKXA 4DBRA 4JLIA 2J7IA 1K73R 3X25B 5M9OA 5GAN4 3G7ZA 3REBB 1H92A 4E6RA 1OI1A 1XNIA 5GAOq 3KBGA 1PC0A 3ZFJA 2R5AA 4BI4A 4JLGA 4ANJA 2KR3A 4C92F 3J81E 2CZ0B 2KQWA 1M8VA 3HTRA 5CKEA 2P0KA 1YWOA 2CP5A 2DRMA 1YJNA 4NL2A 3RUXA 3V8LA 3CBPA 3RESA 4DOWA 1TTHB 4L59A 3HRTA 1H641 3OYDA 2RN8A 2HEQA 1QVGA 1I1JA 1VOMA 4ELYC 3L2RA 3JAME 3LH0A 3VUBA 2DMOA 3CCST 5DLOA 2L3PA 3JCMW 2GBQA 2RQRA 4PJOB 1SEMA 5IHKA 3ZBDA 2K7AA 4OMOA 4JUVA 1YN8A 3TSWA 1HXDA 3CC4A 1Y0MA 2FL7A 2DZCA 1UUEA 4C92B 1LOJA 4RTUA 1I81A 4KGXB 2LQWA 2W0ZA 1I8FA 1GBRA 3UA6A 2R58A 1TOVA 4FIBA 1TU0B 3BFMA 1W6XA 2K3YA 3HL8A 2QASA 2ZZDA 5GJVB 5GMKi 3RDVA 1YIJT 3KFVA 3MJXA 5HK0A 3CCLT 2PNIA 1GBQA 1W2BP 2VASA 3O8VA 2QQ9A 4GLKA 1VQ5Q 4L5GA 4JDSA 2JW4A 1IGUA 3CQTA 1PRLC 4BDZA 3UWNA 3MEAA 2EYXA 3VYHB 1KQSS 1WXBA 1U5SA 3EGDA 4D8DA 5KYXB 1VQNA 4KUDK 1GFDA 5GAN3 3OW2A 1UGVA 4R56A 1WFWA 2E65A 1SSHA 5FRNA 4XK8E 1YITT 2JTEA 1GCQA 4M7AG 3QSUA 2I2LA 4OMNA 5GAN8 2E1HA 1K1ZA 5I2MA 3UF4A 5C0MA 2KEAA 1WHLA 1M90C 1PHTA 3EG1A 2EWNA 3E9GA 2XDPA 2DEQA 4LNPA 3OYAA 4JZ4A 2FVUA 4BY6C 2DIGA 1W4SA 2CDTA 4WCIA 1VQ4T 1I0CA 1VUBA 3CCUT 4HT8A 1R77A 2OTJQ 2L3QA 3UDCA 1S72Q 2K57A 4E7HA 1VQMA 2EYYA 2RQWA 2HSPA 1BCMA 2JNGA 4BE1A 2HBPA 1VQKT 2ZPHB 4C8QE 4XTZA 1VQLQ 1OZ2A 2LCSA 3VS3A 2HMAA 3CCEA 4JRKA 1YJ9A 4CI0C 3VS4A 2CUBA 2F2WA 1WXTA 2OTLT 3VS1A 1YHQA 1KK7A 1N6AA 2QXFA 1AZEA 1OZ3A 1PG5B 4E7ZA 1VQOQ 2LZ6B 4JRIA 4NS5A 3CCJT 4YTLA 1KD1U 5LJ3d 1UFFA 2COZA 5J26A 4J9HA 1HSQA 4CC7A 1QVFA 3NMZC 1YCYA 5CO7A 2FO0A 2A0FB 4M7DA 3M56A 3LH5A 1NJIR 1D1CA 3EG0A 2NUTA 4Z02A 4X1VA 1N9RA 4BD3A 1WJSA 2OAWA 1M5Q1 1PWTA 3CMAT 4F7UA 1HK9A 1C0MA 1AHJB 2JJ9A 5GAN5 2VV5A 4M77E 4RTZA 3DB4A 2IG0A 3CCVQ 1G3WA 2M0OA 3TREA 1XQHA 4MDWA 1TWBA 2D8HA 3S3OA 4M7DE 1Q82R 4BE0A 2ESWA 4EIKA 1RAHB 3GF5A 3CD6T 4RTYA 3G4ST 3V8JA 3VUZA 4A4HA 3V8KA 2DFUA 1M1FA 2VXEA 4FW1A 2WACA 1VQPT 4F7UE 4RG2A 4C0DC 4PLLA 1BCOA 1NG2A 1IXDA 1HYOA 4BI8B 1WNLA 3C0CA 1C6VX 2IVWA 2XK0A 3OYBA 5KH6A 4AMCA 2RF0A 3NTHA 1SF9A 1Y7XA 1VQ7A 2EFIA 4N0AC 4FL6A 2QA4A 3GP8A 2QDLA 2FZCB 5LJ5g 1KHCA 1TS9A 5GANd 1G2BA 3JB9D 1YP5A 2V1RA 5GAMd 3EG9B 1K73C 2DYBA 1NLPC 2E64A 3QXEB 1MMAA 3GNFB 4PJOA 4EDUA 3MKDA 1OPKA 2EJGA 2Y4YA 1KQSA 2HCKA 1SG5A 3QKJA 5KYNA 2J05A 1WGSA 1Q82U 4RCCA 4QQGA 2FB7A 5EG2A 3LYIA 4J83A 2PUKB 2KMTA 2XD0A 3QWYA 1HD3A 3OSSC 2VWFA 2OI3A 4C92A 3CCQT 4C8QC 2R57A 1YI2A 2CH4W 1YJNQ 5GMKe 2FHDA 4IIOA 1X69A 1V1CA 2LJ3A 2VUBA 4N4IA 4PFOA 4Z8AA 3RKYA 4OF1A 4ZTFA 4MZPA 2MOXA 2RHUA 1XTDA 5HY6A 3OYJA 2ZPGB 2L8DA 4AFUC 2KYBA 4XTXA 2K2MA 2RJEA 4OB1B 1GRIA 2IIMA 1F1BB 2RI3A 3A8OB 4C92E 1JXMA 5D6YA 2D0NA 5FWBA 3JB9I 2M0YA 2DTIA 4IUVA 4ZN3A 7AT1B 1Y71A 3I55Q 1NBEB 2YRVA 1OV3A 4IUPA 1VQ5A 2HNIA 1FYNA 4KT0E 2RQVA 5KYXA 2KROA 4KBMB 4DBHA 3M0UA 4GLMA 1PSFA 2ZPIB 2EBPA 2KT1A 3L42A 4LDVA 5GMKm 3R6OA 5J3BA 4ATOA 4M7AF 2KI7A 2FZGB 4AT1B 2KSSA 1ZSZC 2JZ2A 3EFOB 5A0LA 2K2VA 3NHNA 2L89A 3EG2A 2M02A 5IT9E 2LNVA 5HCKA 4CC3A 3PFSA 2J6KA 2QQAA 2LQNA 4NOYA 2QEXT 2HL5C 1ABOA 2O88A 3I56T 1M90R 4JPBW 1M1KC 2ZGWA 2L3SA 3I5RA 1QVGS 1GXIE 3A1PA 3CCRT 3OYGA 1RAFB 1WIEA 4RTWA 3ZEHA 1S72A 2YUQA 2QTVA 3M57A 1AOJA 3CC7A 4JS4A 4EMKB 1M8MA 4HA8A 1AVZC 2RA2A 2CYZB 4IURA 3CCMA 3M55A 4M7AB 1QP3A 1VQLA 3EAEA 1N9SA 3EHQA 2DYIA 2E6NA 3M59A 3JB9G 1BK2A 1LNXA 3PMIA 1MMGA 3QYHB 3CCSA 5CKDA 4V2SA 2MIOA 3FLGA 2DM1A 1VQOA 1BI1A 2YUOA 2L0AA 4FSSA 1WJQA 4DA4A 2BTTA 2EVRA 2HDAA 3JCMb 2MF2A 3QWXX 2L2PA 2BKDN 2R5MA 3G71A 3F70A 1M90U 4O5VA 3OW2P 3CBOA 2NUPA 1I07A 4PLIA 5A2QE 1LJOA 3G6EQ 3CCEQ 1JBMA 1VYTA 3JCMQ 4LDUA 4M78B 1YJ9Q 2EKHA 2D8JA 3S6WA 1YHQQ 2DKGA 4M75B 3A8LB 3JCMd 6AT1B 4R0KA 2DLPA 3CCVA 4II1A 1OYXA 5KYWB 1RI0A 4FT4A 1NJIC 4IUUA 1WHKA 2CS7A 5ECAA 1XJWB 3OQ5A 3PE0A 2RI2A 3JRZA 3UATA 2XICA 3EGXA 4E47A 3META 1WPYA 4AG1C 5IAYA 5GMKh 2L5QA 5FLXE 2ABLA 2MPXC 4F14A 2NWMA 1ZHIA 1RACB 2EQJA 4XAXB 1RAGB 2JT4A 2Y90A 4HT9A 2LX7A 2DL5A 1VQ9T 2KE9A 3EG9A 2MYSA 1WHJA 4BI3A 4DBFA 5LJ3g 2QI2A 1QWEA 2JS2A 1RAEB 2FZKB 4EMHA 1B07A 1D0ZA 2YRCA 5HK3A 5LJ5h 3SHWA 3A5ZB 3CMET 4AG2C 1U1SA 2BIVA 2KRSA 3M0TA 2BUDA 4MZMA 1QVFP 4PKCC 4XQ3A 1BYMA 1T3SA 2ECZA 2K6DA 4C8QD 1TXQA 1M1GA 2XU8A 4PJMA 4PL6A 2QQRA 1JXOA 2WSFE 1VQ7Q 2RM4A 2P84A 5GMKj 1NEBA 2QA4Q 2QG9B 1QVFS 1UEBA 3L1AA 3X26B 2KY9A 1FXXA 1OX8A 4K11A 3QZ9B 3KXTA 3VYGA 3CPFA 2AKLA 2X4YA 2DL7A 4KGZB 3FDRA 3U23A 2KXCA 4B9WA 4MMLA 3HPWA 2OTJT 2DXTA 3QDRB 3VKIA 3TU4K 2XMFA 2K5LA 2O4XB 5CIUA 1RADB 4J7IA 1BI3A 3C95A 4WTOB 5LJ5j 2YWWA 3QUIA 3A8MB 3CEYA 3BDUA 5LJ3e 4B9XA 3VRYA 1BKBA 2RPNA 1Q7YR 3H0HA 1YI2Q 3O5ZA 1K73U 3Q1JA 2ROLA 5I2SA 3OMCA 3I55A 4KH0B 3BW1A 1T3LA 4M77D 3L2WA 2VKNA 1QCNA 4OB3B 3HHTB 4DQ2A 2DO3A 1JRIA 3HFNA 1A0NB 2HD0A 5DM7R 5GAN6 4M7DD 1M30A 2RO0A 2EQKA 3KUFA 4HVVA 1ZUUA 1NPPA 2FPEA 3NGPA 2DZ9A 4A4KA 3EFOA 2FRWA 2NLUA 4TVRA 2GGRA 2AKKA 5I21A 2DK3A 3L2VA 2H3EB 1KQSP 1M2VB 5DY9A 3OMGA 1YJWT 2D6FA 1I5LA 1TG0A 1J3TA 1MMDA 3JV3A 3EH1A 4R55A 2K9GA 3V7SA 2X4XA 1BI0A 4N4HA 1M3AA 2M9UA 2RH2A 5D6XA 3OYIA 3CC2T 4KH1B 1M1KR 4EMKA 4OMPA 1MMNA 2OAUA 4KRTA 3JB9J 4M7AA 4RMOA 1GFCA 2RHZA 4EPCA 3OYHA 2A7YA 1RAAB 5GANe 2EQMA 1SPKA 2GNCA 2AIRB 5FRMA 2MK5A 3J7AF 1Q86R 1VQ6Q 2K3XA 1JEGA 5GAMe 3MEVA 4LDXA 2JMCA 1KFZA 3QJ6A 2CSQA 4ZGJB 2LMJA 2P0PA 5L8RE 3JCMV 4E7IA 1IREB 3CBMA 2K5FA 4C5HA 2CGHA 2KK4A 3EHRA 2YXYA 4M7AE 2DNUA 3SWNC 4JRPA 2JM9A 3UA7A 2CT4A 2HQEA 2X9HA 4XTVA 4C8QG 3CC7Q 2RB6A 5I22A 1TUDA 2X51A 4RG8A 4M78A 1P92A 2KNBB 4J7FA 1WX6A 3CCMQ 1X75C 4QQDA 2GF7A 2EYZA 1LCKA 3G6EA 3RKWA 4NL3A 1ZUKA 3FJ5A 4HCZA 4C92D 4E7KA 1M1KU 5KYUB 1QKXA 4M75A 5IXFA 5LJ3f 2E12A 3VJPA 1EZZB 4D8KA 3CCSQ 3PGGA 2DL8A 2DJQA 5KYWA 1OX9A 3OYLA 4F16A 1ZA2B 2CUDA 2QGGA 2XDBA 2A37A 1YJNT 2O31A 4GBQA 2GQIA 1CSKA 4A54A 3H41A 3OS5A 5CAIA 3QZ5B 3EH2A 3DB3A 3H0FA 4PFZA 5CKHA 4M78E 1K9MR 3G71Q 2DD5A 3S3NA 1UGRB 5A0GA 1FMVA 4QKUA 2V8IA 3VU3C 3RMQA 4HVWA 3CPWA 1AT1B 3HP9A 2G3RA 2QTXA 4M75E 3J80E 1H3HA 1KQ1A 3PMTA 2I0NA 3JSCA 2NUPB 1M3CA 4M77G 2HAXA 1YIJQ 4FCYA 2PTKA 1TH7A 2DXBA 3CXCS 2BE9B 2ED0A 2DILA 4BUGA 3QHSA 1SKUB 2CZ1B 3CC4T 4M7DG 2F2VA 5KYYB 1KC8C 4HVUA 4ESRA 3TCJA 2VVKA 3QO3A 2CKKA 4D6WA 4FU6A 4ME7A 3VS7A 3M5AA 2V8JA 4F7UG 2RHIA 2BE7D 3RR6A 5IN1A 1QKWA 3NFCA 5LJ3h 4QVDA 1VQ8T 5DLQE 1U1TA 3C12A 2LJ1A 4ELZC 5GANf 3EGXB 5GAMf 2RHXA 1JJ2S 2O9VA 4L6V5 1R8OB 3M0QA 1LPLA 1NJIU 2QQBA 2HL3A 2QYZA 3EFSA 2KBTA 3RERA 1D3BB 1VIEA 2V8KA 1CKAA 5FU6C 1IGQA 2B8AA 1SHGA 2O4XA 3GNGA 1VQNT 1VQ4Q 3GBQA 2AHJB 1YNZA 4BY6B 4FYYB 1OU8A 1NZ9A 2EJFA 3REAB 1AEYA 3THKA 2VC8A 1GCQC 5LJ3j 3FB9A 3A8HB 4LUDA 4E7JA 1G83A 1M27C 4RUGA 3TEEA 2O9SA 3UPUA 2XI9A 4A4GA 3OS1A 3TVTA 4IKFA 2VGMA 2X3XD 3OA6A 2KRNA 1HJDA 1JU5C 4PJOE 3QYGB 1VYVA 5FU7C 2EGEA 1D1BA 5GAOn 2DJZA 5GANh 2DD4A 3MP8A 5GAMh 2W10A 2RMOA 5AYFA 1MV3A 1QMCA 1M9SA 2HKQB 3CCJQ 1M2VA 3M54A 1N8RC 1Q7YC 1VQMT 3JCMe 4BB7A 1MUZA 2JOYA 4IUQA 3FC3A 4JJBA 1H8KA 3CCET 2V26A 2C06A 5CQYA 2LRQA 1YJ9T 4ZGDB 3E2UA 2K3BA 1UJ0A 4C5IA 4Z89A 3ASKA 3M0RA 4PJNA 4J9BA 3HSBA 3ULRB 3GOXA 1H3ZA 8AT1B 2YHTA 3AT1B 4M77C 4LDYA 2DRKA 3M58A 1K0SA 1V29B 1LVKA 1D0YA 3VRZA 3MPUB 1K0XA 2RQUA 2RI5A 2GFUA 2EAYA 1QWFA 3LWIA 2ZCFB 4QT7A 2FPFA 1QVGP 4M7DC 5GANj 2YUPA 2F5KA 1C1AA 4J5YA 3X20B 1D09B 3NPFA 4Y28E 2IPOB 3LW5E 1VQ6A 2KRMA 2HSEB 3CMEA 1VQPQ 2LVMA 1ZUYA 1TSFA 3SDZA 4XU0A 3C4SA 5GAOl 1UTIA 1O75A 1KG1A 2PUOB 2RJDA 1ACMB 2Y4XA 3CXCA 5IXBA 2MWOA 2EQIA 3MCAB 4C0DB 1PKSA 2M51A 4C8QF 4MMKA 2VB6A 2MCNA 2EYWA 4RCBA 5KCOA 4XTYA 1MV0B 1Q86C 1AWOA 3DLMA 2PVGB 2JM8A 5KYUA 2XHCA 2A08A 4RTXA 1YWPA 3E1SA 3RIRA 3MO8A 1N5ZA 1AD5A 1B3QA 2LC4A 2YDLA 3EG3A 3JCMJ 2JS0A 1Q81R 5FWCA 3FRNA 1JJ2A 1G3SA 2CP2A 2CH4A 5CK9A 2WSEE 1U06A 4O6JA 4OB2B 1Q95G 1RAIB 2ROTA 4C0GA 1X27A 2AT1B 4HXJA 3QPHA 2XIDA 2BZ8A 5IHNA 4A4FA 4PJOC 4M77F 3JCMf 1XOVA 3DLLA 2XDDA 4E7LA 4PJJA 2EKOA 2RQTA 2CZ6B 1YIJA 4ZTJA 5KYYA 2ZPFB 3CCLA 4C0FA 4C92C 2YRDA 2MMPA 1K9MC 1YI2T 4EMGA 1EX4A 4OP0A 1TUGB 3HRSA 1BIBA 2RJCA 2D0QB 2HQXA 4A4EA 4XU2A 4E7SA 1UGQB 3L2ZA 1GCPA 3BE3A 1FX7A 4DBQA 8ATCB 3PNWC 3JB9H 1KC8R 2QK0A 2GCXA 4FSXA 1WHHA 4LDWA 3OYEA 3MHXA 1X6BA 1WQ7A 2DX1A 1UGPB 1RLPC 3MP6A 4CC2A 2SRCA 5LJ5d 1K8AC 4OMLA 2DBMA 3H6ZA 4LXCA 4IIMA 1OEBA 1PD1A 1YITA 1AWWA 2V1QA 1YFNA 3OYMA 3JCMP 4CC4B 3P8HA 1D3BA 2LP5A 2DA9A 2DVJA 5GJWB 2DERA 3BDLA 3MP1A 3D7SB 1ZX6A 3C94A 1VQ5T 5I11A 1ZSZB 4P5NA 2QEXQ 1E7OA 3I56Q 1Z9QA 1NPRA 5CVIA 1IZ6A 2X4WA 4M7AD 4J9GA 1NYGA 1VQ4A 3URGA 3LX7A 4XTWA 1WJRA 3I9QA 4JJDA 3CCUA 2HQHA 2FG0A 4HKEA 1UJYA 1O9SA 1RI9A 1KC8U 1S1NA 2BZYA 2NUZA 3GLXA 1RLQC 2LCCA 1WA7A 1E6GA 1VQKA 1UECA 3SFMA 4BACA 4Z88A 1OULA 2VYTA 1X2KA 2RK1A 4CRIA 2E41A 3CPWS 2OTLA 4J9CA 2EGCA 1B34B 1OOTA 4LE9A 1UHCA 2LTOA 4J9IA 3N5BB 2C0OA 4M78D 1S72T 5FROA 3PVLA 3FIFA 2E70A 3CCJA 4KGVB 1NE8A 3CC7T 1Z9ZA 4M75D 3JCMc 2K79A 3CCMT 4XU3A 3OYYA 1N8RR 1VQLT 1AWJA 2DTOA 1MNDA 3IQLA 1UGSB 1KHIA 5GANg 5IHIA 4F17A 2YLBA 3VS5A 2JXBA 5GAMg 5L23A 1X6OA 3CMAA 1K76A 1VQOT 4OVAA 4AFSC 4C5GA 2LJ0A 3RMSA 1RL2A 3M53A 3AHUA 2M1HA 1QLYA 2SEMA 3G71T 3QG1A 5KE3A 1I5OB 2CSIA 2LX9A 1KQ2A 4MDXA 2F5TX 1ABQA 1SRLA 2KYMA 3NTIA 3CD6A 3G4SA 2MI6A 1AWXA 2DE0X 2FEIA 3PIPA 1VQ8A 4ZNXA 1VQPA 3QBYA 1UHFA 2CP6A 2EJ9A 2BZXA 2QDYB 1IRXA 3GPLA 1NEGA 1X01A 1PSEA 3CCVT 4OGCA 1N8RU 1ZQ1A 1Q7YU 1M4ZA 1VQ9Q 4N0AA 2A36A 2QGFB 2RHYA 4RKUE 1QW1A 4OMMA 1YCSB 5J39A 3JB9F 2E6ZA 1W2BS 2PQWA 2O01E 3CMEQ 1WYXA 3OYCA 4LD6A 1UE9A 3VS6A 4BE2A 1GL5A 2L3RA 3OYKA 5IH2A 2QAZA 1QCFA 1ZLMA 4RTVA 4ZGEB 3CCQA 4QW2A 2E5QA 4PJOD 1KD1R 3NTKA 2DXCA 4C8QA 2J6FA 1BIAA 5D7UA 4OB0B 2NYSA 3M0SA 2ENMA 1G3YA 3A8GB 1Q81C 3OBWA 3PT9A 5CR2A 2C0TA 2LDMA 1CKBA 1ZBJA 4Q5WA 4MZTA 4ZN1A 2F2XA 3FEOA 2FYKA 4M78G 1K4US 1BB9A 1Q86U 4X9DA 2YT6A 1PCXA 3X28B 1DJ7B 5EC7A 2H8HA 1UB4A 2CZ7B 3CXCP 4F04B 4M75G 3OSVA 2KGTA 3LWHA 4PK4A 1WXUA 1X43A 2EGAA 2ZPBB 1PD0A 3ZL7C 1EFNA 2CREA 4M77A 3QJYA 4A53A 4X9CA 2OX7A 9ATCB 4UC4A 3PTAA 2COYA 2E3HA 2ATCB 3CCLQ 1EIFA 4GY5A 1K8AR 3G1JA 1ZSZA 2LT4A 4C5EA 2D1XA 1IO6A 4JJCA 3I55T 1YJWQ 2PZ1A 1MGQA 1JO8A 4DEXA 4PFPA 1U3OA 1I4K1 4FW2A 1Y96B 1JJ2P 2QEXA 2E3IA 3I56A 4FM4B 3WVEB 1QQJA 3CC2Q 4J8OA 2O2OA 2HBWA 3OYNA 4OMQA 3CCRA 4AFQC 5GMKl 4FYWB 1K9MU 1NYFA 2DPPB 1NM7A 4J9EA 1VYUA 3RNJA 3EFRA 1YITQ 1KJWA 4LD9K 1Y57A 5FW9A 3JCMg 2AZSA 5CCAA
chains in the Genus database with same CATH topology
2RJDA 2Y4XA 3CXCA 4QQ6A 5HK3A 5FRNA 2MWOA 4PNOA 4XK8E 5LJ5h 1YITT 1B34A 3FJPA 3MCAB 4C0DB 4C8QF 4MMKA 3A5ZB 4M7AG 4RCBA 2K5IA 4XTYA 5KCOA 2I2LA 1U1SA 2BIVA 5GAN8 2E1HA 2BUDA 4MZMA 5CQXA 2VXFA 5I2MA 5C0MA 1Q86C 4PKCC 3DLMA 1M90C 4XQ3A 1BYMA 1K8AU 2JTFA 3H8ZA 3OY9A 2EWNA 2PVGB 3E9GA 2XDPA 2DEQA 4C8QD 3OYAA 4EMKC 3L2QA 2MAMA 3OB9A 2XHCA 5CKBA 1M1GA 2XU8A 2FVUA 3E1SA 2JUFA 4PL6A 3RIRA 4BY6C 1Y07A 2QQRA 4M7AC 3MO8A 2DIGA 2LQKA 1W4SA 2F69A 2A3LA 2RM4A 2WSFE 5GMKj 5GAN7 1VQ4T 1VUBA 2E10A 2LC4A 2RK2A 3CCUT 1QVFS 1UEBA 3L1AA 2H3JA 3X26B 4HT8A 2KY9A 1FXXA 4QVCA 3UDCA 3SWNB 2KDSA 3JCMJ 3QZ9B 4PJOG 3FRNA 3KXTA 2K57A 3VYGA 3S3MA 1G3SA 3CPFA 4E7HA 1W2BA 1JJ2A 2X4YA 4FT2A 5CK9A 3FDRA 4B9WA 1VQMA 4MMLA 2WSEE 4O6JA 2X35A 3HPWA 2OTJT 4OB2B 2DXTA 2JNGA 3QDRB 3VKIA 3MEWA 2HBPA 4BE1A 2VGNA 1VQKT 3TU4K 2ZPHB 4C0GA 4C8QE 2K5LA 2O4XB 4XTZA 1OZ2A 5CIUA 4J7IA 4HCBA 3QPHA 3CCEA 2XIDA 4JRKA 1BI3A 3C95A 4A4FA 4PJOC 5LJ5j 1YJ9A 4C92G 2DAQA 3QUIA 4CI0C 5HKCA 3ER0A 4M77F 3JCMf 2OTLT 3A8MB 3CEYA 3BDUA 5LJ3e 1XOVA 3HFOA 4B9XA 1BKBA 3DLLA 1YHQA 2XDDA 2PVDB 1N6AA 2QXFA 4E7LA 1OZ3A 4M78C 1K73U 2DVEA 3Q1JA 2EKOA 2EYQA 2CZ6B 5I2SA 3OMCA 3I55A 4ZTJA 1YIJA 3BW1A 3G6ET 2ZPFB 4JRIA 4M77D 4NS5A 3CCJT 4YTLA 3L2WA 3CCLA 1KD1U 4C0FA 1MHNA 5LJ3d 4C92C 2MMPA 4OB3B 1K9MC 3HHTB 4M75C 5J26A 4DQ2A 2DO3A 1JRIA 1YI2T 4EMGA 4OP0A 3HFNA 1QVFA 1YCYA 5CO7A 2HD0A 3HRSA 1BIBA 2RJCA 2D0QB 2HQXA 4A4EA 4XU2A 5DM7R 5GAN6 3M56A 1YHQT 1UGQB 3L2ZA 4M7DA 4M7DD 2RO0A 1FX7A 4J6YA 2EQKA 3KUFA 2K4YA 3PNWC 3P8DA 4Z02A 2GQVA 1NPPA 1N9RA 2JTMA 3OBYA 4A4KA 2DZ9A 4BD3A 5LJ5e 3JB9H 1WJSA 2GCXA 4FSXA 4LDWA 3OYEA 3WXMB 2NLUA 3MHXA 4OMFB 4TVRA 1WQ7A 1M5Q1 5I21A 2DK3A 2X4JA 3L2VA 1VQ9A 3CMAT 4F7UA 2M16A 1HK9A 2LT1A 4C0ZA 1UGPB 1AHJB 5GAN5 3MP6A 2VV5A 2ZPEB 5DY9A 3OMGA 1YBYA 5LJ5d 1YJWT 4M77E 1K8AC 2D6FA 4OGEA 1I5LA 3DB4A 5GAOr 3H6ZA 2IG0A 4WF2A 1JB0E 1G3WA 2M0OA 3TREA 5GAMj 1XQHA 4R55A 4MDWA 1YITA 3OYMA 3JCMP 3V7SA 2RJFA 3S3OA 3WVDB 2X4XA 3AHUA 3P8HA 4M7DE 1BI0A 4BE0A 2XKOC 1D3BA 3HRUA 4N4HA 3JCMX 2M9UA 3BDLA 3GF5A 3MP1A 2PU9B 3C94A 1VQ5T 3CD6T 3G4ST 2RH2A 5D6XA 3OYIA 3CC2T 4P5NA 3V8JA 2WSCE 3VUZA 4A4HA 3V8KA 1M1FA 2VXEA 4PJOA 4EMKA 2OAUA 4QVZA 2PVOB 2WACA 1VQPT 4IUTA 4F7UE 1Q82U 3JB9J 4M7AA 1NPRA 4XU1A 1IZ6A 2X4WA 5CVIA 4M7AD 1SSFA 4BDYA 4RG2A 4RMOA 2RHZA 4C0DC 3URGA 4EPCA 3OYHA 2A7YA 3LX7A 1VQ4A 5GANe 4PLLA 2EQMA 4XTWA 5FRMA 1WJRA 2P0QA 3CCUA 3J7AF 3V7CA 1WNLA 2GFAA 2K3XA 2IVWA 2XK0A 3QIIA 4BI8B 5GAMe 3OYBA 5KH6A 4J6XA 3NTHA 4HKEA 3P8BB 3DKMA 3MEVA 1Y7XA 1O9SA 2EFIA 3MEUA 4KULA 4N0AC 1VQ7A 1KC8U 4LDXA 4Y91A 4FL6A 2QA4A 3GP8A 2LQ8A 2XG8D 5LJ5g 1KHCA 2DXUA 2KAFA 4XTUA 5GANd 3GLXA 3QJ6A 4JS5A 3JB9D 4ZGJB 2LCCA 2OTJA 2P0PA 5FU6B 5GAMd 5L8RE 3E19A 1K73C 3INZA 1VQKA 3GIBA 3SFMA 4BACA 3BY7A 3JCMV 3T9NA 2E64A 3QXEB 3E9FA 4E7IA 2VYTA 1IREB 2MWPA 3CBMA 1VIFA 2K5FA 3GNFB 4C5HA 2CGHA 1KD1C 2RK1A 4M78F 2E41A 2KK4A 4CRIA 2EJGA 4EDUA 2Y4YA 3PIOA 3CPWS 4HCCA 4M7AE 4JRPA 3SWNC 4N4GA 2DTHA 2HQEA 1VQ7T 1KQSA 2OTLA 4XTVA 2QA4T 4C8QG 5A0DA 1B34B 3QKJA 2RB6A 3LGLA 5CKFA 1WGSA 2LTOA 4M75F 4RG8A 1FWZA 3ME9A 4M78A 2JVVA 1P92A 3N5BB 4J7FA 4M78D 4RCCA 4JJNK 4QQGA 2FB7A 5EG2A 2QQSA 1X75C 2GF7A 3LYIA 4J83A 2PUKB 4QQDA 2KMTA 5FROA 3X24B 3FIFA 3RKWA 2E70A 3OSSC 3G6EA 2XD0A 3CCJA 5C6SA 4C92A 1NE8A 3SB2A 4HCZA 4C8QB 4C92D 4NL3A 3CCQT 4E7KA 1M1KU 3CC7T 3OYFA 4M75A 5LJ3f 2E12A 4M75D 2R57A 3VJPA 4C8QC 3L2UA 4VUBA 3JCMc 5GMKe 3PGGA 1YI2A 3CCMT 4XU3A 2FHDA 3OYYA 1VQLT 3LGFA 4KUIA 5FU7B 3OYLA 2VUBA 4N4IA 3RKYA 4ZTFA 4OF1A 2DTOA 1UGSB 1KHIA 4MZPA 2RHUA 5GANg 1XTDA 2XDBA 4M7DF 1YJNT 3SD4A 2YLBA 5HY6A 2RD1A 3OYJA 5GAMg 4A54A 2ZPGB 1X6OA 2EIFA 2L8DA 3LLRA 3OS5A 3CMAA 5CAIA 3QZ5B 3DB3A 5CKHA 4XTXA 4M78E 2RJEA 1Y96A 1VQOT 2DD5A 2KVQG 4OB1B 3S3NA 4OVAA 3M9QA 1UGRB 1YJWA 5A0GA 2RI3A 1G3TA 4C5GA 2D9TA 2V8IA 3VU3C 3RMQA 5KE2A 5LJ5f 4F7UF 3A8OB 4C92E 3HKSA 3RMSA 2LCLA 1RL2A 3CPWA 3HP9A 3M53A 2EQUA 2G3RA 2M1HA 2QTXA 4J6WA 5D6YA 4M75E 3J80E 3OS2A 1KQ1A 4JRQA 1QVPA 3M4YA 3JSCA 3PMTA 5KCHA 3JB9I 3G71T 3QG1A 5KE3A 1WQWA 1BI2A 4M77G 2LX9A 3OW2S 1Q81U 2DTIA 5D6WA 2HAXA 4IUVA 4ZN3A 3V7RA 1KQ2A 1Y71A 4MDXA 4EMHA 3M4GA 2F5TX 2YRVA 1TH7A 4X34A 3NTIA 4IUPA 2DXBA 3CXCS 1VQ5A 3G4SA 3CD6A 2HNIA 2MI6A 3CC2A 4KT0E 4BUGA 3QHSA 2CZ1B 3CC4T 3PIPA 1VQ8A 4M7DG 4KBMB 4M77B 1VQPA 1KC8C 3QBYA 2EJ9A 5GAOp 1PSFA 2QDYB 2ZPIB 3TCJA 3GPLA 5GMKm 3L42A 4LDVA 3R6OA 5J3BA 1X01A 3QO3A 3VV0A 2CKKA 4D6WA 1U8RA 1PSEA 4FU6A 3CCVT 4ME7A 4OGCA 4ATOA 4M7AF 3M5AA 4M7DB 1QP2A 2V8JA 2RHIA 4F7UG 5GAOm 1N8RU 2P4TA 1ZQ1A 1Q7YU 1M4ZA 5IN1A 3NFCA 2KSSA 5LJ3h 4QVDA 2JZ2A 4N0AA 3JCMh 1VQ8T 1ZBXA 5DLQE 3QSUA 5A0LA 2K2VA 1U1TA 2DIQA 2L89A 3C12A 5LL6S 2JN0A 5IT9E 4DOVA 4ELZC 2RHYA 5GANf 4RKUE 4F7UB 1Q82C 1QW1A 2LNVA 3PFSA 5GAMf 2QQAA 2RHXA 4NOYA 2E6ZA 5J39A 2QEXT 2PQWA 4L6V5 1W2BS 1JJ2S 5GAN2 3JB9F 1R8OB 2O01E 3I56T 1NJIU 3OS0A 3UT1A 2QQBA 1M1KC 2ZGWA 3SWNA 1QVGS 3OYCA 4LD6A 4BE2A 1GXIE 2L3RA 4PJOF 3CCRT 3EFSA 2YLCA 1N27A 3OYKA 1VQ6T 3RERA 3RKXA 3OYGA 1D3BB 1VIEA 4JLIA 2V8KA 3ZEHA 1S72A 3X25B 5FU6C 5M9OA 5GAN4 3G7ZA 2B8AA 3M57A 2O4XA 3GNGA 1OI1A 4ZGEB 3CC7A 3CCQA 4JS4A 4QW2A 1VQNT 1XNIA 2E5QA 4HA8A 4EMKB 5GAOq 4PJOD 3KBGA 3NTKA 2DXCA 4C8QA 2RA2A 2CYZB 2R5AA 2AHJB 3ZFJA 4JLGA 1BIAA 4IURA 4BI4A 4BY6B 3M55A 3CCMA 4M7AB 1QP3A 4C92F 3J81E 1NZ9A 2EJFA 4OB0B 3EAEA 1N9SA 1VQLA 2CZ0B 2E6NA 3M59A 2KQWA 3JB9G 1M8VA 2VC8A 1LNXA 5CKEA 3PMIA 2P0KA 5LJ3j 3FB9A 3QYHB 3A8HB 4E7JA 1YJNA 4NL2A 3RUXA 1G3YA 3A8GB 3TEEA 3CCSA 3V8LA 5CKDA 4V2SA 3UPUA 2XI9A 4A4GA 3CBPA 3RESA 3OS1A 3OBWA 1Q81C 3FLGA 3PT9A 4IKFA 5CR2A 4DOWA 1BI1A 1VQOA 2LDMA 4L59A 3HRTA 1H641 3OYDA 3CMET 2VGMA 4Q5WA 1WJQA 4DA4A 3OA6A 4MZTA 4ZN1A 1QVGA 4PJOE 3JCMb 2MF2A 3FEOA 4ELYC 3L2RA 2FYKA 3QYGB 2R5MA 2BKDN 5FU7C 4M78G 3JAME 1Q86U 3LH0A 5GAOn 4X9DA 3VUBA 3G71A 2DJZA 3F70A 5DLOA 5GANh 2DD4A 3CCST 3X28B 3JCMW 4O5VA 1M90U 1DJ7B 3CBOA 3ZBDA 4PLIA 1UB4A 3MP8A 1LJOA 2CZ7B 5GAMh 5A2QE 5AYFA 4JUVA 1M9SA 1JBMA 4M75G 3OSVA 3JCMQ 3LWHA 3M54A 1N8RC 1Q7YC 1VQMT 1HXDA 4LDUA 4M78B 3JCMe 4BB7A 3CC4A 2JOYA 2ZPBB 4IUQA 3FC3A 2FL7A 2DZCA 3S6WA 4M77A 3QJYA 4C92B 4A53A 4X9CA 3CCET 2DKGA 2C06A 1LOJA 5CQYA 4M75B 2LRQA 1I81A 3A8LB 4UC4A 3PTAA 1YJ9T 3JCMd 4ZGDB 1I8FA 3CCVA 2R58A 4II1A 4FIBA 1EIFA 1OYXA 3BFMA 4C5IA 1RI0A 4FT4A 1NJIC 2K3YA 3ASKA 3HL8A 4GY5A 4IUUA 2LT4A 2ZZDA 3HSBA 4C5EA 3GOXA 5GMKi 1H3ZA 2CS7A 1YIJT 2YHTA 3I55T 5HK0A 1MGQA 4M77C 4LDYA 3CCLT 3M58A 3OQ5A 1V29B 2RI2A 3JRZA 2XICA 1I4K1 1Y96B 2RI5A 4E47A 2GFUA 1S72T 2QEXA 3O8VA 2EAYA 3META 1WPYA 3LWIA 3I56A 2ZCFB 5IAYA 5GMKh 4M7DC 2QQ9A 5GANj 2L5QA 5FLXE 4FM4B 4GLKA 2F5KA 3WVEB 4L5GA 4JDSA 3X20B 4J5YA 4J8OA 3OYNA 1ZHIA 4Y28E 3CCRA 3LW5E 2EQJA 4XAXB 1VQ6A 2Y90A 4HT9A 4PJOB 4BDZA 5GMKl 3UWNA 1K9MU 3CMEA 3MEAA 1G5VA 3VYHB 2DPPB 2LVMA 1VQ9T 1KQSS 3EFRA 3SDZA 4BI3A 4LD9K 4XU0A 1VQNA 3C4SA 5GAOl 4KUDK 5GAN3 5LJ3g 3OW2A 1O75A 4R56A 2E65A 2QI2A 3JCMg 5CCAA 1KG1A 2PUOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LNX A;  5DY9 A;  4A54 A;  5LJ5 d;  5LJ3 j;  5GAM g;  4M77 E;  3FB9 A;  5CAI A;  1I5L A;  4PNO A;  5LJ5 h;  4XTX A;  5GAO r;  4M78 E;  1B34 A;  3FJP A;  1Y96 A;  4NL2 A;  4WF2 A;  3RUX A;  4C8Q F;  4MMK A;  1M8V A;  3V8L A;  4V2S A;  4M7A G;  5GAM j;  4RCB A;  3QSU A;  4XTY A;  3RES A;  2I2L A;  1U1S A;  5GAN 8;  2E1H A;  2VXF A;  3VU3 C;  5LJ5 f;  3V7S A;  3JCM P;  4F7U F;  4C92 E;  4XQ3 A;  4J6W A;  3AHU A;  2QTX A;  4M7D E;  1H64 1;  4M75 E;  2EWN A;  1D3B A;  1KQ1 A;  3JCM X;  2DEQ A;  3JB9 I;  4C8Q D;  4EMK C;  4PJO E;  3JCM b;  1WQW A;  4M77 G;  2DTI A;  2FYK A;  3V7R A;  1KQ2 A;  3V8J A;  4M78 G;  3RIR A;  3V8K A;  2VXE A;  4X9D A;  3M4G A;  2DJZ A;  5GAO n;  4EMK A;  5GAN h;  1TH7 A;  3JCM W;  4M7A C;  4PJO B;  2RM4 A;  5GMK j;  5GAN 7;  2HNI A;  4F7U E;  5GAM h;  1LJO A;  2E10 A;  3QHS A;  3JB9 J;  4M7A A;  4JUV A;  3L1A A;  4XU1 A;  4HT8 A;  4M7A D;  4M7D G;  4QVC A;  1JBM A;  4M75 G;  4M77 B;  3SWN B;  3JCM Q;  3JCM J;  5GAN e;  1HXD A;  4M78 B;  2EJ9 A;  4XTW A;  3JCM e;  5GAO p;  4PJO G;  2K57 A;  3V7C A;  1WNL A;  5GMK m;  5GAM e;  2DZC A;  4J6X A;  1X01 A;  3QO3 A;  4MML A;  4M77 A;  4C92 B;  4N0A C;  4X9C A;  4A53 A;  2DKG A;  4M7A F;  4M7D B;  1LOJ A;  2DXT A;  4M75 B;  4Y91 A;  4F7U G;  5GAO m;  1I81 A;  5LJ5 g;  4C8Q E;  2DXU A;  4XTU A;  5LJ3 h;  3JCM d;  4QVD A;  4XTZ A;  1I8F A;  5GAN d;  3JB9 D;  4N0A A;  3JCM h;  4JRK A;  5GAM d;  3BFM A;  3INZ A;  4PJO C;  3GIB A;  5LJ5 j;  1U1T A;  4C92 G;  3BY7 A;  3QUI A;  3JCM V;  2E64 A;  2JN0 A;  4M77 F;  5GAN f;  3JCM f;  3HSB A;  4F7U B;  3BDU A;  5GMK i;  2CGH A;  5LJ3 e;  3HFO A;  4M78 F;  2E41 A;  4PJO A;  2EJG A;  2YHT A;  4M7A E;  5GAM f;  1MGQ A;  4M77 C;  4NOY A;  3SWN C;  5GAN 5;  3JB9 F;  2DTH A;  5GAN 2;  4M78 C;  2DVE A;  4XTV A;  4C8Q G;  1B34 B;  1I4K 1;  1Y96 B;  2RB6 A;  2ZGW A;  3SWN A;  3BW1 A;  4JRI A;  4M77 D;  2EAY A;  4M75 F;  4M78 A;  1WPY A;  4M78 D;  5LJ3 d;  4RCC A;  4C92 C;  2FB7 A;  5GMK h;  4M7D C;  4PJO F;  4M75 C;  5GAN j;  3EFS A;  2YLC A;  3FIF A;  3RKW A;  4DQ2 A;  1JRI A;  3RER A;  3RKX A;  4OP0 A;  4EMG A;  3HFN A;  1D3B B;  1YCY A;  4C92 A;  4JLI A;  3SB2 A;  4C8Q B;  1BIB A;  4C92 D;  4NL3 A;  2VC8 A;  4J5Y A;  4XU2 A;  5GAN 6;  4M7D A;  4M75 A;  3L2Z A;  5GAN 4;  5LJ3 f;  4M7D D;  4M75 D;  4J6Y A;  4C8Q C;  3JCM c;  2Y90 A;  3PGG A;  5GMK e;  4HT9 A;  5GMK l;  4XU3 A;  1N9R A;  5LJ5 e;  3JB9 H;  2DZ9 A;  4PJO D;  4EMK B;  4HA8 A;  5GAO q;  4C8Q A;  2RA2 A;  3EFR A;  1BIA A;  1WQ7 A;  1M5Q 1;  3RKY A;  4XU0 A;  5I21 A;  5GAO l;  2DTO A;  4M7A B;  5GAN 3;  5LJ3 g;  4C92 F;  2EJF A;  4F7U A;  1N9S A;  2E65 A;  1HK9 A;  3JCM g;  5GAN g;  4M7D F;  2YLB A;  3JB9 G;  2RD1 A;  4EMH A; 
#chains in the Genus database with same CATH topology
 3A98 A;  4QQ6 A;  2EW3 A;  4PNO A;  1B34 A;  3FJP A;  2K5I A;  5CQX A;  2VXF A;  1SHF A;  1K8A U;  2JTF A;  3H8Z A;  3OY9 A;  2X3W D;  1T0H A;  1D1A A;  1OQK A;  2E4H A;  1M3B A;  3R6N A;  4EMK C;  3L2Q A;  2MAM A;  3I35 A;  3OB9 A;  5CKB A;  3CCU Q;  4FYX B;  2JUF A;  3PVQ A;  1Y07 A;  1X2Q A;  4M7A C;  2A28 A;  2LQK A;  2F69 A;  2A3L A;  2E5K A;  5GAN 7;  1NLO C;  1QCO A;  2E10 A;  2RK2 A;  2HKN A;  1PNJ A;  2JMA A;  2H3J A;  4QVC A;  4LUE A;  3SWN B;  1X6G A;  2KDS A;  1VQK Q;  2YUN A;  1JQQ A;  4PJO G;  3S3M A;  1FMW A;  1W2B A;  4E2F B;  4FT2 A;  3H0I A;  2X35 A;  1T0J A;  2EPD A;  1MNE A;  2OTL Q;  3MEW A;  1ARK A;  2VGN A;  4HCB A;  2ZAE A;  3VS2 A;  2DL4 A;  4C92 G;  2DAQ A;  1RUW A;  5HKC A;  3ER0 A;  2G6F X;  3EGU A;  3HFO A;  1B7T A;  2PVD B;  1ZSG A;  4M78 C;  2DVE A;  2EYQ A;  1UG1 A;  3G6E T;  1TUC A;  2J06 A;  1MHN A;  2AZV A;  4M75 C;  4JZ3 A;  1YHQ T;  3CMA Q;  4J6Y A;  4LN2 A;  2K4Y A;  3P8D A;  2GQV A;  2JTM A;  5LJ5 e;  3OBY A;  1E6H A;  3WXM B;  4OMF B;  1K9A A;  3CC4 Q;  1OU9 A;  1PM3 A;  1WZO A;  4PJL A;  2X4J A;  1VQ9 A;  4B6M A;  2M16 A;  2DL3 A;  2LT1 A;  2CP0 A;  1IB8 A;  4C0Z A;  2OJ2 A;  2ZPE B;  1YBY A;  4OGE A;  1W70 A;  5GAO r;  1IHW A;  1WI7 A;  4WF2 A;  1JB0 E;  1WLP B;  3CD6 Q;  5GAM j;  3G4S Q;  2B86 A;  2RJF A;  3WVD B;  1VQ8 Q;  2DET A;  2XKO C;  3HRU A;  3JCM X;  2PU9 B;  2WSC E;  3H9N A;  3M0P A;  4QVZ A;  2PVO B;  2Z0W A;  4IUT A;  4XU1 A;  1SSF A;  4BDY A;  2C0I A;  2P0Q A;  3TSZ A;  2P4R A;  3V7C A;  2GFA A;  3QII A;  4J6X A;  1G8X A;  1SRM A;  3P8B B;  3DKM A;  2LNH B;  1R0C B;  3MEU A;  4KUL A;  2CP3 A;  4Y91 A;  1IHV A;  1VQN Q;  2LQ8 A;  2XG8 D;  2DXU A;  2KAF A;  4XTU A;  4JS5 A;  2OTJ A;  4FYV B;  5FU6 B;  3E19 A;  3INZ A;  3GIB A;  2COW A;  4AFZ C;  3EGD B;  3BY7 A;  3T9N A;  3E9F A;  2MWP A;  1VIF A;  1KD1 C;  4M78 F;  3TQ7 P;  4HCC A;  3PIO A;  4N4G A;  2DTH A;  1VQ7 T;  2QA4 T;  5A0D A;  3CCQ Q;  4DEY A;  3LGL A;  5CKF A;  3SEM A;  3I5S A;  4M75 F;  2YSQ A;  1FWZ A;  3ME9 A;  4JJN K;  2JVV A;  2F1L A;  2QQS A;  3X24 B;  1VA7 A;  1G5V A;  4Y92 A;  5C6S A;  1PRM C;  3SB2 A;  4C8Q B;  2DBK A;  3OYF A;  2ED1 A;  3L2U A;  2KT8 A;  4VUB A;  1D0X A;  1R0B G;  3LGF A;  1KIK A;  4KUI A;  5FU7 B;  1KSW A;  1VQM Q;  4M7D F;  3SD4 A;  2RD1 A;  2EIF A;  3LLR A;  2RNA A;  1Y96 A;  2KVQ G;  3M9Q A;  1YJW A;  5AT1 B;  1G3T A;  4J9F A;  2D9T A;  2KXD A;  5KE2 A;  5LJ5 f;  4F7U F;  3HKS A;  2LCL A;  4J6W A;  1PKT A;  2EQU A;  3OS2 A;  2GTJ A;  3VS0 A;  4JRQ A;  1QVP A;  3M4Y A;  5KCH A;  4A63 B;  1WHM A;  1BBZ A;  1WQW A;  1BI2 A;  1Q81 U;  3OW2 S;  5D6W A;  3V7R A;  4RTT A;  2CT3 A;  3M4G A;  4X34 A;  3CC2 A;  1AZG B;  1FMK A;  3QDF A;  3RBB B;  1W1F A;  1WDX A;  4M77 B;  4ORZ A;  1BU1 A;  5GAO p;  2GTO A;  1WHG A;  1M2O A;  3VV0 A;  1U8R A;  2FRY A;  2CP7 A;  1ZA1 B;  4M7D B;  1QP2 A;  4J9D A;  5GAO m;  2P4T A;  2NUT B;  3JCM h;  1ZBX A;  2DIQ A;  2AK5 A;  5LL6 S;  2JN0 A;  4DOV A;  2J6O A;  1Q82 C;  4F7U B;  2FPD A;  3CCR Q;  1UDL A;  5GAN 2;  2DEU A;  1OPL A;  3OS0 A;  3UT1 A;  3CPW P;  3SWN A;  1RAB B;  1V76 A;  4M4Z A;  4PJO F;  4HCK A;  2YLC A;  1N27 A;  2HZY A;  1VQ6 T;  2DF6 A;  3RKX A;  4DBR A;  4JLI A;  2J7I A;  1K73 R;  3X25 B;  5M9O A;  5GAN 4;  3G7Z A;  3REB B;  1H92 A;  4E6R A;  1OI1 A;  1XNI A;  5GAO q;  3KBG A;  1PC0 A;  3ZFJ A;  2R5A A;  4BI4 A;  4JLG A;  4ANJ A;  2KR3 A;  4C92 F;  3J81 E;  2CZ0 B;  2KQW A;  1M8V A;  3HTR A;  5CKE A;  2P0K A;  1YWO A;  2CP5 A;  2DRM A;  1YJN A;  4NL2 A;  3RUX A;  3V8L A;  3CBP A;  3RES A;  4DOW A;  1TTH B;  4L59 A;  3HRT A;  1H64 1;  3OYD A;  2RN8 A;  2HEQ A;  1QVG A;  1I1J A;  1VOM A;  4ELY C;  3L2R A;  3JAM E;  3LH0 A;  3VUB A;  2DMO A;  3CCS T;  5DLO A;  2L3P A;  3JCM W;  2GBQ A;  2RQR A;  4PJO B;  1SEM A;  5IHK A;  3ZBD A;  2K7A A;  4OMO A;  4JUV A;  1YN8 A;  3TSW A;  1HXD A;  3CC4 A;  1Y0M A;  2FL7 A;  2DZC A;  1UUE A;  4C92 B;  1LOJ A;  4RTU A;  1I81 A;  4KGX B;  2LQW A;  2W0Z A;  1I8F A;  1GBR A;  3UA6 A;  2R58 A;  1TOV A;  4FIB A;  1TU0 B;  3BFM A;  1W6X A;  2K3Y A;  3HL8 A;  2QAS A;  2ZZD A;  5GJV B;  5GMK i;  3RDV A;  1YIJ T;  3KFV A;  3MJX A;  5HK0 A;  3CCL T;  2PNI A;  1GBQ A;  1W2B P;  2VAS A;  3O8V A;  2QQ9 A;  4GLK A;  1VQ5 Q;  4L5G A;  4JDS A;  2JW4 A;  1IGU A;  3CQT A;  1PRL C;  4BDZ A;  3UWN A;  3MEA A;  2EYX A;  3VYH B;  1KQS S;  1WXB A;  1U5S A;  3EGD A;  4D8D A;  5KYX B;  1VQN A;  4KUD K;  1GFD A;  5GAN 3;  3OW2 A;  1UGV A;  4R56 A;  1WFW A;  2E65 A;  1SSH A;  5FRN A;  4XK8 E;  1YIT T;  2JTE A;  1GCQ A;  4M7A G;  3QSU A;  2I2L A;  4OMN A;  5GAN 8;  2E1H A;  1K1Z A;  5I2M A;  3UF4 A;  5C0M A;  2KEA A;  1WHL A;  1M90 C;  1PHT A;  3EG1 A;  2EWN A;  3E9G A;  2XDP A;  2DEQ A;  4LNP A;  3OYA A;  4JZ4 A;  2FVU A;  4BY6 C;  2DIG A;  1W4S A;  2CDT A;  4WCI A;  1VQ4 T;  1I0C A;  1VUB A;  3CCU T;  4HT8 A;  1R77 A;  2OTJ Q;  2L3Q A;  3UDC A;  1S72 Q;  2K57 A;  4E7H A;  1VQM A;  2EYY A;  2RQW A;  2HSP A;  1BCM A;  2JNG A;  4BE1 A;  2HBP A;  1VQK T;  2ZPH B;  4C8Q E;  4XTZ A;  1VQL Q;  1OZ2 A;  2LCS A;  3VS3 A;  2HMA A;  3CCE A;  4JRK A;  1YJ9 A;  4CI0 C;  3VS4 A;  2CUB A;  2F2W A;  1WXT A;  2OTL T;  3VS1 A;  1YHQ A;  1KK7 A;  1N6A A;  2QXF A;  1AZE A;  1OZ3 A;  1PG5 B;  4E7Z A;  1VQO Q;  2LZ6 B;  4JRI A;  4NS5 A;  3CCJ T;  4YTL A;  1KD1 U;  5LJ3 d;  1UFF A;  2COZ A;  5J26 A;  4J9H A;  1HSQ A;  4CC7 A;  1QVF A;  3NMZ C;  1YCY A;  5CO7 A;  2FO0 A;  2A0F B;  4M7D A;  3M56 A;  3LH5 A;  1NJI R;  1D1C A;  3EG0 A;  2NUT A;  4Z02 A;  4X1V A;  1N9R A;  4BD3 A;  1WJS A;  2OAW A;  1M5Q 1;  1PWT A;  3CMA T;  4F7U A;  1HK9 A;  1C0M A;  1AHJ B;  2JJ9 A;  5GAN 5;  2VV5 A;  4M77 E;  4RTZ A;  3DB4 A;  2IG0 A;  3CCV Q;  1G3W A;  2M0O A;  3TRE A;  1XQH A;  4MDW A;  1TWB A;  2D8H A;  3S3O A;  4M7D E;  1Q82 R;  4BE0 A;  2ESW A;  4EIK A;  1RAH B;  3GF5 A;  3CD6 T;  4RTY A;  3G4S T;  3V8J A;  3VUZ A;  4A4H A;  3V8K A;  2DFU A;  1M1F A;  2VXE A;  4FW1 A;  2WAC A;  1VQP T;  4F7U E;  4RG2 A;  4C0D C;  4PLL A;  1BCO A;  1NG2 A;  1IXD A;  1HYO A;  4BI8 B;  1WNL A;  3C0C A;  1C6V X;  2IVW A;  2XK0 A;  3OYB A;  5KH6 A;  4AMC A;  2RF0 A;  3NTH A;  1SF9 A;  1Y7X A;  1VQ7 A;  2EFI A;  4N0A C;  4FL6 A;  2QA4 A;  3GP8 A;  2QDL A;  2FZC B;  5LJ5 g;  1KHC A;  1TS9 A;  5GAN d;  1G2B A;  3JB9 D;  1YP5 A;  2V1R A;  5GAM d;  3EG9 B;  1K73 C;  2DYB A;  1NLP C;  2E64 A;  3QXE B;  1MMA A;  3GNF B;  4PJO A;  4EDU A;  3MKD A;  1OPK A;  2EJG A;  2Y4Y A;  1KQS A;  2HCK A;  1SG5 A;  3QKJ A;  5KYN A;  2J05 A;  1WGS A;  1Q82 U;  4RCC A;  4QQG A;  2FB7 A;  5EG2 A;  3LYI A;  4J83 A;  2PUK B;  2KMT A;  2XD0 A;  3QWY A;  1HD3 A;  3OSS C;  2VWF A;  2OI3 A;  4C92 A;  3CCQ T;  4C8Q C;  2R57 A;  1YI2 A;  2CH4 W;  1YJN Q;  5GMK e;  2FHD A;  4IIO A;  1X69 A;  1V1C A;  2LJ3 A;  2VUB A;  4N4I A;  4PFO A;  4Z8A A;  3RKY A;  4OF1 A;  4ZTF A;  4MZP A;  2MOX A;  2RHU A;  1XTD A;  5HY6 A;  3OYJ A;  2ZPG B;  2L8D A;  4AFU C;  2KYB A;  4XTX A;  2K2M A;  2RJE A;  4OB1 B;  1GRI A;  2IIM A;  1F1B B;  2RI3 A;  3A8O B;  4C92 E;  1JXM A;  5D6Y A;  2D0N A;  5FWB A;  3JB9 I;  2M0Y A;  2DTI A;  4IUV A;  4ZN3 A;  7AT1 B;  1Y71 A;  3I55 Q;  1NBE B;  2YRV A;  1OV3 A;  4IUP A;  1VQ5 A;  2HNI A;  1FYN A;  4KT0 E;  2RQV A;  5KYX A;  2KRO A;  4KBM B;  4DBH A;  3M0U A;  4GLM A;  1PSF A;  2ZPI B;  2EBP A;  2KT1 A;  3L42 A;  4LDV A;  5GMK m;  3R6O A;  5J3B A;  4ATO A;  4M7A F;  2KI7 A;  2FZG B;  4AT1 B;  2KSS A;  1ZSZ C;  2JZ2 A;  3EFO B;  5A0L A;  2K2V A;  3NHN A;  2L89 A;  3EG2 A;  2M02 A;  5IT9 E;  2LNV A;  5HCK A;  4CC3 A;  3PFS A;  2J6K A;  2QQA A;  2LQN A;  4NOY A;  2QEX T;  2HL5 C;  1ABO A;  2O88 A;  3I56 T;  1M90 R;  4JPB W;  1M1K C;  2ZGW A;  2L3S A;  3I5R A;  1QVG S;  1GXI E;  3A1P A;  3CCR T;  3OYG A;  1RAF B;  1WIE A;  4RTW A;  3ZEH A;  1S72 A;  2YUQ A;  2QTV A;  3M57 A;  1AOJ A;  3CC7 A;  4JS4 A;  4EMK B;  1M8M A;  4HA8 A;  1AVZ C;  2RA2 A;  2CYZ B;  4IUR A;  3CCM A;  3M55 A;  4M7A B;  1QP3 A;  1VQL A;  3EAE A;  1N9S A;  3EHQ A;  2DYI A;  2E6N A;  3M59 A;  3JB9 G;  1BK2 A;  1LNX A;  3PMI A;  1MMG A;  3QYH B;  3CCS A;  5CKD A;  4V2S A;  2MIO A;  3FLG A;  2DM1 A;  1VQO A;  1BI1 A;  2YUO A;  2L0A A;  4FSS A;  1WJQ A;  4DA4 A;  2BTT A;  2EVR A;  2HDA A;  3JCM b;  2MF2 A;  3QWX X;  2L2P A;  2BKD N;  2R5M A;  3G71 A;  3F70 A;  1M90 U;  4O5V A;  3OW2 P;  3CBO A;  2NUP A;  1I07 A;  4PLI A;  5A2Q E;  1LJO A;  3G6E Q;  3CCE Q;  1JBM A;  1VYT A;  3JCM Q;  4LDU A;  4M78 B;  1YJ9 Q;  2EKH A;  2D8J A;  3S6W A;  1YHQ Q;  2DKG A;  4M75 B;  3A8L B;  3JCM d;  6AT1 B;  4R0K A;  2DLP A;  3CCV A;  4II1 A;  1OYX A;  5KYW B;  1RI0 A;  4FT4 A;  1NJI C;  4IUU A;  1WHK A;  2CS7 A;  5ECA A;  1XJW B;  3OQ5 A;  3PE0 A;  2RI2 A;  3JRZ A;  3UAT A;  2XIC A;  3EGX A;  4E47 A;  3MET A;  1WPY A;  4AG1 C;  5IAY A;  5GMK h;  2L5Q A;  5FLX E;  2ABL A;  2MPX C;  4F14 A;  2NWM A;  1ZHI A;  1RAC B;  2EQJ A;  4XAX B;  1RAG B;  2JT4 A;  2Y90 A;  4HT9 A;  2LX7 A;  2DL5 A;  1VQ9 T;  2KE9 A;  3EG9 A;  2MYS A;  1WHJ A;  4BI3 A;  4DBF A;  5LJ3 g;  2QI2 A;  1QWE A;  2JS2 A;  1RAE B;  2FZK B;  4EMH A;  1B07 A;  1D0Z A;  2YRC A;  5HK3 A;  5LJ5 h;  3SHW A;  3A5Z B;  3CME T;  4AG2 C;  1U1S A;  2BIV A;  2KRS A;  3M0T A;  2BUD A;  4MZM A;  1QVF P;  4PKC C;  4XQ3 A;  1BYM A;  1T3S A;  2ECZ A;  2K6D A;  4C8Q D;  1TXQ A;  1M1G A;  2XU8 A;  4PJM A;  4PL6 A;  2QQR A;  1JXO A;  2WSF E;  1VQ7 Q;  2RM4 A;  2P84 A;  5GMK j;  1NEB A;  2QA4 Q;  2QG9 B;  1QVF S;  1UEB A;  3L1A A;  3X26 B;  2KY9 A;  1FXX A;  1OX8 A;  4K11 A;  3QZ9 B;  3KXT A;  3VYG A;  3CPF A;  2AKL A;  2X4Y A;  2DL7 A;  4KGZ B;  3FDR A;  3U23 A;  2KXC A;  4B9W A;  4MML A;  3HPW A;  2OTJ T;  2DXT A;  3QDR B;  3VKI A;  3TU4 K;  2XMF A;  2K5L A;  2O4X B;  5CIU A;  1RAD B;  4J7I A;  1BI3 A;  3C95 A;  4WTO B;  5LJ5 j;  2YWW A;  3QUI A;  3A8M B;  3CEY A;  3BDU A;  5LJ3 e;  4B9X A;  3VRY A;  1BKB A;  2RPN A;  1Q7Y R;  3H0H A;  1YI2 Q;  3O5Z A;  1K73 U;  3Q1J A;  2ROL A;  5I2S A;  3OMC A;  3I55 A;  4KH0 B;  3BW1 A;  1T3L A;  4M77 D;  3L2W A;  2VKN A;  1QCN A;  4OB3 B;  3HHT B;  4DQ2 A;  2DO3 A;  1JRI A;  3HFN A;  1A0N B;  2HD0 A;  5DM7 R;  5GAN 6;  4M7D D;  1M30 A;  2RO0 A;  2EQK A;  3KUF A;  4HVV A;  1ZUU A;  1NPP A;  2FPE A;  3NGP A;  2DZ9 A;  4A4K A;  3EFO A;  2FRW A;  2NLU A;  4TVR A;  2GGR A;  2AKK A;  5I21 A;  2DK3 A;  3L2V A;  2H3E B;  1KQS P;  1M2V B;  5DY9 A;  3OMG A;  1YJW T;  2D6F A;  1I5L A;  1TG0 A;  1J3T A;  1MMD A;  3JV3 A;  3EH1 A;  4R55 A;  2K9G A;  3V7S A;  2X4X A;  1BI0 A;  4N4H A;  1M3A A;  2M9U A;  2RH2 A;  5D6X A;  3OYI A;  3CC2 T;  4KH1 B;  1M1K R;  4EMK A;  4OMP A;  1MMN A;  2OAU A;  4KRT A;  3JB9 J;  4M7A A;  4RMO A;  1GFC A;  2RHZ A;  4EPC A;  3OYH A;  2A7Y A;  1RAA B;  5GAN e;  2EQM A;  1SPK A;  2GNC A;  2AIR B;  5FRM A;  2MK5 A;  3J7A F;  1Q86 R;  1VQ6 Q;  2K3X A;  1JEG A;  5GAM e;  3MEV A;  4LDX A;  2JMC A;  1KFZ A;  3QJ6 A;  2CSQ A;  4ZGJ B;  2LMJ A;  2P0P A;  5L8R E;  3JCM V;  4E7I A;  1IRE B;  3CBM A;  2K5F A;  4C5H A;  2CGH A;  2KK4 A;  3EHR A;  2YXY A;  4M7A E;  2DNU A;  3SWN C;  4JRP A;  2JM9 A;  3UA7 A;  2CT4 A;  2HQE A;  2X9H A;  4XTV A;  4C8Q G;  3CC7 Q;  2RB6 A;  5I22 A;  1TUD A;  2X51 A;  4RG8 A;  4M78 A;  1P92 A;  2KNB B;  4J7F A;  1WX6 A;  3CCM Q;  1X75 C;  4QQD A;  2GF7 A;  2EYZ A;  1LCK A;  3G6E A;  3RKW A;  4NL3 A;  1ZUK A;  3FJ5 A;  4HCZ A;  4C92 D;  4E7K A;  1M1K U;  5KYU B;  1QKX A;  4M75 A;  5IXF A;  5LJ3 f;  2E12 A;  3VJP A;  1EZZ B;  4D8K A;  3CCS Q;  3PGG A;  2DL8 A;  2DJQ A;  5KYW A;  1OX9 A;  3OYL A;  4F16 A;  1ZA2 B;  2CUD A;  2QGG A;  2XDB A;  2A37 A;  1YJN T;  2O31 A;  4GBQ A;  2GQI A;  1CSK A;  4A54 A;  3H41 A;  3OS5 A;  5CAI A;  3QZ5 B;  3EH2 A;  3DB3 A;  3H0F A;  4PFZ A;  5CKH A;  4M78 E;  1K9M R;  3G71 Q;  2DD5 A;  3S3N A;  1UGR B;  5A0G A;  1FMV A;  4QKU A;  2V8I A;  3VU3 C;  3RMQ A;  4HVW A;  3CPW A;  1AT1 B;  3HP9 A;  2G3R A;  2QTX A;  4M75 E;  3J80 E;  1H3H A;  1KQ1 A;  3PMT A;  2I0N A;  3JSC A;  2NUP B;  1M3C A;  4M77 G;  2HAX A;  1YIJ Q;  4FCY A;  2PTK A;  1TH7 A;  2DXB A;  3CXC S;  2BE9 B;  2ED0 A;  2DIL A;  4BUG A;  3QHS A;  1SKU B;  2CZ1 B;  3CC4 T;  4M7D G;  2F2V A;  5KYY B;  1KC8 C;  4HVU A;  4ESR A;  3TCJ A;  2VVK A;  3QO3 A;  2CKK A;  4D6W A;  4FU6 A;  4ME7 A;  3VS7 A;  3M5A A;  2V8J A;  4F7U G;  2RHI A;  2BE7 D;  3RR6 A;  5IN1 A;  1QKW A;  3NFC A;  5LJ3 h;  4QVD A;  1VQ8 T;  5DLQ E;  1U1T A;  3C12 A;  2LJ1 A;  4ELZ C;  5GAN f;  3EGX B;  5GAM f;  2RHX A;  1JJ2 S;  2O9V A;  4L6V 5;  1R8O B;  3M0Q A;  1LPL A;  1NJI U;  2QQB A;  2HL3 A;  2QYZ A;  3EFS A;  2KBT A;  3RER A;  1D3B B;  1VIE A;  2V8K A;  1CKA A;  5FU6 C;  1IGQ A;  2B8A A;  1SHG A;  2O4X A;  3GNG A;  1VQN T;  1VQ4 Q;  3GBQ A;  2AHJ B;  1YNZ A;  4BY6 B;  4FYY B;  1OU8 A;  1NZ9 A;  2EJF A;  3REA B;  1AEY A;  3THK A;  2VC8 A;  1GCQ C;  5LJ3 j;  3FB9 A;  3A8H B;  4LUD A;  4E7J A;  1G83 A;  1M27 C;  4RUG A;  3TEE A;  2O9S A;  3UPU A;  2XI9 A;  4A4G A;  3OS1 A;  3TVT A;  4IKF A;  2VGM A;  2X3X D;  3OA6 A;  2KRN A;  1HJD A;  1JU5 C;  4PJO E;  3QYG B;  1VYV A;  5FU7 C;  2EGE A;  1D1B A;  5GAO n;  2DJZ A;  5GAN h;  2DD4 A;  3MP8 A;  5GAM h;  2W10 A;  2RMO A;  5AYF A;  1MV3 A;  1QMC A;  1M9S A;  2HKQ B;  3CCJ Q;  1M2V A;  3M54 A;  1N8R C;  1Q7Y C;  1VQM T;  3JCM e;  4BB7 A;  1MUZ A;  2JOY A;  4IUQ A;  3FC3 A;  4JJB A;  1H8K A;  3CCE T;  2V26 A;  2C06 A;  5CQY A;  2LRQ A;  1YJ9 T;  4ZGD B;  3E2U A;  2K3B A;  1UJ0 A;  4C5I A;  4Z89 A;  3ASK A;  3M0R A;  4PJN A;  4J9B A;  3HSB A;  3ULR B;  3GOX A;  1H3Z A;  8AT1 B;  2YHT A;  3AT1 B;  4M77 C;  4LDY A;  2DRK A;  3M58 A;  1K0S A;  1V29 B;  1LVK A;  1D0Y A;  3VRZ A;  3MPU B;  1K0X A;  2RQU A;  2RI5 A;  2GFU A;  2EAY A;  1QWF A;  3LWI A;  2ZCF B;  4QT7 A;  2FPF A;  1QVG P;  4M7D C;  5GAN j;  2YUP A;  2F5K A;  1C1A A;  4J5Y A;  3X20 B;  1D09 B;  3NPF A;  4Y28 E;  2IPO B;  3LW5 E;  1VQ6 A;  2KRM A;  2HSE B;  3CME A;  1VQP Q;  2LVM A;  1ZUY A;  1TSF A;  3SDZ A;  4XU0 A;  3C4S A;  5GAO l;  1UTI A;  1O75 A;  1KG1 A;  2PUO B;  2RJD A;  1ACM B;  2Y4X A;  3CXC A;  5IXB A;  2MWO A;  2EQI A;  3MCA B;  4C0D B;  1PKS A;  2M51 A;  4C8Q F;  4MMK A;  2VB6 A;  2MCN A;  2EYW A;  4RCB A;  5KCO A;  4XTY A;  1MV0 B;  1Q86 C;  1AWO A;  3DLM A;  2PVG B;  2JM8 A;  5KYU A;  2XHC A;  2A08 A;  4RTX A;  1YWP A;  3E1S A;  3RIR A;  3MO8 A;  1N5Z A;  1AD5 A;  1B3Q A;  2LC4 A;  2YDL A;  3EG3 A;  3JCM J;  2JS0 A;  1Q81 R;  5FWC A;  3FRN A;  1JJ2 A;  1G3S A;  2CP2 A;  2CH4 A;  5CK9 A;  2WSE E;  1U06 A;  4O6J A;  4OB2 B;  1Q95 G;  1RAI B;  2ROT A;  4C0G A;  1X27 A;  2AT1 B;  4HXJ A;  3QPH A;  2XID A;  2BZ8 A;  5IHN A;  4A4F A;  4PJO C;  4M77 F;  3JCM f;  1XOV A;  3DLL A;  2XDD A;  4E7L A;  4PJJ A;  2EKO A;  2RQT A;  2CZ6 B;  1YIJ A;  4ZTJ A;  5KYY A;  2ZPF B;  3CCL A;  4C0F A;  4C92 C;  2YRD A;  2MMP A;  1K9M C;  1YI2 T;  4EMG A;  1EX4 A;  4OP0 A;  1TUG B;  3HRS A;  1BIB A;  2RJC A;  2D0Q B;  2HQX A;  4A4E A;  4XU2 A;  4E7S A;  1UGQ B;  3L2Z A;  1GCP A;  3BE3 A;  1FX7 A;  4DBQ A;  8ATC B;  3PNW C;  3JB9 H;  1KC8 R;  2QK0 A;  2GCX A;  4FSX A;  1WHH A;  4LDW A;  3OYE A;  3MHX A;  1X6B A;  1WQ7 A;  2DX1 A;  1UGP B;  1RLP C;  3MP6 A;  4CC2 A;  2SRC A;  5LJ5 d;  1K8A C;  4OML A;  2DBM A;  3H6Z A;  4LXC A;  4IIM A;  1OEB A;  1PD1 A;  1YIT A;  1AWW A;  2V1Q A;  1YFN A;  3OYM A;  3JCM P;  4CC4 B;  3P8H A;  1D3B A;  2LP5 A;  2DA9 A;  2DVJ A;  5GJW B;  2DER A;  3BDL A;  3MP1 A;  3D7S B;  1ZX6 A;  3C94 A;  1VQ5 T;  5I11 A;  1ZSZ B;  4P5N A;  2QEX Q;  1E7O A;  3I56 Q;  1Z9Q A;  1NPR A;  5CVI A;  1IZ6 A;  2X4W A;  4M7A D;  4J9G A;  1NYG A;  1VQ4 A;  3URG A;  3LX7 A;  4XTW A;  1WJR A;  3I9Q A;  4JJD A;  3CCU A;  2HQH A;  2FG0 A;  4HKE A;  1UJY A;  1O9S A;  1RI9 A;  1KC8 U;  1S1N A;  2BZY A;  2NUZ A;  3GLX A;  1RLQ C;  2LCC A;  1WA7 A;  1E6G A;  1VQK A;  1UEC A;  3SFM A;  4BAC A;  4Z88 A;  1OUL A;  2VYT A;  1X2K A;  2RK1 A;  4CRI A;  2E41 A;  3CPW S;  2OTL A;  4J9C A;  2EGC A;  1B34 B;  1OOT A;  4LE9 A;  1UHC A;  2LTO A;  4J9I A;  3N5B B;  2C0O A;  4M78 D;  1S72 T;  5FRO A;  3PVL A;  3FIF A;  2E70 A;  3CCJ A;  4KGV B;  1NE8 A;  3CC7 T;  1Z9Z A;  4M75 D;  3JCM c;  2K79 A;  3CCM T;  4XU3 A;  3OYY A;  1N8R R;  1VQL T;  1AWJ A;  2DTO A;  1MND A;  3IQL A;  1UGS B;  1KHI A;  5GAN g;  5IHI A;  4F17 A;  2YLB A;  3VS5 A;  2JXB A;  5GAM g;  5L23 A;  1X6O A;  3CMA A;  1K76 A;  1VQO T;  4OVA A;  4AFS C;  4C5G A;  2LJ0 A;  3RMS A;  1RL2 A;  3M53 A;  3AHU A;  2M1H A;  1QLY A;  2SEM A;  3G71 T;  3QG1 A;  5KE3 A;  1I5O B;  2CSI A;  2LX9 A;  1KQ2 A;  4MDX A;  2F5T X;  1ABQ A;  1SRL A;  2KYM A;  3NTI A;  3CD6 A;  3G4S A;  2MI6 A;  1AWX A;  2DE0 X;  2FEI A;  3PIP A;  1VQ8 A;  4ZNX A;  1VQP A;  3QBY A;  1UHF A;  2CP6 A;  2EJ9 A;  2BZX A;  2QDY B;  1IRX A;  3GPL A;  1NEG A;  1X01 A;  1PSE A;  3CCV T;  4OGC A;  1N8R U;  1ZQ1 A;  1Q7Y U;  1M4Z A;  1VQ9 Q;  4N0A A;  2A36 A;  2QGF B;  2RHY A;  4RKU E;  1QW1 A;  4OMM A;  1YCS B;  5J39 A;  3JB9 F;  2E6Z A;  1W2B S;  2PQW A;  2O01 E;  3CME Q;  1WYX A;  3OYC A;  4LD6 A;  1UE9 A;  3VS6 A;  4BE2 A;  1GL5 A;  2L3R A;  3OYK A;  5IH2 A;  2QAZ A;  1QCF A;  1ZLM A;  4RTV A;  4ZGE B;  3CCQ A;  4QW2 A;  2E5Q A;  4PJO D;  1KD1 R;  3NTK A;  2DXC A;  4C8Q A;  2J6F A;  1BIA A;  5D7U A;  4OB0 B;  2NYS A;  3M0S A;  2ENM A;  1G3Y A;  3A8G B;  1Q81 C;  3OBW A;  3PT9 A;  5CR2 A;  2C0T A;  2LDM A;  1CKB A;  1ZBJ A;  4Q5W A;  4MZT A;  4ZN1 A;  2F2X A;  3FEO A;  2FYK A;  4M78 G;  1K4U S;  1BB9 A;  1Q86 U;  4X9D A;  2YT6 A;  1PCX A;  3X28 B;  1DJ7 B;  5EC7 A;  2H8H A;  1UB4 A;  2CZ7 B;  3CXC P;  4F04 B;  4M75 G;  3OSV A;  2KGT A;  3LWH A;  4PK4 A;  1WXU A;  1X43 A;  2EGA A;  2ZPB B;  1PD0 A;  3ZL7 C;  1EFN A;  2CRE A;  4M77 A;  3QJY A;  4A53 A;  4X9C A;  2OX7 A;  9ATC B;  4UC4 A;  3PTA A;  2COY A;  2E3H A;  2ATC B;  3CCL Q;  1EIF A;  4GY5 A;  1K8A R;  3G1J A;  1ZSZ A;  2LT4 A;  4C5E A;  2D1X A;  1IO6 A;  4JJC A;  3I55 T;  1YJW Q;  2PZ1 A;  1MGQ A;  1JO8 A;  4DEX A;  4PFP A;  1U3O A;  1I4K 1;  4FW2 A;  1Y96 B;  1JJ2 P;  2QEX A;  2E3I A;  3I56 A;  4FM4 B;  3WVE B;  1QQJ A;  3CC2 Q;  4J8O A;  2O2O A;  2HBW A;  3OYN A;  4OMQ A;  3CCR A;  4AFQ C;  5GMK l;  4FYW B;  1K9M U;  1NYF A;  2DPP B;  1NM7 A;  4J9E A;  1VYU A;  3RNJ A;  3EFR A;  1YIT Q;  1KJW A;  4LD9 K;  1Y57 A;  5FW9 A;  3JCM g;  2AZS A;  5CCA A; 
#chains in the Genus database with same CATH homology
 2RJD A;  2Y4X A;  3CXC A;  4QQ6 A;  5HK3 A;  5FRN A;  2MWO A;  4PNO A;  4XK8 E;  5LJ5 h;  1YIT T;  1B34 A;  3FJP A;  3MCA B;  4C0D B;  4C8Q F;  4MMK A;  3A5Z B;  4M7A G;  4RCB A;  2K5I A;  4XTY A;  5KCO A;  2I2L A;  1U1S A;  2BIV A;  5GAN 8;  2E1H A;  2BUD A;  4MZM A;  5CQX A;  2VXF A;  5I2M A;  5C0M A;  1Q86 C;  4PKC C;  3DLM A;  1M90 C;  4XQ3 A;  1BYM A;  1K8A U;  2JTF A;  3H8Z A;  3OY9 A;  2EWN A;  2PVG B;  3E9G A;  2XDP A;  2DEQ A;  4C8Q D;  3OYA A;  4EMK C;  3L2Q A;  2MAM A;  3OB9 A;  2XHC A;  5CKB A;  1M1G A;  2XU8 A;  2FVU A;  3E1S A;  2JUF A;  4PL6 A;  3RIR A;  4BY6 C;  1Y07 A;  2QQR A;  4M7A C;  3MO8 A;  2DIG A;  2LQK A;  1W4S A;  2F69 A;  2A3L A;  2RM4 A;  2WSF E;  5GMK j;  5GAN 7;  1VQ4 T;  1VUB A;  2E10 A;  2LC4 A;  2RK2 A;  3CCU T;  1QVF S;  1UEB A;  3L1A A;  2H3J A;  3X26 B;  4HT8 A;  2KY9 A;  1FXX A;  4QVC A;  3UDC A;  3SWN B;  2KDS A;  3JCM J;  3QZ9 B;  4PJO G;  3FRN A;  3KXT A;  2K57 A;  3VYG A;  3S3M A;  1G3S A;  3CPF A;  4E7H A;  1W2B A;  1JJ2 A;  2X4Y A;  4FT2 A;  5CK9 A;  3FDR A;  4B9W A;  1VQM A;  4MML A;  2WSE E;  4O6J A;  2X35 A;  3HPW A;  2OTJ T;  4OB2 B;  2DXT A;  2JNG A;  3QDR B;  3VKI A;  3MEW A;  2HBP A;  4BE1 A;  2VGN A;  1VQK T;  3TU4 K;  2ZPH B;  4C0G A;  4C8Q E;  2K5L A;  2O4X B;  4XTZ A;  1OZ2 A;  5CIU A;  4J7I A;  4HCB A;  3QPH A;  3CCE A;  2XID A;  4JRK A;  1BI3 A;  3C95 A;  4A4F A;  4PJO C;  5LJ5 j;  1YJ9 A;  4C92 G;  2DAQ A;  3QUI A;  4CI0 C;  5HKC A;  3ER0 A;  4M77 F;  3JCM f;  2OTL T;  3A8M B;  3CEY A;  3BDU A;  5LJ3 e;  1XOV A;  3HFO A;  4B9X A;  1BKB A;  3DLL A;  1YHQ A;  2XDD A;  2PVD B;  1N6A A;  2QXF A;  4E7L A;  1OZ3 A;  4M78 C;  1K73 U;  2DVE A;  3Q1J A;  2EKO A;  2EYQ A;  2CZ6 B;  5I2S A;  3OMC A;  3I55 A;  4ZTJ A;  1YIJ A;  3BW1 A;  3G6E T;  2ZPF B;  4JRI A;  4M77 D;  4NS5 A;  3CCJ T;  4YTL A;  3L2W A;  3CCL A;  1KD1 U;  4C0F A;  1MHN A;  5LJ3 d;  4C92 C;  2MMP A;  4OB3 B;  1K9M C;  3HHT B;  4M75 C;  5J26 A;  4DQ2 A;  2DO3 A;  1JRI A;  1YI2 T;  4EMG A;  4OP0 A;  3HFN A;  1QVF A;  1YCY A;  5CO7 A;  2HD0 A;  3HRS A;  1BIB A;  2RJC A;  2D0Q B;  2HQX A;  4A4E A;  4XU2 A;  5DM7 R;  5GAN 6;  3M56 A;  1YHQ T;  1UGQ B;  3L2Z A;  4M7D A;  4M7D D;  2RO0 A;  1FX7 A;  4J6Y A;  2EQK A;  3KUF A;  2K4Y A;  3PNW C;  3P8D A;  4Z02 A;  2GQV A;  1NPP A;  1N9R A;  2JTM A;  3OBY A;  4A4K A;  2DZ9 A;  4BD3 A;  5LJ5 e;  3JB9 H;  1WJS A;  2GCX A;  4FSX A;  4LDW A;  3OYE A;  3WXM B;  2NLU A;  3MHX A;  4OMF B;  4TVR A;  1WQ7 A;  1M5Q 1;  5I21 A;  2DK3 A;  2X4J A;  3L2V A;  1VQ9 A;  3CMA T;  4F7U A;  2M16 A;  1HK9 A;  2LT1 A;  4C0Z A;  1UGP B;  1AHJ B;  5GAN 5;  3MP6 A;  2VV5 A;  2ZPE B;  5DY9 A;  3OMG A;  1YBY A;  5LJ5 d;  1YJW T;  4M77 E;  1K8A C;  2D6F A;  4OGE A;  1I5L A;  3DB4 A;  5GAO r;  3H6Z A;  2IG0 A;  4WF2 A;  1JB0 E;  1G3W A;  2M0O A;  3TRE A;  5GAM j;  1XQH A;  4R55 A;  4MDW A;  1YIT A;  3OYM A;  3JCM P;  3V7S A;  2RJF A;  3S3O A;  3WVD B;  2X4X A;  3AHU A;  3P8H A;  4M7D E;  1BI0 A;  4BE0 A;  2XKO C;  1D3B A;  3HRU A;  4N4H A;  3JCM X;  2M9U A;  3BDL A;  3GF5 A;  3MP1 A;  2PU9 B;  3C94 A;  1VQ5 T;  3CD6 T;  3G4S T;  2RH2 A;  5D6X A;  3OYI A;  3CC2 T;  4P5N A;  3V8J A;  2WSC E;  3VUZ A;  4A4H A;  3V8K A;  1M1F A;  2VXE A;  4PJO A;  4EMK A;  2OAU A;  4QVZ A;  2PVO B;  2WAC A;  1VQP T;  4IUT A;  4F7U E;  1Q82 U;  3JB9 J;  4M7A A;  1NPR A;  4XU1 A;  1IZ6 A;  2X4W A;  5CVI A;  4M7A D;  1SSF A;  4BDY A;  4RG2 A;  4RMO A;  2RHZ A;  4C0D C;  3URG A;  4EPC A;  3OYH A;  2A7Y A;  3LX7 A;  1VQ4 A;  5GAN e;  4PLL A;  2EQM A;  4XTW A;  5FRM A;  1WJR A;  2P0Q A;  3CCU A;  3J7A F;  3V7C A;  1WNL A;  2GFA A;  2K3X A;  2IVW A;  2XK0 A;  3QII A;  4BI8 B;  5GAM e;  3OYB A;  5KH6 A;  4J6X A;  3NTH A;  4HKE A;  3P8B B;  3DKM A;  3MEV A;  1Y7X A;  1O9S A;  2EFI A;  3MEU A;  4KUL A;  4N0A C;  1VQ7 A;  1KC8 U;  4LDX A;  4Y91 A;  4FL6 A;  2QA4 A;  3GP8 A;  2LQ8 A;  2XG8 D;  5LJ5 g;  1KHC A;  2DXU A;  2KAF A;  4XTU A;  5GAN d;  3GLX A;  3QJ6 A;  4JS5 A;  3JB9 D;  4ZGJ B;  2LCC A;  2OTJ A;  2P0P A;  5FU6 B;  5GAM d;  5L8R E;  3E19 A;  1K73 C;  3INZ A;  1VQK A;  3GIB A;  3SFM A;  4BAC A;  3BY7 A;  3JCM V;  3T9N A;  2E64 A;  3QXE B;  3E9F A;  4E7I A;  2VYT A;  1IRE B;  2MWP A;  3CBM A;  1VIF A;  2K5F A;  3GNF B;  4C5H A;  2CGH A;  1KD1 C;  2RK1 A;  4M78 F;  2E41 A;  2KK4 A;  4CRI A;  2EJG A;  4EDU A;  2Y4Y A;  3PIO A;  3CPW S;  4HCC A;  4M7A E;  4JRP A;  3SWN C;  4N4G A;  2DTH A;  2HQE A;  1VQ7 T;  1KQS A;  2OTL A;  4XTV A;  2QA4 T;  4C8Q G;  5A0D A;  1B34 B;  3QKJ A;  2RB6 A;  3LGL A;  5CKF A;  1WGS A;  2LTO A;  4M75 F;  4RG8 A;  1FWZ A;  3ME9 A;  4M78 A;  2JVV A;  1P92 A;  3N5B B;  4J7F A;  4M78 D;  4RCC A;  4JJN K;  4QQG A;  2FB7 A;  5EG2 A;  2QQS A;  1X75 C;  2GF7 A;  3LYI A;  4J83 A;  2PUK B;  4QQD A;  2KMT A;  5FRO A;  3X24 B;  3FIF A;  3RKW A;  2E70 A;  3OSS C;  3G6E A;  2XD0 A;  3CCJ A;  5C6S A;  4C92 A;  1NE8 A;  3SB2 A;  4HCZ A;  4C8Q B;  4C92 D;  4NL3 A;  3CCQ T;  4E7K A;  1M1K U;  3CC7 T;  3OYF A;  4M75 A;  5LJ3 f;  2E12 A;  4M75 D;  2R57 A;  3VJP A;  4C8Q C;  3L2U A;  4VUB A;  3JCM c;  5GMK e;  3PGG A;  1YI2 A;  3CCM T;  4XU3 A;  2FHD A;  3OYY A;  1VQL T;  3LGF A;  4KUI A;  5FU7 B;  3OYL A;  2VUB A;  4N4I A;  3RKY A;  4ZTF A;  4OF1 A;  2DTO A;  1UGS B;  1KHI A;  4MZP A;  2RHU A;  5GAN g;  1XTD A;  2XDB A;  4M7D F;  1YJN T;  3SD4 A;  2YLB A;  5HY6 A;  2RD1 A;  3OYJ A;  5GAM g;  4A54 A;  2ZPG B;  1X6O A;  2EIF A;  2L8D A;  3LLR A;  3OS5 A;  3CMA A;  5CAI A;  3QZ5 B;  3DB3 A;  5CKH A;  4XTX A;  4M78 E;  2RJE A;  1Y96 A;  1VQO T;  2DD5 A;  2KVQ G;  4OB1 B;  3S3N A;  4OVA A;  3M9Q A;  1UGR B;  1YJW A;  5A0G A;  2RI3 A;  1G3T A;  4C5G A;  2D9T A;  2V8I A;  3VU3 C;  3RMQ A;  5KE2 A;  5LJ5 f;  4F7U F;  3A8O B;  4C92 E;  3HKS A;  3RMS A;  2LCL A;  1RL2 A;  3CPW A;  3HP9 A;  3M53 A;  2EQU A;  2G3R A;  2M1H A;  2QTX A;  4J6W A;  5D6Y A;  4M75 E;  3J80 E;  3OS2 A;  1KQ1 A;  4JRQ A;  1QVP A;  3M4Y A;  3JSC A;  3PMT A;  5KCH A;  3JB9 I;  3G71 T;  3QG1 A;  5KE3 A;  1WQW A;  1BI2 A;  4M77 G;  2LX9 A;  3OW2 S;  1Q81 U;  2DTI A;  5D6W A;  2HAX A;  4IUV A;  4ZN3 A;  3V7R A;  1KQ2 A;  1Y71 A;  4MDX A;  4EMH A;  3M4G A;  2F5T X;  2YRV A;  1TH7 A;  4X34 A;  3NTI A;  4IUP A;  2DXB A;  3CXC S;  1VQ5 A;  3G4S A;  3CD6 A;  2HNI A;  2MI6 A;  3CC2 A;  4KT0 E;  4BUG A;  3QHS A;  2CZ1 B;  3CC4 T;  3PIP A;  1VQ8 A;  4M7D G;  4KBM B;  4M77 B;  1VQP A;  1KC8 C;  3QBY A;  2EJ9 A;  5GAO p;  1PSF A;  2QDY B;  2ZPI B;  3TCJ A;  3GPL A;  5GMK m;  3L42 A;  4LDV A;  3R6O A;  5J3B A;  1X01 A;  3QO3 A;  3VV0 A;  2CKK A;  4D6W A;  1U8R A;  1PSE A;  4FU6 A;  3CCV T;  4ME7 A;  4OGC A;  4ATO A;  4M7A F;  3M5A A;  4M7D B;  1QP2 A;  2V8J A;  2RHI A;  4F7U G;  5GAO m;  1N8R U;  2P4T A;  1ZQ1 A;  1Q7Y U;  1M4Z A;  5IN1 A;  3NFC A;  2KSS A;  5LJ3 h;  4QVD A;  2JZ2 A;  4N0A A;  3JCM h;  1VQ8 T;  1ZBX A;  5DLQ E;  3QSU A;  5A0L A;  2K2V A;  1U1T A;  2DIQ A;  2L89 A;  3C12 A;  5LL6 S;  2JN0 A;  5IT9 E;  4DOV A;  4ELZ C;  2RHY A;  5GAN f;  4RKU E;  4F7U B;  1Q82 C;  1QW1 A;  2LNV A;  3PFS A;  5GAM f;  2QQA A;  2RHX A;  4NOY A;  2E6Z A;  5J39 A;  2QEX T;  2PQW A;  4L6V 5;  1W2B S;  1JJ2 S;  5GAN 2;  3JB9 F;  1R8O B;  2O01 E;  3I56 T;  1NJI U;  3OS0 A;  3UT1 A;  2QQB A;  1M1K C;  2ZGW A;  3SWN A;  1QVG S;  3OYC A;  4LD6 A;  4BE2 A;  1GXI E;  2L3R A;  4PJO F;  3CCR T;  3EFS A;  2YLC A;  1N27 A;  3OYK A;  1VQ6 T;  3RER A;  3RKX A;  3OYG A;  1D3B B;  1VIE A;  4JLI A;  2V8K A;  3ZEH A;  1S72 A;  3X25 B;  5FU6 C;  5M9O A;  5GAN 4;  3G7Z A;  2B8A A;  3M57 A;  2O4X A;  3GNG A;  1OI1 A;  4ZGE B;  3CC7 A;  3CCQ A;  4JS4 A;  4QW2 A;  1VQN T;  1XNI A;  2E5Q A;  4HA8 A;  4EMK B;  5GAO q;  4PJO D;  3KBG A;  3NTK A;  2DXC A;  4C8Q A;  2RA2 A;  2CYZ B;  2R5A A;  2AHJ B;  3ZFJ A;  4JLG A;  1BIA A;  4IUR A;  4BI4 A;  4BY6 B;  3M55 A;  3CCM A;  4M7A B;  1QP3 A;  4C92 F;  3J81 E;  1NZ9 A;  2EJF A;  4OB0 B;  3EAE A;  1N9S A;  1VQL A;  2CZ0 B;  2E6N A;  3M59 A;  2KQW A;  3JB9 G;  1M8V A;  2VC8 A;  1LNX A;  5CKE A;  3PMI A;  2P0K A;  5LJ3 j;  3FB9 A;  3QYH B;  3A8H B;  4E7J A;  1YJN A;  4NL2 A;  3RUX A;  1G3Y A;  3A8G B;  3TEE A;  3CCS A;  3V8L A;  5CKD A;  4V2S A;  3UPU A;  2XI9 A;  4A4G A;  3CBP A;  3RES A;  3OS1 A;  3OBW A;  1Q81 C;  3FLG A;  3PT9 A;  4IKF A;  5CR2 A;  4DOW A;  1BI1 A;  1VQO A;  2LDM A;  4L59 A;  3HRT A;  1H64 1;  3OYD A;  3CME T;  2VGM A;  4Q5W A;  1WJQ A;  4DA4 A;  3OA6 A;  4MZT A;  4ZN1 A;  1QVG A;  4PJO E;  3JCM b;  2MF2 A;  3FEO A;  4ELY C;  3L2R A;  2FYK A;  3QYG B;  2R5M A;  2BKD N;  5FU7 C;  4M78 G;  3JAM E;  1Q86 U;  3LH0 A;  5GAO n;  4X9D A;  3VUB A;  3G71 A;  2DJZ A;  3F70 A;  5DLO A;  5GAN h;  2DD4 A;  3CCS T;  3X28 B;  3JCM W;  4O5V A;  1M90 U;  1DJ7 B;  3CBO A;  3ZBD A;  4PLI A;  1UB4 A;  3MP8 A;  1LJO A;  2CZ7 B;  5GAM h;  5A2Q E;  5AYF A;  4JUV A;  1M9S A;  1JBM A;  4M75 G;  3OSV A;  3JCM Q;  3LWH A;  3M54 A;  1N8R C;  1Q7Y C;  1VQM T;  1HXD A;  4LDU A;  4M78 B;  3JCM e;  4BB7 A;  3CC4 A;  2JOY A;  2ZPB B;  4IUQ A;  3FC3 A;  2FL7 A;  2DZC A;  3S6W A;  4M77 A;  3QJY A;  4C92 B;  4A53 A;  4X9C A;  3CCE T;  2DKG A;  2C06 A;  1LOJ A;  5CQY A;  4M75 B;  2LRQ A;  1I81 A;  3A8L B;  4UC4 A;  3PTA A;  1YJ9 T;  3JCM d;  4ZGD B;  1I8F A;  3CCV A;  2R58 A;  4II1 A;  4FIB A;  1EIF A;  1OYX A;  3BFM A;  4C5I A;  1RI0 A;  4FT4 A;  1NJI C;  2K3Y A;  3ASK A;  3HL8 A;  4GY5 A;  4IUU A;  2LT4 A;  2ZZD A;  3HSB A;  4C5E A;  3GOX A;  5GMK i;  1H3Z A;  2CS7 A;  1YIJ T;  2YHT A;  3I55 T;  5HK0 A;  1MGQ A;  4M77 C;  4LDY A;  3CCL T;  3M58 A;  3OQ5 A;  1V29 B;  2RI2 A;  3JRZ A;  2XIC A;  1I4K 1;  1Y96 B;  2RI5 A;  4E47 A;  2GFU A;  1S72 T;  2QEX A;  3O8V A;  2EAY A;  3MET A;  1WPY A;  3LWI A;  3I56 A;  2ZCF B;  5IAY A;  5GMK h;  4M7D C;  2QQ9 A;  5GAN j;  2L5Q A;  5FLX E;  4FM4 B;  4GLK A;  2F5K A;  3WVE B;  4L5G A;  4JDS A;  3X20 B;  4J5Y A;  4J8O A;  3OYN A;  1ZHI A;  4Y28 E;  3CCR A;  3LW5 E;  2EQJ A;  4XAX B;  1VQ6 A;  2Y90 A;  4HT9 A;  4PJO B;  4BDZ A;  5GMK l;  3UWN A;  1K9M U;  3CME A;  3MEA A;  1G5V A;  3VYH B;  2DPP B;  2LVM A;  1VQ9 T;  1KQS S;  3EFR A;  3SDZ A;  4BI3 A;  4LD9 K;  4XU0 A;  1VQN A;  3C4S A;  5GAO l;  4KUD K;  5GAN 3;  5LJ3 g;  3OW2 A;  1O75 A;  4R56 A;  2E65 A;  2QI2 A;  3JCM g;  5CCA A;  1KG1 A;  2PUO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...