4PJOE

Minimal u1 snrnp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
77
structure length
77
Chain Sequence
b'MVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein Sm D3
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing
total genus 15
structure length 77
sequence length 77
chains with identical sequence S, e, s
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoE00
4M7DC 2DTOA 4NOYA 4C8QF 4NL3A 4M7AC 5LJ5d 4J5YA 4M78D 2DXUA 3RUXA 4XTXA 5GAOl 3JCMJ 1HXDA 4M75E 4XTVA 4C8QB 3JB9J 1BIBA 4F7UA 2ZGWA 5GAN6 3JCMf 4MMKA 3SB2A 5GAN2 4HT8A 4C92A 2E64A 2RD1A 5GAN3 5GMKi 5GANg 3GIBA 5GAMg 4PJOF 5GMKl 5GAN5 4RCBA 4M77F 4XTZA 4C8QG 1HK9A 5GMKj 2DZCA 2E41A 5GANj 4PJOB 2VXEA 2DTIA 5DY9A 3V8LA 5GAMj 5GMKh 3QUIA 1WNLA 2HNIA 4XQ3A 1M5Q1 3SWNB 3PGGA 4XTWA 5GANf 5GANh 4F7UG 1KQ2A 4V2SA 1YCYA 2EAYA 1H641 3L1AA 4M78F 3JCMg 3RESA 2Y90A 5GAMh 4M7DD 4C8QA 4M7AD 2DKGA 2JN0A 4EMKC 3JB9G 1WQ7A 4C92G 4EMGA 2FYKA 2CGHA 3HFNA 4XTUA 4PJOG 1JRIA 2FB7A 4Y91A 4C8QC 4N0AA 4F7UE 2YLCA 2EJFA 3BW1A 2RA2A 4M75D 5LJ5e 3JCMh 2EWNA 5GAOn 4J6YA 3FJPA 5GAOq 3L2ZA 4J6XA 4C92E 2VXFA 4PJOA 4PJOE 4M77A 3M4GA 1B34A 1JBMA 3V7RA 3RERA 4C92C 3SWNA 3QO3A 1LNXA 3JCMb 2YHTA 1TH7A 4QVCA 4PJOC 4M77B 4DQ2A 1B34B 2DVEA 2RM4A 4X9CA 5LJ5g 3JCMX 3AHUA 4M7DF 4M7AF 4M78A 2YLBA 2DJZA 4JLIA 4M7DB 4M7AB 4PNOA 3BFMA 3VU3C 5GAN7 3JCMV 5LJ5j 5LJ3d 2I2LA 4C8QE 4M78B 3JCMW 1KQ1A 1N9SA 2RB6A 4M75F 3RIRA 3JCMc 3HSBA 4WF2A 5LJ5f 5LJ5h 2QTXA 4M77G 1N9RA 5LJ3e 4M75B 3JB9H 3V8KA 1U1SA 1MGQA 1M8VA 4NL2A 3QSUA 4JRIA 4N0AC 1WQWA 2DZ9A 2VC8A 4XU0A 4EMHA 4M78G 3V7SA 4C92D 5GAOm 3JB9D 4M77E 3FIFA 3JCMP 4A54A 2EJGA 3HFOA 2DTHA 4RCCA 5GAN4 4M7DA 4X9DA 4JRKA 4M7AA 4M77C 5GAMd 3SWNC 5LJ3j 4M78E 1D3BA 5GMKm 5GAMe 2E1HA 1WPYA 3INZA 4M75A 2K57A 5LJ3h 3BY7A 5LJ3f 4MMLA 4XU3A 5GAN8 5GAOr 4M78C 1Y96A 1BIAA 1D3BB 4C8QD 3JCMd 1LJOA 4F7UF 4QVDA 2EJ9A 2DEQA 1I5LA 4M75C 4HA8A 3V7CA 4F7UB 2E10A 1Y96B 3JB9F 3JCMe 4C92F 4HT9A 4M7DG 1X01A 4M7AG 3BDUA 4OP0A 4A53A 3JCMQ 4C92B 3QHSA 5CAIA 1I4K1 1I81A 3JB9I 1LOJA 4J6WA 4XTYA 4PJOD 5GAOp 4M77D 3RKXA 4M75G 4EMKA 5LJ3g 3EFSA 3RKWA 5GANd 4M7DE 2DXTA 3FB9A 4M7AE 4XU1A 1I8FA 3RKYA 3V8JA 1U1TA 2E65A 3EFRA 4JUVA 5GAMf 5I21A 5GMKe 5GANe 4EMKB 4XU2A
chains in the Genus database with same CATH superfamily
1RAHB 1ZSGA 2RHXA 2CP5A 3CCET 2QQAA 4KGXB 2HQXA 2EQJA 1NPRA 3H8ZA 5HY6A 4KULA 3CCVQ 4Z88A 1PRLC 3PT9A 5GANj 4A4FA 1YJ9Q 2DTIA 3G6ET 1D0YA 2YSQA 4AG1C 1NM7A 4OGEA 3OYFA 1YJNT 3QIIA 2Y90A 3X28B 4M7AD 2JN0A 4KT0E 3VYHB 1BBZA 5A0DA 1WHMA 3CCUT 2EJFA 3I56Q 4WTOB 2CP6A 1QCOA 1UUEA 3M0PA 3UDCA 1S72T 4QVZA 1UGPB 2E3IA 4C0DB 1RI0A 4MDWA 2YHTA 2DE0X 3DLLA 2JNGA 1OZ3A 2XMFA 2D0QB 2AHJB 3HPWA 3EFOB 3GBQA 4KBMB 3X20B 2C0OA 3CPWA 3M57A 5GAOm 4DBRA 2LX7A 2DRMA 2PVOB 1KD1R 4F04B 4LXCA 4FYVB 1K8AU 1I0CA 3CC4Q 4P5NA 1M1KU 1G83A 3SWNC 5GMKm 2JT4A 2BTTA 4M75A 5GAOr 2V8IA 4XU3A 1Y96A 2K3YA 1HSQA 2JS2A 3MEUA 2R5MA 1QVGA 4M7AG 1T3LA 2DXCA 4A53A 3META 3OYJA 1KSWA 3CCSQ 5L8RE 1AZEA 2EYXA 3RKWA 1TTHB 2DXTA 1YI2A 2P84A 4LDVA 4C8QF 4NL3A 3CMEQ 5M9OA 2PU9B 1Y57A 4C8QB 2J6KA 1H3ZA 3CMET 2VYTA 2KNBB 5GMKi 3GIBA 3GNFB 2QASA 2PUKB 5GAN5 4ANJA 4BY6B 4RTUA 3EGUA 1S1NA 3REBB 6AT1B 3M0RA 4XQ3A 4LDUA 1KC8C 4XTWA 4J8OA 4F7UG 3KFVA 1NLOC 1FMVA 1ZQ1A 1G3YA 1RI9A 4XTUA 2RJCA 3M9QA 1LCKA 1VQ9Q 2RF0A 2JZ2A 2EKOA 2YWWA 4A63B 3LH0A 1G5VA 2EKHA 1Q81R 1VQMA 1VQ9T 4Y28E 7AT1B 3MEVA 4GLMA 1VQ5A 2XG8D 1YJWQ 1M30A 1B34B 1TSFA 2RM4A 3Q1JA 4FSSA 4KH1B 2A36A 3UT1A 3MP1A 2E4HA 3CC7Q 2HAXA 1VA7A 3M54A 2J06A 1YJWT 1WJQA 1VQ7Q 1HD3A 2QTVA 2AZSA 3I5SA 1WJRA 2ATCB 2RHYA 1VQ7T 1U1SA 2MOXA 2PVGB 3SD4A 4EMHA 2CUBA 2VC8A 5KCOA 4M77E 2YXYA 2HD0A 5IHKA 3L42A 2HBWA 3S3MA 5LJ3j 2YRVA 1D3BA 1TOVA 2JTEA 3H0FA 4O6JA 2VKNA 4JDSA 1VQNA 4QKUA 3OYGA 1IB8A 2CT3A 4M75C 2DLPA 2LCSA 4CC2A 4J9DA 2LC4A 3A8MB 5C0MA 5KE3A 2CZ6B 4MZPA 1IGQA 2HMAA 4EMKA 4EIKA 4M7DE 5CIUA 4IUUA 5LL6S 4RTTA 3VUBA 2BE9B 3NTIA 5GAOl 2V1RA 5GJVB 1NPPA 1BIBA 1KQSP 4RG2A 2VGMA 5IT9E 4DEYA 5GAMg 5GMKl 2KXCA 4XTZA 2DZCA 2EIFA 3OA6A 3NTKA 1WNLA 3OS5A 4PJJA 5CQXA 4AFSC 4C8QA 2FYKA 5AT1B 4FL6A 1OU8A 3KUFA 1N6AA 2EYYA 2MWOA 2EWNA 3VKIA 2KDSA 5HCKA 3RERA 4C92C 4CC4B 1VQPQ 5IN1A 4M77B 1SKUB 1UB4A 1TXQA 1K1ZA 2VWFA 4E2FB 4E7JA 2DJZA 4RTXA 1WJSA 3EG1A 1VQPT 3JCMV 2FPFA 1K73C 3C12A 5FWBA 3JAME 1M8VA 1ABQA 2EQUA 2K7AA 3ME9A 4C0GA 3ZL7C 4C0DC 2P0QA 2DTHA 2O4XB 4D8KA 2F5KA 2MMPA 1IRXA 4M78E 5I22A 4FSXA 3CCRA 2QA4A 4E7IA 5AYFA 2KXDA 2K57A 4DBFA 4RUGA 1GCQC 3CPWS 1W2BA 1NZ9A 1OPLA 3JRZA 4E6RA 1G3SA 3JCMQ 5D6YA 1AVZC 1I81A 1LOJA 1IO6A 2JS0A 1UGVA 5GAOp 2I0NA 2O9VA 2FVUA 3MPUB 4MDXA 2L89A 3RUXA 1AWXA 4E7SA 1AEYA 3ER0A 4BDYA 3A8LB 2QEXT 2JM8A 4NS5A 5CCAA 1TWBA 5GAN3 5C6SA 2ECZA 4ELYC 3UPUA 3OMGA 2BKDN 2MI6A 5FRMA 3A8HB 3PGGA 1VQ5Q 3OYAA 1MNDA 4ZTFA 1Q86R 3L2QA 1AWJA 3QJ6A 3T9NA 4AFUC 2D0NA 2DFUA 3EGXA 4C8QC 1EFNA 3OYNA 5D6WA 5KE2A 1D0ZA 4FYWB 3OB9A 2ED0A 1BYMA 3RNJA 2EBPA 1B7TA 4JJBA 4BY6C 3RDVA 3C4SA 3CCJA 4BI8B 1T0JA 1R8OB 4PNOA 1VYVA 4M78B 1X75C 3HSBA 1VQ8T 4WF2A 5LJ5f 5LJ5h 3R6NA 1N9RA 1YP5A 3LX7A 4PFZA 3CCQA 3ASKA 2NYSA 4C92D 3FIFA 1KC8U 5L23A 3EH2A 1N8RC 3OW2A 2GQVA 1QP2A 2HSPA 3HRSA 4BACA 3GLXA 2X51A 1IREB 2VASA 1K9MR 2EJ9A 1YWPA 3OS1A 2L3SA 3V7CA 1QVFS 3JB9F 4JJDA 1AD5A 1CSKA 5KYNA 1UTIA 1JEGA 1LPLA 1GXIE 2CUDA 1TUDA 4FU6A 3E9FA 1B07A 2P4TA 3LLRA 1H3HA 4XU1A 3V8JA 4OB0B 2NWMA 1VQOT 2DO3A 3OMCA 4M75E 2ZGWA 3NMZC 5GAN6 2PTKA 1YN8A 4E7HA 1M3CA 3LGFA 5GAN2 4KRTA 2E64A 2V1QA 2M9UA 3FDRA 2LJ0A 4OGCA 4ZGDB 2K3BA 4PK4A 1X27A 1PKTA 2QGFB 5CKEA 5J39A 3H9NA 3QJYA 5GAMj 1RAFB 2G3RA 2DYBA 4F17A 2JM9A 3SDZA 2CZ1B 4C92G 2QDLA 1WXBA 5DLQE 1N27A 3CMAA 5ECAA 3U23A 1W6XA 3L2ZA 3H0HA 1VQLA 1D1BA 1BI0A 2CSIA 3M4GA 2LJ1A 2DJQA 1FMWA 4JS4A 2RI5A 4R0KA 4E7KA 1ARKA 4OMQA 1JJ2A 2E12A 4R55A 3OYDA 3JCMW 2OTJQ 2KR3A 5CKBA 1PSEA 4NL2A 2OTJT 2EQKA 4ESRA 4C5HA 1GCPA 3O5ZA 3CC2A 1O9SA 2CDTA 3HFOA 3G71T 4D8DA 1KG1A 4M77C 2KY9A 4ZNXA 2LRQA 1SSFA 4HXJA 2KRMA 2DBKA 3OQ5A 1KD1C 1H8KA 1E6HA 2GFAA 1PKSA 2KQWA 4A4HA 1NLPC 3P8HA 1Y96B 3BDUA 2RMOA 3HP9A 1I4K1 3A98A 1EZZB 3VJPA 2PZ1A 4O5VA 5LJ3g 4PL6A 4IUPA 3QZ9B 9ATCB 1G3TA 3LGLA 1UECA 4OMNA 1NEBA 1K73U 4OVAA 2KGTA 4M7DC 1W2BS 2DX1A 4X1VA 2H3JA 2KSSA 4C8QG 2J05A 3G4SQ 1UDLA 2VXEA 5DY9A 2EYQA 1YFNA 3L2UA 3JCMg 1NBEB 3G4ST 3L2VA 4Y91A 2YUOA 2QDYB 2DL5A 4KUDK 2IVWA 2VXFA 3OYMA 4PJOE 4A4EA 1JBMA 1MV0B 1U06A 5HKCA 3OYEA 2F2XA 2L5QA 1QWEA 4QVCA 3I55Q 3FRNA 1F1BB 1NJIR 2E6NA 1G8XA 2FL7A 3CCVT 2BZYA 2HKQB 1PWTA 5I2MA 4C8QE 1YJ9T 3I55T 2LQ8A 2D8HA 5I11A 1AT1B 2EGAA 1R0CB 5D7UA 1MMAA 1QLYA 4N0AC 1WQWA 2DZ9A 1JO8A 3I56T 5GAN4 1RUWA 1VQ6A 2RO0A 2YRCA 1GFCA 2CP3A 2DK3A 4ME7A 2ZZDA 2ABLA 4M78C 1M90R 1D3BB 5D6XA 2KYMA 2V26A 2OJ2A 1X01A 3JV3A 2IG0A 1X69A 3OW2S 1UHCA 4M77D 1H92A 3VV0A 1SSHA 3DKMA 4EMKB 2DPPB 1KHCA 3CC4T 5CQYA 2X35A 3CMAQ 2DETA 2ZPBB 4PJOF 1R77A 3VRZA 1B3QA 4JZ3A 4RCBA 2RNAA 4PJOB 1N8RU 3CPWP 5GMKh 1BCOA 3QYGB 3L1AA 5KCHA 4M7DD 4HCZA 1W1FA 2CP7A 3CCST 3PE0A 3CD6Q 1WQ7A 2CGHA 2BZ8A 2C0IA 3VS0A 2IPOB 5LJ5e 3CD6T 3NTHA 1I07A 1M3AA 1U8RA 3TSWA 4FW1A 2AKLA 5CKHA 2LT4A 3TSZA 2MCNA 3CC2Q 3JCMX 4J7IA 1ZA1B 5FU7B 2KT1A 3DB4A 1QWFA 8ATCB 3QKJA 1N9SA 2FG0A 3RIRA 2XDBA 1W4SA 2CKKA 4M77G 2B86A 3S3OA 2IIMA 1OPKA 1MGQA 2KI7A 4XU0A 5IH2A 1WDXA 3JCMP 3PVLA 4X9DA 3NPFA 2QEXA 2EYWA 4L5GA 3CCMA 2QK0A 3GF5A 4KGZB 4ORZA 3CBMA 1YHQA 2HCKA 1LJOA 5CO7A 3CC7T 4IUVA 2EVRA 4M7DG 1N5ZA 4MZTA 4F14A 3N5BB 3QHSA 2VVKA 2DF6A 2XKOC 3VS7A 5FU6B 2MAMA 1NYGA 3ZEHA 3MP8A 1QP3A 1BU1A 5GAMf 4E7LA 4HCCA 3R6OA 4FT2A 1GBRA 4M78D 1WXTA 1A0NB 3EH1A 2QG9B 3CEYA 4CC3A 1SPKA 2E3HA 3UATA 3S6WA 1RACB 2HQHA 1X6GA 2RQRA 4PLIA 2P0PA 3QXEB 2O01E 1G3WA 2V8JA 1QVFP 1KD1U 3PIPA 1KQSA 1VQ4A 4OMPA 2DM1A 3H0IA 1OV3A 1IHWA 2Z0WA 5EC7A 2K9GA 4DOVA 2D6FA 1KIKA 1K4US 3EGXB 1RL2A 1JU5C 4PJOA 4DA4A 2A28A 4Q5WA 3RR6A 1ACMB 4M7AF 4LD9K 4IUTA 2XK0A 4GLKA 4J9EA 4M7AB 1VQ6Q 4LE9A 5KH6A 1QMCA 2ESWA 2QYZA 1MMDA 2F5TX 2ZPHB 4OMOA 4PFOA 2BUDA 4C5IA 2KK4A 4GBQA 4CI0C 1V1CA 2GCXA 3EGDB 3E1SA 1ZSZB 4M78G 4QQDA 4BE1A 3CCLA 4FM4B 5GAMd 2PQWA 2K5IA 2YUQA 1NG2A 4ZN1A 1AWOA 2G6FX 1D1CA 2CREA 5FROA 2D1XA 1AZGB 4F7UF 2YDLA 1K0SA 2DD4A 3REAB 4F7UB 2OTLA 1ZHIA 2HDAA 2KE9A 1K9MC 1Q82C 4Z02A 1Q81U 4XTYA 3CXCP 3RKXA 1VQKA 2RPNA 4PFPA 2ZAEA 1YNZA 1ZLMA 2DTOA 2LJ3A 5CVIA 3MEAA 1M2VA 2LX9A 1YI2Q 1M1FA 4N4HA 2ZPEB 5A0GA 1X6BA 3AT1B 4EDUA 1PM3A 1YI2T 1OU9A 2K5FA 2MWPA 2KAFA 2RHUA 2R5AA 2VB6A 3H6ZA 2DL4A 4X34A 2MK5A 2VV5A 5IHNA 1NE8A 5IAYA 1X2QA 1WZOA 5GANf 5GANh 4JRPA 1OYXA 1I1JA 2WSCE 2DL8A 4EMKC 2DBMA 1W70A 1RADB 1WYXA 1QVGS 4M75D 1WHJA 2QGGA 1R0BG 5KYYB 4ELZC 1W2BP 2E5QA 1P92A 1JB0E 3FEOA 3NHNA 4WCIA 5FW9A 1YITA 4PJOC 1VQMQ 2RQTA 2FPDA 5GAN7 2VUBA 1T3SA 1WHHA 2I2LA 3CCMQ 4FYYB 1VQMT 1U3OA 2DYIA 1KQ1A 1VQ5T 1YIJA 2PVDB 1YHQQ 5CK9A 4J9FA 5HK0A 1J3TA 4PJNA 1XJWB 2W0ZA 1Q95G 4RCCA 3M53A 4M7AA 3BE3A 2GBQA 3L2WA 2DIQA 5FU7C 2E1HA 3BY7A 4MMLA 3QZ5B 4TVRA 3EGDA 1ZSZA 1VQNQ 1M9SA 3PMIA 1WHGA 1PNJA 3KBGA 1HYOA 3CCEA 2WACA 3JB9I 4OB3B 4BE2A 1VQNT 4M4ZA 4M75G 5GANd 3OYYA 2LT1A 5GMKe 2LNHB 1OZ2A 3MO8A 1UE9A 1VQ4Q 5FRNA 4F7UA 1JQQA 3G6EA 2LQNA 2FRWA 1YJNA 2KROA 5HK3A 1U5SA 2DMOA 3CCUA 1Q7YC 2HL5C 1BKBA 3MEWA 5FU6C 2RQVA 3SWNB 2XD0A 1VYTA 2ZPFB 1Y07A 1YCYA 2E6ZA 4C5EA 1H641 3RESA 3I9QA 4BUGA 1S72A 1KHIA 4JRQA 4EMGA 3OW2P 1JRIA 1C6VX 1AOJA 3FJPA 2KT8A 4DEXA 3OYKA 4JZ4A 4JJCA 3V7RA 2WSFE 2ROLA 3HL8A 4ZGEB 4HCBA 1SF9A 5LJ5g 4L59A 2HKNA 2LDMA 2RI3A 4ZN3A 2L0AA 2FEIA 4AFQC 5FWCA 1NJIC 1XQHA 2HEQA 5KYYA 3LH5A 3TVTA 2M02A 3M0QA 4A54A 3OY9A 3P8BB 1OX9A 4Z8AA 3OYCA 1WA7A 5GAMe 1VQKQ 2GGRA 1FX7A 3M0TA 5LJ3h 5LJ3f 3M4YA 1KK7A 2J7IA 4C8QD 4DBHA 3MHXA 3CCRQ 2QA4Q 1Q86U 2DEQA 3M0UA 1GRIA 1UEBA 2E10A 2DXBA 2XHCA 2OAWA 4OP0A 1M90C 4BI4A 4OMFB 3VS2A 1MMNA 4LUEA 3CMEA 2KBTA 1U1TA 4IUQA 1WHLA 4NOYA 4FYXB 2O31A 3JCMJ 2RHZA 3MKDA 3JCMf 4MMKA 3TEEA 8AT1B 2GTOA 1QKXA 1K8AR 1M1KR 1BI3A 2E41A 1VYUA 3HTRA 3V8LA 1D0XA 2HNIA 2YUPA 1YITQ 2K2MA 5EG2A 2MPXC 2LNVA 5DLOA 4E7ZA 3H41A 1VQ9A 1GFDA 2X3XD 2DIGA 2K3XA 3HFNA 4PJOG 2NUTA 4FCYA 4J9GA 1IGUA 3VS5A 5GAOn 1SHFA 1PC0A 1K9MU 3OBYA 1YJWA 1Q82U 2JMAA 1X2KA 2AKKA 3SWNA 2M0YA 4IIMA 3RMQA 4X9CA 4A4GA 1VQ7A 1O75A 1K76A 3FLGA 3CCJQ 4C0ZA 4N4IA 5LJ3d 2QXFA 3J80E 4Y92A 4EPCA 4OB1B 2KRSA 1XTDA 4JPBW 3CCJT 4LDYA 4B6MA 1OOTA 1JXOA 2F69A 4LN2A 2PNIA 2ED1A 1RAIB 2JTMA 1WIEA 3DB3A 3CCQQ 2XIDA 2LP5A 3OS0A 4DBQA 1SG5A 1Q81C 3CCQT 2MIOA 4F16A 2NUZA 4OF1A 2XDPA 3M58A 4QVDA 3JCMd 2O88A 4C92F 3G6EQ 3VS4A 1UJ0A 4C92B 1YJNQ 3D7SB 1QW1A 1OQKA 5KYUA 4BI3A 1SEMA 2COZA 3FB9A 3RKYA 4RTVA 4LD6A 3A8OB 3CCUQ 4OMLA 2XDDA 5GANe 1K9AA 4HCKA 2CYZB 1S72Q 1FMKA 1E7OA 2FZKB 3MP6A 2RD1A 2ZPGB 2X4XA 1Z9QA 2JOYA 4C5GA 4DOWA 1VOMA 2OX7A 4KUIA 2L3QA 2EW3A 4AMCA 2H8HA 2WSEE 2CS7A 3QUIA 2EQMA 4RTYA 1M3BA 3X24B 2GF7A 1M1GA 1G2BA 2FZGB 3UF4A 4PJLA 2FRYA 2YLCA 1PD1A 4II1A 3I5RA 1VQPA 1Z9ZA 1BI1A 3HHTB 1VQLQ 1IZ6A 5A0LA 2NLUA 4J83A 4PJMA 3FC3A 3JSCA 3RMSA 3CMAT 2YLBA 2COWA 2GQIA 1VQLT 1UGRB 5LJ5j 3JCMc 4LDXA 5KYWA 3NGPA 2ZPIB 1KFZA 3GOXA 2YUNA 1PG5B 1Q7YU 2HL3A 1QVGP 4AG2C 1YWOA 3VRYA 2X3WD 4FW2A 2GTJA 1CKBA 2KRNA 2RN8A 4VUBA 1KJWA 4K11A 3INZA 2XICA 2CH4A 1AWWA 3CC2T 2L2PA 1RAEB 5CR2A 1X6OA 1MHNA 3OBWA 4PLLA 2SRCA 4PKCC 3EG3A 3S3NA 1JJ2S 4M7AE 1BCMA 2E65A 2R58A 3J81E 3TREA 2RH2A 4XTXA 1NJIU 1OI1A 4XTVA 5A2QE 1WFWA 3PTAA 1TS9A 1M2VB 2HQEA 3EHQA 4RMOA 1OULA 4C92A 4R56A 2E5KA 2AT1B 3C0CA 1QKWA 4XK8E 3QDRB 3VYGA 3OSSC 3GPLA 1ZBXA 2EAYA 5GAMh 4J9BA 4IURA 2X4JA 2X4WA 2FB7A 5J3BA 2DILA 4F7UE 1BB9A 5GAOq 1M90U 4J6XA 3OYLA 1QVFA 4BB7A 1YCSB 1VQ8A 1QCFA 2X9HA 1LNXA 2COYA 1MUZA 5GJWB 4HVVA 1WI7A 2RQUA 1GCQA 1WGSA 1ZBJA 3EFOA 2MF2A 2YRDA 3FJ5A 5DM7R 2RB6A 2QTXA 5LJ3e 3VS1A 2BZXA 3QBYA 2EGEA 3MJXA 4QQGA 4D6WA 3OYHA 1Q86C 1SHGA 2DD5A 4OB2B 1XOVA 3QWYA 3JB9D 1PSFA 3V7SA 2LZ6B 3QPHA 5IXBA 3NFCA 3ULRB 1PCXA 3CBPA 1QVPA 2K2VA 3G7ZA 4QQ6A 2J6OA 2AZVA 2QQRA 4ZTJA 3PIOA 4HVWA 1UG1A 2CZ0B 1VQ6T 2KMTA 2JTFA 1D1AA 3JCMe 1ZUUA 1VQOA 3OS2A 1C1AA 1PHTA 3VS3A 5KYXB 4JJNK 2FPEA 1M27C 2P0KA 1E6GA 1UFFA 3GP8A 1RABB 1M8MA 1AHJB 2M51A 2F2WA 4J5YA 2BIVA 2C0TA 1Y7XA 2VGNA 2PUOB 3QYHB 3DLMA 1CKAA 3RBBB 1IHVA 3CXCA 2FZCB 2YT6A 1KC8R 2DL3A 2Y4XA 4M77F 1HK9A 3UA6A 4UC4A 1M2OA 3LW5E 1PD0A 4J9IA 2CZ7B 1VIFA 2L3RA 4BD3A 1C0MA 2RJFA 2JJ9A 1RLQC 3JB9G 3J7AF 3EAEA 4J6YA 4N4GA 3M0SA 1BI2A 3C94A 4KGVB 1B34A 3CQTA 3IQLA 4XAXB 2JMCA 4M7DF 2JW4A 2M0OA 4MZMA 2K6DA 2LCCA 4JLIA 1FXXA 4M7DB 4Z89A 2OTJA 4HVUA 3VUZA 3HRTA 2MYSA 2CT4A 3G71A 2ENMA 5J26A 3JB9H 3V8KA 2K4YA 2NUPB 3WVDB 4QT7A 2AK5A 3QSUA 1PRMC 1NYFA 3HRUA 4L6V5 2RJDA 1FWZA 4C0FA 2EJGA 3ZFJA 4J7FA 2X4YA 4AT1B 2LQKA 2GFUA 2QEXQ 2V8KA 2DERA 1WPYA 1UGSB 3QDFA 2CP2A 3WXMB 2EYZA 4B9XA 2A37A 3SEMA 1RAGB 1I5LA 1JXMA 2QQ9A 2P4RA 4HT9A 1VUBA 3UWNA 3CCMT 2GNCA 4YTLA 1YBYA 4LUDA 1K0XA 2KYBA 1YHQT 2A08A 3EHRA 4BDZA 2C06A 1WX6A 3M59A 4FT4A 3EG9B 2RK2A 3BDLA 1I8FA 3EFRA 4JUVA 3TQ7P 2FO0A 4XU2A 3URGA 1HXDA 3JB9J 1TG0A 2KEAA 4J9CA 3SB2A 3QWXX 4JS5A 5KYXA 2JUFA 4J9HA 5GANg 1V29B 2EGCA 4JLGA 3G4SA 4IKFA 2HZYA 3M55A 5GMKj 1V76A 2SEMA 3KXTA 1VQ8Q 1KQ2A 2O2OA 4QW2A 1GL5A 4M78F 1K8AC 1X43A 4LNPA 1M1KC 1GBQA 3BW1A 2XI9A 2NUTB 2QQSA 2BE7D 3SFMA 3UA7A 3CCVA 3HKSA 4M77A 3X25B 1VQ4T 2HSEB 3I55A 1YJ9A 3E2UA 3CPFA 5IHIA 4OMMA 2LMJA 3JCMb 1K73R 1TH7A 2RHIA 2M1HA 2DVEA 3P8DA 1ZUKA 1ZA2B 2LVMA 3L2RA 3F70A 3LWHA 1FYNA 3GNGA 3I56A 2OAUA 1WXUA 1Q82R 2H3EB 2W10A 2QAZA 4ZGJB 3OYBA 1MNEA 5FLXE 2O4XA 3M56A 3PFSA 1OEBA 1VQOQ 4CRIA 1I5OB 3VS6A 1M4ZA 4M7DA 4BE0A 1KQSS 4RTWA 3WVEB 3CCLQ 1IXDA 2HBPA 2D8JA 1D09B 2NUPA 1BIAA 1HJDA 2DA9A 3CCLT 1ZUYA 2L3PA 1VIEA 4A4KA 1UHFA 3OYIA 3E9GA 4RG8A 3PNWC 2ROTA 1Y0MA 1QQJA 2OTLQ 2R57A 4J6WA 5IXFA 3CC4A 4PJOD 1MV3A 2A7YA 3EFSA 5I21A 4AFZC 2OTLT 3LYIA 5KYUB 4KH0B 2RK1A 4M7AC 2DRKA 3O8VA 5LJ5d 3PVQA 2DXUA 2RQWA 2K79A 1Y71A 2CP0A 3ZBDA 4B9WA 1NEGA 4HT8A 1VQKT 4GY5A 1OX8A 2DAQA 3CCSA 1LVKA 2F1LA 2QA4T 3A5ZB 2A0FB 3CBOA 3CCRT 1ZSZC 3EG9A 1UJYA 3CD6A 4CC7A 1M5Q1 2CH4W 4V2SA 1DJ7B 3PMTA 2B8AA 2DKGA 2K5LA 3TCJA 2LCLA 3CXCS 1JJ2P 4N0AA 2E70A 2RA2A 2KVQG 2Y4YA 3JCMh 3G71Q 2D9TA 1RAAB 4C92E 2L8DA 4HKEA 3QG1A 2QQBA 3E19A 3X26B 2EQIA 2QI2A 3QO3A 3EG0A 4E47A 4DQ2A 2F2VA 3AHUA 1MMGA 4M78A 2LQWA 3BFMA 3VU3C 3TU4K 4LDWA 5CKFA 2O9SA 2JVVA 5CKDA 1SRMA 2J6FA 4M75F 1SRLA 2EFIA 2FHDA 1YITT 4M75B 3A1PA 2RJEA 1ZX6A 1TUGB 5KYWB 3I35A 3C95A 4JRIA 1YIJQ 2AIRB 1N8RR 3THKA 1XNIA 2XU8A 1TU0B 2DEUA 4JRKA 3CC7A 1BK2A 4FIBA 1YIJT 3EG2A 2OI3A 1ABOA 4ATOA 2M16A 1QCNA 1UGQB 2A3LA 2DVJA 5GAN8 1EIFA 3OSVA 2DL7A 2DNUA 3MCAB 1WHKA 4HA8A 1T0HA 1EX4A 1WLPB 1Q7YR 3G1JA 4IIOA 2CSQA 2RI2A 4RTZA 1RLPC 1TUCA 5CAIA 3M5AA 3LWIA 5I2SA 2LTOA 2ZCFB 4RKUE 3SHWA 2EPDA 3CCEQ 2JXBA 3A8GB
chains in the Genus database with same CATH topology
3TREA 1VQOT 2DTOA 2RH2A 5CVIA 3MEAA 2RHXA 2LX9A 2DO3A 4XTXA 3OMCA 1NJIU 1OI1A 4M75E 4XTVA 5A2QE 3CCET 3PTAA 1M1FA 2QQAA 2ZGWA 4N4HA 5GAN6 4E7HA 2ZPEB 5A0GA 2HQXA 2EQJA 2HQEA 3LGFA 5GAN2 4RMOA 4R56A 1NPRA 2E64A 3H8ZA 4C92A 4EDUA 2M9UA 1YI2T 2K5FA 2MWPA 2RHUA 2KAFA 3FDRA 2R5AA 4XK8E 5HY6A 3H6ZA 4KULA 4OGCA 4X34A 4ZGDB 3PT9A 5GANj 5CKEA 2VV5A 4A4FA 1NE8A 5J39A 3QDRB 5IAYA 2DTIA 5GAMj 3QJYA 3G6ET 3VYGA 3OSSC 5GANh 5GANf 4JRPA 2G3RA 3GPLA 1OYXA 4OGEA 1ZBXA 2EAYA 2WSCE 5GAMh 3QIIA 3OYFA 2Y90A 1YJNT 3X28B 4M7AD 3SDZA 2JN0A 4IURA 4EMKC 2CZ1B 4C92G 4KT0E 2X4JA 2X4WA 3VYHB 5A0DA 5DLQE 1N27A 2FB7A 3CMAA 5J3BA 3CCUT 1QVGS 4F7UE 2EJFA 4M75D 5GAOq 1M90U 3L2ZA 4J6XA 3OYLA 1BI0A 1VQLA 1QVFA 3UDCA 4BB7A 1S72T 3M4GA 4QVZA 1UGPB 4C0DB 4ELZC 2E5QA 1VQ8A 1RI0A 4JS4A 1P92A 1JB0E 1LNXA 3FEOA 4MDWA 2RI5A 2YHTA 1YITA 4PJOC 4E7KA 1JJ2A 3DLLA 2JNGA 1WGSA 2E12A 2VUBA 5GAN7 4R55A 2MF2A 3OYDA 2I2LA 1VQMT 1OZ3A 5DM7R 1KQ1A 2RB6A 3JCMW 2D0QB 2AHJB 3HPWA 2QTXA 1VQ5T 5LJ3e 1YIJA 5CKBA 2PVDB 3QBYA 4KBMB 1Q86C 4QQGA 3OYHA 1PSEA 3X20B 4D6WA 4NL2A 3CPWA 2OTJT 3M57A 2DD5A 2EQKA 4OB2B 4C5HA 1XOVA 5CK9A 5HK0A 5GAOm 1PSFA 3V7SA 3JB9D 3CC2A 3QPHA 2PVOB 1O9SA 3HFOA 4RCCA 3G71T 1KG1A 3M53A 3NFCA 4M7AA 1K8AU 4M77C 1M1KU 4P5NA 2KY9A 3CBPA 1QVPA 2LRQA 1SSFA 3L2WA 3SWNC 2DIQA 5GMKm 3OQ5A 2K2VA 5FU7C 3G7ZA 1KD1C 2E1HA 4QQ6A 4M75A 5GAOr 3BY7A 2V8IA 4MMLA 4XU3A 1Y96A 2GFAA 3QZ5B 2QQRA 4ZTJA 3PIOA 2K3YA 4TVRA 2KQWA 2CZ0B 4A4HA 1VQ6T 3MEUA 2KMTA 2R5MA 2JTFA 1Y96B 3P8HA 3JCMe 1QVGA 2XD0A 4M7AG 3BDUA 1M9SA 3PMIA 2DXCA 4A53A 1VQOA 3OS2A 4JJNK 3HP9A 3KBGA 3META 1I4K1 3VJPA 3OYJA 3CCEA 2WACA 3JB9I 2P0KA 4OB3B 5L8RE 4O5VA 4BE2A 1VQNT 5LJ3g 4M75G 4IUPA 3QZ9B 4PL6A 1G3TA 3RKWA 3LGLA 5GANd 3GP8A 2DXTA 3OYYA 2LT1A 5GMKe 1YI2A 1K73U 1AHJB 1OZ2A 4OVAA 4LDVA 4M7DC 3MO8A 4C8QF 4NL3A 5M9OA 4J5YA 2PU9B 2BIVA 1Y7XA 1W2BS 2VGNA 4C8QB 2PUOB 5FRNA 4F7UA 3QYHB 3DLMA 3G6EA 1H3ZA 3CMET 1YJNA 2VYTA 3CXCA 2H3JA 5GMKi 3GIBA 3GNFB 2KSSA 2PUKB 2Y4XA 5GAN5 4M77F 4BY6B 4C8QG 5HK3A 1HK9A 4UC4A 3LW5E 3CCUA 2VXEA 1Q7YC 5DY9A 3MEWA 1BKBA 2CZ7B 1VIFA 2EYQA 2L3RA 4LDUA 4XQ3A 5FU6C 4XTWA 2ZPFB 3SWNB 4BD3A 4J8OA 4F7UG 1Y07A 1YCYA 2E6ZA 2RJFA 1H641 3JCMg 4C5EA 3L2UA 3RESA 4BUGA 1S72A 1KHIA 3G4ST 1ZQ1A 1G3YA 4JRQA 4EMGA 3JB9G 4XTUA 2RJCA 3M9QA 1JRIA 3L2VA 3J7AF 4Y91A 2JZ2A 2EKOA 2QDYB 3EAEA 4J6YA 3FJPA 3LH0A 4N4GA 1G5VA 1BI2A 4KUDK 2IVWA 2VXFA 3OYMA 1VQMA 3C94A 4PJOE 4A4EA 3OYKA 1B34A 4Y28E 1VQ9T 1JBMA 5HKCA 3V7RA 3OYEA 2L5QA 2WSFE 3MEVA 1VQ5A 3HL8A 2XG8D 4ZGEB 4QVCA 4HCBA 4XAXB 1B34B 2RM4A 4L59A 5LJ5g 4M7DF 2M0OA 2LDMA 3FRNA 3Q1JA 4MZMA 3UT1A 2RI3A 2LCCA 3MP1A 1FXXA 2E6NA 4JLIA 4ZN3A 4M7DB 2OTJA 2FL7A 2HAXA 3CCVT 3M54A 1YJWT 1WJQA 5I2MA 4C8QE 3VUZA 1YJ9T 3HRTA 3I55T 2LQ8A 3G71A 5J26A 1WJRA 3JB9H 1NJIC 2RHYA 3V8KA 2K4YA 1XQHA 1VQ7T 1U1SA 3WVDB 2PVGB 3QSUA 3HRUA 4L6V5 4N0AC 1WQWA 2DZ9A 2RJDA 1FWZA 2VC8A 3SD4A 4C0FA 4EMHA 5KCOA 4M77E 4A54A 2EJGA 3ZFJA 3OY9A 3I56T 2HD0A 5GAN4 1VQ6A 4J7FA 2X4YA 2RO0A 3P8BB 3L42A 2LQKA 3OYCA 3S3MA 2GFUA 2YRVA 5LJ3j 1D3BA 5GAMe 2V8KA 1WPYA 4O6JA 1FX7A 1UGSB 5LJ3h 5LJ3f 2DK3A 4ME7A 2ZZDA 3M4YA 4JDSA 4M78C 3WXMB 1VQNA 1D3BB 4C8QD 1Q86U 3MHXA 5D6XA 4B9XA 3OYGA 2DEQA 1I5LA 4M75C 2QQ9A 4HT9A 1UEBA 2E10A 1VUBA 1X01A 2DXBA 2XHCA 3UWNA 3CCMT 4OP0A 2LC4A 3A8MB 5C0MA 1M90C 4YTLA 2IG0A 1YBYA 4BI4A 4OMFB 5KE3A 2CZ6B 4MZPA 3OW2S 1YHQT 4M77D 4EMKA 4BDZA 2C06A 3M59A 4FT4A 3CMEA 4M7DE 2RK2A 3BDLA 1I8FA 5CIUA 3VV0A 1U1TA 3EFRA 4IUUA 4JUVA 3DKMA 5LL6S 4IUQA 4EMKB 4XU2A 4NOYA 3VUBA 3NTIA 2DPPB 5GAOl 3URGA 1HXDA 1KHCA 1NPPA 3JCMJ 3JB9J 1BIBA 2RHZA 3CC4T 4RG2A 5CQYA 4MMKA 3SB2A 3JCMf 2X35A 2VGMA 3TEEA 4JS5A 2JUFA 5IT9E 5GANg 1V29B 4JLGA 3G4SA 2ZPBB 4IKFA 5GAMg 4PJOF 5GMKl 4RCBA 4XTZA 3M55A 5GMKj 1BI3A 2DZCA 2E41A 2EIFA 4PJOB 1N8RU 3OA6A 3NTKA 3V8LA 3KXTA 5GMKh 1WNLA 2HNIA 3OS5A 3QYGB 1KQ2A 4QW2A 3L1AA 4M78F 5EG2A 5CQXA 2LNVA 5KCHA 5DLOA 4HCZA 4C8QA 1K8AC 3CCST 1M1KC 1VQ9A 4M7DD 2DIGA 1WQ7A 2FYKA 2K3XA 2CGHA 3HFNA 4FL6A 4PJOG 3KUFA 1N6AA 3BW1A 5GAOn 2XI9A 5LJ5e 2MWOA 3CD6T 2EWNA 3VKIA 2QQSA 2KDSA 3NTHA 3SFMA 1U8RA 3CCVA 1K9MU 3OBYA 1YJWA 1Q82U 3HKSA 4M77A 5CKHA 3X25B 2LT4A 3I55A 1VQ4T 1YJ9A 3CPFA 3RERA 4C92C 3SWNA 5IN1A 3JCMb 1TH7A 2RHIA 3RMQA 4M77B 2M1HA 2DVEA 3P8DA 4X9CA 2LVMA 4A4GA 3JCMX 1VQ7A 1O75A 1UB4A 4J7IA 4E7JA 2DJZA 3L2RA 3F70A 1WJSA 3FLGA 3LWHA 5FU7B 3GNGA 4C0ZA 1VQPT 3JCMV 4N4IA 3DB4A 5LJ3d 1K73C 2QXFA 3QKJA 1N9SA 3I56A 3RIRA 2XDBA 1W4SA 2CKKA 2OAUA 4M77G 3J80E 3C12A 4EPCA 4OB1B 3S3OA 1KC8C 3CCJT 1XTDA 3JAME 4OB0B 4ZGJB 3OYBA 4LDYA 1MGQA 1M8VA 2EQUA 2F69A 5FLXE 3ME9A 4XU0A 2O4XA 3M56A 4C0GA 2JTMA 3PFSA 4C0DC 3JCMP 2P0QA 3DB3A 2DTHA 2XIDA 4CRIA 1M4ZA 4M7DA 3OS0A 4X9DA 4BE0A 2O4XB 1KQSS 2QEXA 3WVEB 2F5KA 1Q81C 4L5GA 3CCMA 2MMPA 2HBPA 4M78E 2QA4A 4FSXA 3CCRA 3GF5A 3CCQT 4E7IA 5AYFA 2K57A 3CBMA 1YHQA 4OF1A 1BIAA 2XDPA 3M58A 1LJOA 5CO7A 4QVDA 3JCMd 3CCLT 3CPWS 1VIEA 1W2BA 4IUVA 1NZ9A 4A4KA 3OYIA 3JRZA 3CC7T 3E9GA 4RG8A 4C92F 4M7DG 4MZTA 3PNWC 3N5BB 1G3SA 3JCMQ 4C92B 5D6YA 3QHSA 1I81A 1LOJA 2R57A 1QW1A 4J6WA 3CC4A 2XKOC 4PJOD 5GAOp 5FU6B 2A7YA 2MAMA 3EFSA 2FVUA 4BI3A 3ZEHA 4MDXA 3MP8A 1QP3A 3FB9A 3RKYA 5GAMf 4LD6A 3A8OB 5I21A 2OTLT 3LYIA 2XDDA 4E7LA 5GANe 4HCCA 2RK1A 3R6OA 4FT2A 4M7AC 3O8VA 2CYZB 5LJ5d 4M78D 2DXUA 2L89A 3RUXA 3ER0A 1Y71A 4BDYA 3CEYA 3ZBDA 4B9WA 3A8LB 3MP6A 4HT8A 1VQKT 2RD1A 2ZPGB 4GY5A 3S6WA 4NS5A 5CCAA 5GAN3 2QEXT 2DAQA 2X4XA 5C6SA 3CCSA 2JOYA 4PLIA 4C5GA 4ELYC 4DOWA 2QA4T 3A5ZB 3CBOA 3CCRT 3UPUA 4KUIA 3OMGA 2P0PA 2BKDN 2WSEE 3QXEB 2MI6A 2O01E 3CD6A 2CS7A 1G3WA 3QUIA 5FRMA 2V8JA 1M5Q1 3A8HB 2EQMA 3PGGA 1KD1U 3PIPA 4V2SA 1DJ7B 3OYAA 1KQSA 3PMTA 2B8AA 4ZTFA 3X24B 2GF7A 1VQ4A 2DKGA 3L2QA 2K5LA 1M1GA 3QJ6A 3T9NA 3TCJA 2LCLA 4C8QC 3CXCS 4N0AA 4DOVA 2E70A 3OYNA 2D6FA 2YLCA 2RA2A 2KVQG 2Y4YA 5D6WA 3JCMh 5KE2A 4II1A 2D9TA 1RL2A 4C92E 2L8DA 1VQPA 3OB9A 4HKEA 3QG1A 4PJOA 1BYMA 2QQBA 3E19A 3X26B 1BI1A 3HHTB 2QI2A 4DA4A 4BY6C 3QO3A 1IZ6A 4Q5WA 3C4SA 4E47A 5A0LA 2NLUA 4J83A 4DQ2A 3FC3A 3JSCA 3RMSA 3CCJA 3CMAT 3AHUA 4M7AF 4BI8B 4LD9K 4IUTA 4M78A 2YLBA 2XK0A 4GLKA 1R8OB 4PNOA 4M7AB 3BFMA 3VU3C 3TU4K 4LDWA 5KH6A 1VQLT 1UGRB 5CKFA 5LJ5j 2F5TX 2JVVA 2ZPHB 5CKDA 4M78B 4M75F 1X75C 3JCMc 2BUDA 1VQ8T 3HSBA 2EFIA 2FHDA 4WF2A 5LJ5f 5LJ5h 1N9RA 4C5IA 1YITT 2KK4A 4M75B 4LDXA 3LX7A 2ZPIB 2RJEA 4CI0C 2GCXA 3C95A 3ASKA 4JRIA 3CCQA 3GOXA 3E1SA 4M78G 4C92D 1Q7YU 3FIFA 4QQDA 4BE1A 1XNIA 1KC8U 3CCLA 2XU8A 4JRKA 3CC7A 4FM4B 4FIBA 5GAMd 2PQWA 1YIJT 1N8RC 4ATOA 3OW2A 2K5IA 2GQVA 2M16A 1QP2A 4ZN1A 3HRSA 4BACA 3GLXA 4VUBA 1UGQB 2A3LA 2XICA 3INZA 5GAN8 5FROA 1EIFA 3CC2T 3OSVA 1IREB 4F7UF 2EJ9A 3MCAB 2DD4A 4HA8A 3OS1A 3V7CA 4F7UB 2OTLA 1QVFS 3JB9F 1ZHIA 5CR2A 1X6OA 2RI2A 1MHNA 3OBWA 4PLLA 4PKCC 5CAIA 3M5AA 1GXIE 1K9MC 3LWIA 5I2SA 1Q82C 2LTOA 4Z02A 1Q81U 2ZCFB 4FU6A 4RKUE 4XTYA 3E9FA 3S3NA 2P4TA 3LLRA 3RKXA 1JJ2S 1VQKA 4M7AE 4XU1A 3V8JA 2E65A 3A8GB 2R58A 3J81E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7D C;  2DTO A;  4NOY A;  4C8Q F;  4NL3 A;  4M7A C;  5LJ5 d;  4J5Y A;  4M78 D;  2DXU A;  3RUX A;  4XTX A;  5GAO l;  3JCM J;  1HXD A;  4M75 E;  4XTV A;  4C8Q B;  3JB9 J;  1BIB A;  4F7U A;  2ZGW A;  5GAN 6;  3JCM f;  4MMK A;  3SB2 A;  5GAN 2;  4HT8 A;  4C92 A;  2E64 A;  2RD1 A;  5GAN 3;  5GMK i;  5GAN g;  3GIB A;  5GAM g;  4PJO F;  5GMK l;  5GAN 5;  4RCB A;  4M77 F;  4XTZ A;  4C8Q G;  1HK9 A;  5GMK j;  2DZC A;  2E41 A;  5GAN j;  4PJO B;  2VXE A;  2DTI A;  5DY9 A;  3V8L A;  5GAM j;  5GMK h;  3QUI A;  1WNL A;  2HNI A;  4XQ3 A;  1M5Q 1;  3SWN B;  3PGG A;  4XTW A;  5GAN f;  5GAN h;  4F7U G;  1KQ2 A;  4V2S A;  1YCY A;  2EAY A;  1H64 1;  3L1A A;  4M78 F;  3JCM g;  3RES A;  2Y90 A;  5GAM h;  4M7D D;  4C8Q A;  4M7A D;  2DKG A;  2JN0 A;  4EMK C;  3JB9 G;  1WQ7 A;  4C92 G;  4EMG A;  2FYK A;  2CGH A;  3HFN A;  4XTU A;  4PJO G;  1JRI A;  2FB7 A;  4Y91 A;  4C8Q C;  4N0A A;  4F7U E;  2YLC A;  2EJF A;  3BW1 A;  2RA2 A;  4M75 D;  5LJ5 e;  3JCM h;  2EWN A;  5GAO n;  4J6Y A;  3FJP A;  5GAO q;  3L2Z A;  4J6X A;  4C92 E;  2VXF A;  4PJO A;  4PJO E;  4M77 A;  3M4G A;  1B34 A;  1JBM A;  3V7R A;  3RER A;  4C92 C;  3SWN A;  3QO3 A;  1LNX A;  3JCM b;  2YHT A;  1TH7 A;  4QVC A;  4PJO C;  4M77 B;  4DQ2 A;  1B34 B;  2DVE A;  2RM4 A;  4X9C A;  5LJ5 g;  3JCM X;  3AHU A;  4M7D F;  4M7A F;  4M78 A;  2YLB A;  2DJZ A;  4JLI A;  4M7D B;  4M7A B;  4PNO A;  3BFM A;  3VU3 C;  5GAN 7;  3JCM V;  5LJ5 j;  5LJ3 d;  2I2L A;  4C8Q E;  4M78 B;  3JCM W;  1KQ1 A;  1N9S A;  2RB6 A;  4M75 F;  3RIR A;  3JCM c;  3HSB A;  4WF2 A;  5LJ5 f;  5LJ5 h;  2QTX A;  4M77 G;  1N9R A;  5LJ3 e;  4M75 B;  3JB9 H;  3V8K A;  1U1S A;  1MGQ A;  1M8V A;  4NL2 A;  3QSU A;  4JRI A;  4N0A C;  1WQW A;  2DZ9 A;  2VC8 A;  4XU0 A;  4EMH A;  4M78 G;  3V7S A;  4C92 D;  5GAO m;  3JB9 D;  4M77 E;  3FIF A;  3JCM P;  4A54 A;  2EJG A;  3HFO A;  2DTH A;  4RCC A;  5GAN 4;  4M7D A;  4X9D A;  4JRK A;  4M7A A;  4M77 C;  5GAM d;  3SWN C;  5LJ3 j;  4M78 E;  1D3B A;  5GMK m;  5GAM e;  2E1H A;  1WPY A;  3INZ A;  4M75 A;  2K57 A;  5LJ3 h;  3BY7 A;  5LJ3 f;  4MML A;  4XU3 A;  5GAN 8;  5GAO r;  4M78 C;  1Y96 A;  1BIA A;  1D3B B;  4C8Q D;  3JCM d;  1LJO A;  4F7U F;  4QVD A;  2EJ9 A;  2DEQ A;  1I5L A;  4M75 C;  4HA8 A;  3V7C A;  4F7U B;  2E10 A;  1Y96 B;  3JB9 F;  3JCM e;  4C92 F;  4HT9 A;  4M7D G;  1X01 A;  4M7A G;  3BDU A;  4OP0 A;  4A53 A;  3JCM Q;  4C92 B;  3QHS A;  5CAI A;  1I4K 1;  1I81 A;  3JB9 I;  1LOJ A;  4J6W A;  4XTY A;  4PJO D;  5GAO p;  4M77 D;  3RKX A;  4M75 G;  4EMK A;  5LJ3 g;  3EFS A;  3RKW A;  5GAN d;  4M7D E;  2DXT A;  3FB9 A;  4M7A E;  4XU1 A;  1I8F A;  3RKY A;  3V8J A;  1U1T A;  2E65 A;  3EFR A;  4JUV A;  5GAM f;  5I21 A;  5GMK e;  5GAN e;  4EMK B;  4XU2 A; 
#chains in the Genus database with same CATH topology
 1RAH B;  1ZSG A;  2RHX A;  2CP5 A;  3CCE T;  2QQA A;  4KGX B;  2HQX A;  2EQJ A;  1NPR A;  3H8Z A;  5HY6 A;  4KUL A;  3CCV Q;  4Z88 A;  1PRL C;  3PT9 A;  5GAN j;  4A4F A;  1YJ9 Q;  2DTI A;  3G6E T;  1D0Y A;  2YSQ A;  4AG1 C;  1NM7 A;  4OGE A;  3OYF A;  1YJN T;  3QII A;  2Y90 A;  3X28 B;  4M7A D;  2JN0 A;  4KT0 E;  3VYH B;  1BBZ A;  5A0D A;  1WHM A;  3CCU T;  2EJF A;  3I56 Q;  4WTO B;  2CP6 A;  1QCO A;  1UUE A;  3M0P A;  3UDC A;  1S72 T;  4QVZ A;  1UGP B;  2E3I A;  4C0D B;  1RI0 A;  4MDW A;  2YHT A;  2DE0 X;  3DLL A;  2JNG A;  1OZ3 A;  2XMF A;  2D0Q B;  2AHJ B;  3HPW A;  3EFO B;  3GBQ A;  4KBM B;  3X20 B;  2C0O A;  3CPW A;  3M57 A;  5GAO m;  4DBR A;  2LX7 A;  2DRM A;  2PVO B;  1KD1 R;  4F04 B;  4LXC A;  4FYV B;  1K8A U;  1I0C A;  3CC4 Q;  4P5N A;  1M1K U;  1G83 A;  3SWN C;  5GMK m;  2JT4 A;  2BTT A;  4M75 A;  5GAO r;  2V8I A;  4XU3 A;  1Y96 A;  2K3Y A;  1HSQ A;  2JS2 A;  3MEU A;  2R5M A;  1QVG A;  4M7A G;  1T3L A;  2DXC A;  4A53 A;  3MET A;  3OYJ A;  1KSW A;  3CCS Q;  5L8R E;  1AZE A;  2EYX A;  3RKW A;  1TTH B;  2DXT A;  1YI2 A;  2P84 A;  4LDV A;  4C8Q F;  4NL3 A;  3CME Q;  5M9O A;  2PU9 B;  1Y57 A;  4C8Q B;  2J6K A;  1H3Z A;  3CME T;  2VYT A;  2KNB B;  5GMK i;  3GIB A;  3GNF B;  2QAS A;  2PUK B;  5GAN 5;  4ANJ A;  4BY6 B;  4RTU A;  3EGU A;  1S1N A;  3REB B;  6AT1 B;  3M0R A;  4XQ3 A;  4LDU A;  1KC8 C;  4XTW A;  4J8O A;  4F7U G;  3KFV A;  1NLO C;  1FMV A;  1ZQ1 A;  1G3Y A;  1RI9 A;  4XTU A;  2RJC A;  3M9Q A;  1LCK A;  1VQ9 Q;  2RF0 A;  2JZ2 A;  2EKO A;  2YWW A;  4A63 B;  3LH0 A;  1G5V A;  2EKH A;  1Q81 R;  1VQM A;  1VQ9 T;  4Y28 E;  7AT1 B;  3MEV A;  4GLM A;  1VQ5 A;  2XG8 D;  1YJW Q;  1M30 A;  1B34 B;  1TSF A;  2RM4 A;  3Q1J A;  4FSS A;  4KH1 B;  2A36 A;  3UT1 A;  3MP1 A;  2E4H A;  3CC7 Q;  2HAX A;  1VA7 A;  3M54 A;  2J06 A;  1YJW T;  1WJQ A;  1VQ7 Q;  1HD3 A;  2QTV A;  2AZS A;  3I5S A;  1WJR A;  2ATC B;  2RHY A;  1VQ7 T;  1U1S A;  2MOX A;  2PVG B;  3SD4 A;  4EMH A;  2CUB A;  2VC8 A;  5KCO A;  4M77 E;  2YXY A;  2HD0 A;  5IHK A;  3L42 A;  2HBW A;  3S3M A;  5LJ3 j;  2YRV A;  1D3B A;  1TOV A;  2JTE A;  3H0F A;  4O6J A;  2VKN A;  4JDS A;  1VQN A;  4QKU A;  3OYG A;  1IB8 A;  2CT3 A;  4M75 C;  2DLP A;  2LCS A;  4CC2 A;  4J9D A;  2LC4 A;  3A8M B;  5C0M A;  5KE3 A;  2CZ6 B;  4MZP A;  1IGQ A;  2HMA A;  4EMK A;  4EIK A;  4M7D E;  5CIU A;  4IUU A;  5LL6 S;  4RTT A;  3VUB A;  2BE9 B;  3NTI A;  5GAO l;  2V1R A;  5GJV B;  1NPP A;  1BIB A;  1KQS P;  4RG2 A;  2VGM A;  5IT9 E;  4DEY A;  5GAM g;  5GMK l;  2KXC A;  4XTZ A;  2DZC A;  2EIF A;  3OA6 A;  3NTK A;  1WNL A;  3OS5 A;  4PJJ A;  5CQX A;  4AFS C;  4C8Q A;  2FYK A;  5AT1 B;  4FL6 A;  1OU8 A;  3KUF A;  1N6A A;  2EYY A;  2MWO A;  2EWN A;  3VKI A;  2KDS A;  5HCK A;  3RER A;  4C92 C;  4CC4 B;  1VQP Q;  5IN1 A;  4M77 B;  1SKU B;  1UB4 A;  1TXQ A;  1K1Z A;  2VWF A;  4E2F B;  4E7J A;  2DJZ A;  4RTX A;  1WJS A;  3EG1 A;  1VQP T;  3JCM V;  2FPF A;  1K73 C;  3C12 A;  5FWB A;  3JAM E;  1M8V A;  1ABQ A;  2EQU A;  2K7A A;  3ME9 A;  4C0G A;  3ZL7 C;  4C0D C;  2P0Q A;  2DTH A;  2O4X B;  4D8K A;  2F5K A;  2MMP A;  1IRX A;  4M78 E;  5I22 A;  4FSX A;  3CCR A;  2QA4 A;  4E7I A;  5AYF A;  2KXD A;  2K57 A;  4DBF A;  4RUG A;  1GCQ C;  3CPW S;  1W2B A;  1NZ9 A;  1OPL A;  3JRZ A;  4E6R A;  1G3S A;  3JCM Q;  5D6Y A;  1AVZ C;  1I81 A;  1LOJ A;  1IO6 A;  2JS0 A;  1UGV A;  5GAO p;  2I0N A;  2O9V A;  2FVU A;  3MPU B;  4MDX A;  2L89 A;  3RUX A;  1AWX A;  4E7S A;  1AEY A;  3ER0 A;  4BDY A;  3A8L B;  2QEX T;  2JM8 A;  4NS5 A;  5CCA A;  1TWB A;  5GAN 3;  5C6S A;  2ECZ A;  4ELY C;  3UPU A;  3OMG A;  2BKD N;  2MI6 A;  5FRM A;  3A8H B;  3PGG A;  1VQ5 Q;  3OYA A;  1MND A;  4ZTF A;  1Q86 R;  3L2Q A;  1AWJ A;  3QJ6 A;  3T9N A;  4AFU C;  2D0N A;  2DFU A;  3EGX A;  4C8Q C;  1EFN A;  3OYN A;  5D6W A;  5KE2 A;  1D0Z A;  4FYW B;  3OB9 A;  2ED0 A;  1BYM A;  3RNJ A;  2EBP A;  1B7T A;  4JJB A;  4BY6 C;  3RDV A;  3C4S A;  3CCJ A;  4BI8 B;  1T0J A;  1R8O B;  4PNO A;  1VYV A;  4M78 B;  1X75 C;  3HSB A;  1VQ8 T;  4WF2 A;  5LJ5 f;  5LJ5 h;  3R6N A;  1N9R A;  1YP5 A;  3LX7 A;  4PFZ A;  3CCQ A;  3ASK A;  2NYS A;  4C92 D;  3FIF A;  1KC8 U;  5L23 A;  3EH2 A;  1N8R C;  3OW2 A;  2GQV A;  1QP2 A;  2HSP A;  3HRS A;  4BAC A;  3GLX A;  2X51 A;  1IRE B;  2VAS A;  1K9M R;  2EJ9 A;  1YWP A;  3OS1 A;  2L3S A;  3V7C A;  1QVF S;  3JB9 F;  4JJD A;  1AD5 A;  1CSK A;  5KYN A;  1UTI A;  1JEG A;  1LPL A;  1GXI E;  2CUD A;  1TUD A;  4FU6 A;  3E9F A;  1B07 A;  2P4T A;  3LLR A;  1H3H A;  4XU1 A;  3V8J A;  4OB0 B;  2NWM A;  1VQO T;  2DO3 A;  3OMC A;  4M75 E;  2ZGW A;  3NMZ C;  5GAN 6;  2PTK A;  1YN8 A;  4E7H A;  1M3C A;  3LGF A;  5GAN 2;  4KRT A;  2E64 A;  2V1Q A;  2M9U A;  3FDR A;  2LJ0 A;  4OGC A;  4ZGD B;  2K3B A;  4PK4 A;  1X27 A;  1PKT A;  2QGF B;  5CKE A;  5J39 A;  3H9N A;  3QJY A;  5GAM j;  1RAF B;  2G3R A;  2DYB A;  4F17 A;  2JM9 A;  3SDZ A;  2CZ1 B;  4C92 G;  2QDL A;  1WXB A;  5DLQ E;  1N27 A;  3CMA A;  5ECA A;  3U23 A;  1W6X A;  3L2Z A;  3H0H A;  1VQL A;  1D1B A;  1BI0 A;  2CSI A;  3M4G A;  2LJ1 A;  2DJQ A;  1FMW A;  4JS4 A;  2RI5 A;  4R0K A;  4E7K A;  1ARK A;  4OMQ A;  1JJ2 A;  2E12 A;  4R55 A;  3OYD A;  3JCM W;  2OTJ Q;  2KR3 A;  5CKB A;  1PSE A;  4NL2 A;  2OTJ T;  2EQK A;  4ESR A;  4C5H A;  1GCP A;  3O5Z A;  3CC2 A;  1O9S A;  2CDT A;  3HFO A;  3G71 T;  4D8D A;  1KG1 A;  4M77 C;  2KY9 A;  4ZNX A;  2LRQ A;  1SSF A;  4HXJ A;  2KRM A;  2DBK A;  3OQ5 A;  1KD1 C;  1H8K A;  1E6H A;  2GFA A;  1PKS A;  2KQW A;  4A4H A;  1NLP C;  3P8H A;  1Y96 B;  3BDU A;  2RMO A;  3HP9 A;  1I4K 1;  3A98 A;  1EZZ B;  3VJP A;  2PZ1 A;  4O5V A;  5LJ3 g;  4PL6 A;  4IUP A;  3QZ9 B;  9ATC B;  1G3T A;  3LGL A;  1UEC A;  4OMN A;  1NEB A;  1K73 U;  4OVA A;  2KGT A;  4M7D C;  1W2B S;  2DX1 A;  4X1V A;  2H3J A;  2KSS A;  4C8Q G;  2J05 A;  3G4S Q;  1UDL A;  2VXE A;  5DY9 A;  2EYQ A;  1YFN A;  3L2U A;  3JCM g;  1NBE B;  3G4S T;  3L2V A;  4Y91 A;  2YUO A;  2QDY B;  2DL5 A;  4KUD K;  2IVW A;  2VXF A;  3OYM A;  4PJO E;  4A4E A;  1JBM A;  1MV0 B;  1U06 A;  5HKC A;  3OYE A;  2F2X A;  2L5Q A;  1QWE A;  4QVC A;  3I55 Q;  3FRN A;  1F1B B;  1NJI R;  2E6N A;  1G8X A;  2FL7 A;  3CCV T;  2BZY A;  2HKQ B;  1PWT A;  5I2M A;  4C8Q E;  1YJ9 T;  3I55 T;  2LQ8 A;  2D8H A;  5I11 A;  1AT1 B;  2EGA A;  1R0C B;  5D7U A;  1MMA A;  1QLY A;  4N0A C;  1WQW A;  2DZ9 A;  1JO8 A;  3I56 T;  5GAN 4;  1RUW A;  1VQ6 A;  2RO0 A;  2YRC A;  1GFC A;  2CP3 A;  2DK3 A;  4ME7 A;  2ZZD A;  2ABL A;  4M78 C;  1M90 R;  1D3B B;  5D6X A;  2KYM A;  2V26 A;  2OJ2 A;  1X01 A;  3JV3 A;  2IG0 A;  1X69 A;  3OW2 S;  1UHC A;  4M77 D;  1H92 A;  3VV0 A;  1SSH A;  3DKM A;  4EMK B;  2DPP B;  1KHC A;  3CC4 T;  5CQY A;  2X35 A;  3CMA Q;  2DET A;  2ZPB B;  4PJO F;  1R77 A;  3VRZ A;  1B3Q A;  4JZ3 A;  4RCB A;  2RNA A;  4PJO B;  1N8R U;  3CPW P;  5GMK h;  1BCO A;  3QYG B;  3L1A A;  5KCH A;  4M7D D;  4HCZ A;  1W1F A;  2CP7 A;  3CCS T;  3PE0 A;  3CD6 Q;  1WQ7 A;  2CGH A;  2BZ8 A;  2C0I A;  3VS0 A;  2IPO B;  5LJ5 e;  3CD6 T;  3NTH A;  1I07 A;  1M3A A;  1U8R A;  3TSW A;  4FW1 A;  2AKL A;  5CKH A;  2LT4 A;  3TSZ A;  2MCN A;  3CC2 Q;  3JCM X;  4J7I A;  1ZA1 B;  5FU7 B;  2KT1 A;  3DB4 A;  1QWF A;  8ATC B;  3QKJ A;  1N9S A;  2FG0 A;  3RIR A;  2XDB A;  1W4S A;  2CKK A;  4M77 G;  2B86 A;  3S3O A;  2IIM A;  1OPK A;  1MGQ A;  2KI7 A;  4XU0 A;  5IH2 A;  1WDX A;  3JCM P;  3PVL A;  4X9D A;  3NPF A;  2QEX A;  2EYW A;  4L5G A;  3CCM A;  2QK0 A;  3GF5 A;  4KGZ B;  4ORZ A;  3CBM A;  1YHQ A;  2HCK A;  1LJO A;  5CO7 A;  3CC7 T;  4IUV A;  2EVR A;  4M7D G;  1N5Z A;  4MZT A;  4F14 A;  3N5B B;  3QHS A;  2VVK A;  2DF6 A;  2XKO C;  3VS7 A;  5FU6 B;  2MAM A;  1NYG A;  3ZEH A;  3MP8 A;  1QP3 A;  1BU1 A;  5GAM f;  4E7L A;  4HCC A;  3R6O A;  4FT2 A;  1GBR A;  4M78 D;  1WXT A;  1A0N B;  3EH1 A;  2QG9 B;  3CEY A;  4CC3 A;  1SPK A;  2E3H A;  3UAT A;  3S6W A;  1RAC B;  2HQH A;  1X6G A;  2RQR A;  4PLI A;  2P0P A;  3QXE B;  2O01 E;  1G3W A;  2V8J A;  1QVF P;  1KD1 U;  3PIP A;  1KQS A;  1VQ4 A;  4OMP A;  2DM1 A;  3H0I A;  1OV3 A;  1IHW A;  2Z0W A;  5EC7 A;  2K9G A;  4DOV A;  2D6F A;  1KIK A;  1K4U S;  3EGX B;  1RL2 A;  1JU5 C;  4PJO A;  4DA4 A;  2A28 A;  4Q5W A;  3RR6 A;  1ACM B;  4M7A F;  4LD9 K;  4IUT A;  2XK0 A;  4GLK A;  4J9E A;  4M7A B;  1VQ6 Q;  4LE9 A;  5KH6 A;  1QMC A;  2ESW A;  2QYZ A;  1MMD A;  2F5T X;  2ZPH B;  4OMO A;  4PFO A;  2BUD A;  4C5I A;  2KK4 A;  4GBQ A;  4CI0 C;  1V1C A;  2GCX A;  3EGD B;  3E1S A;  1ZSZ B;  4M78 G;  4QQD A;  4BE1 A;  3CCL A;  4FM4 B;  5GAM d;  2PQW A;  2K5I A;  2YUQ A;  1NG2 A;  4ZN1 A;  1AWO A;  2G6F X;  1D1C A;  2CRE A;  5FRO A;  2D1X A;  1AZG B;  4F7U F;  2YDL A;  1K0S A;  2DD4 A;  3REA B;  4F7U B;  2OTL A;  1ZHI A;  2HDA A;  2KE9 A;  1K9M C;  1Q82 C;  4Z02 A;  1Q81 U;  4XTY A;  3CXC P;  3RKX A;  1VQK A;  2RPN A;  4PFP A;  2ZAE A;  1YNZ A;  1ZLM A;  2DTO A;  2LJ3 A;  5CVI A;  3MEA A;  1M2V A;  2LX9 A;  1YI2 Q;  1M1F A;  4N4H A;  2ZPE B;  5A0G A;  1X6B A;  3AT1 B;  4EDU A;  1PM3 A;  1YI2 T;  1OU9 A;  2K5F A;  2MWP A;  2KAF A;  2RHU A;  2R5A A;  2VB6 A;  3H6Z A;  2DL4 A;  4X34 A;  2MK5 A;  2VV5 A;  5IHN A;  1NE8 A;  5IAY A;  1X2Q A;  1WZO A;  5GAN f;  5GAN h;  4JRP A;  1OYX A;  1I1J A;  2WSC E;  2DL8 A;  4EMK C;  2DBM A;  1W70 A;  1RAD B;  1WYX A;  1QVG S;  4M75 D;  1WHJ A;  2QGG A;  1R0B G;  5KYY B;  4ELZ C;  1W2B P;  2E5Q A;  1P92 A;  1JB0 E;  3FEO A;  3NHN A;  4WCI A;  5FW9 A;  1YIT A;  4PJO C;  1VQM Q;  2RQT A;  2FPD A;  5GAN 7;  2VUB A;  1T3S A;  1WHH A;  2I2L A;  3CCM Q;  4FYY B;  1VQM T;  1U3O A;  2DYI A;  1KQ1 A;  1VQ5 T;  1YIJ A;  2PVD B;  1YHQ Q;  5CK9 A;  4J9F A;  5HK0 A;  1J3T A;  4PJN A;  1XJW B;  2W0Z A;  1Q95 G;  4RCC A;  3M53 A;  4M7A A;  3BE3 A;  2GBQ A;  3L2W A;  2DIQ A;  5FU7 C;  2E1H A;  3BY7 A;  4MML A;  3QZ5 B;  4TVR A;  3EGD A;  1ZSZ A;  1VQN Q;  1M9S A;  3PMI A;  1WHG A;  1PNJ A;  3KBG A;  1HYO A;  3CCE A;  2WAC A;  3JB9 I;  4OB3 B;  4BE2 A;  1VQN T;  4M4Z A;  4M75 G;  5GAN d;  3OYY A;  2LT1 A;  5GMK e;  2LNH B;  1OZ2 A;  3MO8 A;  1UE9 A;  1VQ4 Q;  5FRN A;  4F7U A;  1JQQ A;  3G6E A;  2LQN A;  2FRW A;  1YJN A;  2KRO A;  5HK3 A;  1U5S A;  2DMO A;  3CCU A;  1Q7Y C;  2HL5 C;  1BKB A;  3MEW A;  5FU6 C;  2RQV A;  3SWN B;  2XD0 A;  1VYT A;  2ZPF B;  1Y07 A;  1YCY A;  2E6Z A;  4C5E A;  1H64 1;  3RES A;  3I9Q A;  4BUG A;  1S72 A;  1KHI A;  4JRQ A;  4EMG A;  3OW2 P;  1JRI A;  1C6V X;  1AOJ A;  3FJP A;  2KT8 A;  4DEX A;  3OYK A;  4JZ4 A;  4JJC A;  3V7R A;  2WSF E;  2ROL A;  3HL8 A;  4ZGE B;  4HCB A;  1SF9 A;  5LJ5 g;  4L59 A;  2HKN A;  2LDM A;  2RI3 A;  4ZN3 A;  2L0A A;  2FEI A;  4AFQ C;  5FWC A;  1NJI C;  1XQH A;  2HEQ A;  5KYY A;  3LH5 A;  3TVT A;  2M02 A;  3M0Q A;  4A54 A;  3OY9 A;  3P8B B;  1OX9 A;  4Z8A A;  3OYC A;  1WA7 A;  5GAM e;  1VQK Q;  2GGR A;  1FX7 A;  3M0T A;  5LJ3 h;  5LJ3 f;  3M4Y A;  1KK7 A;  2J7I A;  4C8Q D;  4DBH A;  3MHX A;  3CCR Q;  2QA4 Q;  1Q86 U;  2DEQ A;  3M0U A;  1GRI A;  1UEB A;  2E10 A;  2DXB A;  2XHC A;  2OAW A;  4OP0 A;  1M90 C;  4BI4 A;  4OMF B;  3VS2 A;  1MMN A;  4LUE A;  3CME A;  2KBT A;  1U1T A;  4IUQ A;  1WHL A;  4NOY A;  4FYX B;  2O31 A;  3JCM J;  2RHZ A;  3MKD A;  3JCM f;  4MMK A;  3TEE A;  8AT1 B;  2GTO A;  1QKX A;  1K8A R;  1M1K R;  1BI3 A;  2E41 A;  1VYU A;  3HTR A;  3V8L A;  1D0X A;  2HNI A;  2YUP A;  1YIT Q;  2K2M A;  5EG2 A;  2MPX C;  2LNV A;  5DLO A;  4E7Z A;  3H41 A;  1VQ9 A;  1GFD A;  2X3X D;  2DIG A;  2K3X A;  3HFN A;  4PJO G;  2NUT A;  4FCY A;  4J9G A;  1IGU A;  3VS5 A;  5GAO n;  1SHF A;  1PC0 A;  1K9M U;  3OBY A;  1YJW A;  1Q82 U;  2JMA A;  1X2K A;  2AKK A;  3SWN A;  2M0Y A;  4IIM A;  3RMQ A;  4X9C A;  4A4G A;  1VQ7 A;  1O75 A;  1K76 A;  3FLG A;  3CCJ Q;  4C0Z A;  4N4I A;  5LJ3 d;  2QXF A;  3J80 E;  4Y92 A;  4EPC A;  4OB1 B;  2KRS A;  1XTD A;  4JPB W;  3CCJ T;  4LDY A;  4B6M A;  1OOT A;  1JXO A;  2F69 A;  4LN2 A;  2PNI A;  2ED1 A;  1RAI B;  2JTM A;  1WIE A;  3DB3 A;  3CCQ Q;  2XID A;  2LP5 A;  3OS0 A;  4DBQ A;  1SG5 A;  1Q81 C;  3CCQ T;  2MIO A;  4F16 A;  2NUZ A;  4OF1 A;  2XDP A;  3M58 A;  4QVD A;  3JCM d;  2O88 A;  4C92 F;  3G6E Q;  3VS4 A;  1UJ0 A;  4C92 B;  1YJN Q;  3D7S B;  1QW1 A;  1OQK A;  5KYU A;  4BI3 A;  1SEM A;  2COZ A;  3FB9 A;  3RKY A;  4RTV A;  4LD6 A;  3A8O B;  3CCU Q;  4OML A;  2XDD A;  5GAN e;  1K9A A;  4HCK A;  2CYZ B;  1S72 Q;  1FMK A;  1E7O A;  2FZK B;  3MP6 A;  2RD1 A;  2ZPG B;  2X4X A;  1Z9Q A;  2JOY A;  4C5G A;  4DOW A;  1VOM A;  2OX7 A;  4KUI A;  2L3Q A;  2EW3 A;  4AMC A;  2H8H A;  2WSE E;  2CS7 A;  3QUI A;  2EQM A;  4RTY A;  1M3B A;  3X24 B;  2GF7 A;  1M1G A;  1G2B A;  2FZG B;  3UF4 A;  4PJL A;  2FRY A;  2YLC A;  1PD1 A;  4II1 A;  3I5R A;  1VQP A;  1Z9Z A;  1BI1 A;  3HHT B;  1VQL Q;  1IZ6 A;  5A0L A;  2NLU A;  4J83 A;  4PJM A;  3FC3 A;  3JSC A;  3RMS A;  3CMA T;  2YLB A;  2COW A;  2GQI A;  1VQL T;  1UGR B;  5LJ5 j;  3JCM c;  4LDX A;  5KYW A;  3NGP A;  2ZPI B;  1KFZ A;  3GOX A;  2YUN A;  1PG5 B;  1Q7Y U;  2HL3 A;  1QVG P;  4AG2 C;  1YWO A;  3VRY A;  2X3W D;  4FW2 A;  2GTJ A;  1CKB A;  2KRN A;  2RN8 A;  4VUB A;  1KJW A;  4K11 A;  3INZ A;  2XIC A;  2CH4 A;  1AWW A;  3CC2 T;  2L2P A;  1RAE B;  5CR2 A;  1X6O A;  1MHN A;  3OBW A;  4PLL A;  2SRC A;  4PKC C;  3EG3 A;  3S3N A;  1JJ2 S;  4M7A E;  1BCM A;  2E65 A;  2R58 A;  3J81 E;  3TRE A;  2RH2 A;  4XTX A;  1NJI U;  1OI1 A;  4XTV A;  5A2Q E;  1WFW A;  3PTA A;  1TS9 A;  1M2V B;  2HQE A;  3EHQ A;  4RMO A;  1OUL A;  4C92 A;  4R56 A;  2E5K A;  2AT1 B;  3C0C A;  1QKW A;  4XK8 E;  3QDR B;  3VYG A;  3OSS C;  3GPL A;  1ZBX A;  2EAY A;  5GAM h;  4J9B A;  4IUR A;  2X4J A;  2X4W A;  2FB7 A;  5J3B A;  2DIL A;  4F7U E;  1BB9 A;  5GAO q;  1M90 U;  4J6X A;  3OYL A;  1QVF A;  4BB7 A;  1YCS B;  1VQ8 A;  1QCF A;  2X9H A;  1LNX A;  2COY A;  1MUZ A;  5GJW B;  4HVV A;  1WI7 A;  2RQU A;  1GCQ A;  1WGS A;  1ZBJ A;  3EFO A;  2MF2 A;  2YRD A;  3FJ5 A;  5DM7 R;  2RB6 A;  2QTX A;  5LJ3 e;  3VS1 A;  2BZX A;  3QBY A;  2EGE A;  3MJX A;  4QQG A;  4D6W A;  3OYH A;  1Q86 C;  1SHG A;  2DD5 A;  4OB2 B;  1XOV A;  3QWY A;  3JB9 D;  1PSF A;  3V7S A;  2LZ6 B;  3QPH A;  5IXB A;  3NFC A;  3ULR B;  1PCX A;  3CBP A;  1QVP A;  2K2V A;  3G7Z A;  4QQ6 A;  2J6O A;  2AZV A;  2QQR A;  4ZTJ A;  3PIO A;  4HVW A;  1UG1 A;  2CZ0 B;  1VQ6 T;  2KMT A;  2JTF A;  1D1A A;  3JCM e;  1ZUU A;  1VQO A;  3OS2 A;  1C1A A;  1PHT A;  3VS3 A;  5KYX B;  4JJN K;  2FPE A;  1M27 C;  2P0K A;  1E6G A;  1UFF A;  3GP8 A;  1RAB B;  1M8M A;  1AHJ B;  2M51 A;  2F2W A;  4J5Y A;  2BIV A;  2C0T A;  1Y7X A;  2VGN A;  2PUO B;  3QYH B;  3DLM A;  1CKA A;  3RBB B;  1IHV A;  3CXC A;  2FZC B;  2YT6 A;  1KC8 R;  2DL3 A;  2Y4X A;  4M77 F;  1HK9 A;  3UA6 A;  4UC4 A;  1M2O A;  3LW5 E;  1PD0 A;  4J9I A;  2CZ7 B;  1VIF A;  2L3R A;  4BD3 A;  1C0M A;  2RJF A;  2JJ9 A;  1RLQ C;  3JB9 G;  3J7A F;  3EAE A;  4J6Y A;  4N4G A;  3M0S A;  1BI2 A;  3C94 A;  4KGV B;  1B34 A;  3CQT A;  3IQL A;  4XAX B;  2JMC A;  4M7D F;  2JW4 A;  2M0O A;  4MZM A;  2K6D A;  2LCC A;  4JLI A;  1FXX A;  4M7D B;  4Z89 A;  2OTJ A;  4HVU A;  3VUZ A;  3HRT A;  2MYS A;  2CT4 A;  3G71 A;  2ENM A;  5J26 A;  3JB9 H;  3V8K A;  2K4Y A;  2NUP B;  3WVD B;  4QT7 A;  2AK5 A;  3QSU A;  1PRM C;  1NYF A;  3HRU A;  4L6V 5;  2RJD A;  1FWZ A;  4C0F A;  2EJG A;  3ZFJ A;  4J7F A;  2X4Y A;  4AT1 B;  2LQK A;  2GFU A;  2QEX Q;  2V8K A;  2DER A;  1WPY A;  1UGS B;  3QDF A;  2CP2 A;  3WXM B;  2EYZ A;  4B9X A;  2A37 A;  3SEM A;  1RAG B;  1I5L A;  1JXM A;  2QQ9 A;  2P4R A;  4HT9 A;  1VUB A;  3UWN A;  3CCM T;  2GNC A;  4YTL A;  1YBY A;  4LUD A;  1K0X A;  2KYB A;  1YHQ T;  2A08 A;  3EHR A;  4BDZ A;  2C06 A;  1WX6 A;  3M59 A;  4FT4 A;  3EG9 B;  2RK2 A;  3BDL A;  1I8F A;  3EFR A;  4JUV A;  3TQ7 P;  2FO0 A;  4XU2 A;  3URG A;  1HXD A;  3JB9 J;  1TG0 A;  2KEA A;  4J9C A;  3SB2 A;  3QWX X;  4JS5 A;  5KYX A;  2JUF A;  4J9H A;  5GAN g;  1V29 B;  2EGC A;  4JLG A;  3G4S A;  4IKF A;  2HZY A;  3M55 A;  5GMK j;  1V76 A;  2SEM A;  3KXT A;  1VQ8 Q;  1KQ2 A;  2O2O A;  4QW2 A;  1GL5 A;  4M78 F;  1K8A C;  1X43 A;  4LNP A;  1M1K C;  1GBQ A;  3BW1 A;  2XI9 A;  2NUT B;  2QQS A;  2BE7 D;  3SFM A;  3UA7 A;  3CCV A;  3HKS A;  4M77 A;  3X25 B;  1VQ4 T;  2HSE B;  3I55 A;  1YJ9 A;  3E2U A;  3CPF A;  5IHI A;  4OMM A;  2LMJ A;  3JCM b;  1K73 R;  1TH7 A;  2RHI A;  2M1H A;  2DVE A;  3P8D A;  1ZUK A;  1ZA2 B;  2LVM A;  3L2R A;  3F70 A;  3LWH A;  1FYN A;  3GNG A;  3I56 A;  2OAU A;  1WXU A;  1Q82 R;  2H3E B;  2W10 A;  2QAZ A;  4ZGJ B;  3OYB A;  1MNE A;  5FLX E;  2O4X A;  3M56 A;  3PFS A;  1OEB A;  1VQO Q;  4CRI A;  1I5O B;  3VS6 A;  1M4Z A;  4M7D A;  4BE0 A;  1KQS S;  4RTW A;  3WVE B;  3CCL Q;  1IXD A;  2HBP A;  2D8J A;  1D09 B;  2NUP A;  1BIA A;  1HJD A;  2DA9 A;  3CCL T;  1ZUY A;  2L3P A;  1VIE A;  4A4K A;  1UHF A;  3OYI A;  3E9G A;  4RG8 A;  3PNW C;  2ROT A;  1Y0M A;  1QQJ A;  2OTL Q;  2R57 A;  4J6W A;  5IXF A;  3CC4 A;  4PJO D;  1MV3 A;  2A7Y A;  3EFS A;  5I21 A;  4AFZ C;  2OTL T;  3LYI A;  5KYU B;  4KH0 B;  2RK1 A;  4M7A C;  2DRK A;  3O8V A;  5LJ5 d;  3PVQ A;  2DXU A;  2RQW A;  2K79 A;  1Y71 A;  2CP0 A;  3ZBD A;  4B9W A;  1NEG A;  4HT8 A;  1VQK T;  4GY5 A;  1OX8 A;  2DAQ A;  3CCS A;  1LVK A;  2F1L A;  2QA4 T;  3A5Z B;  2A0F B;  3CBO A;  3CCR T;  1ZSZ C;  3EG9 A;  1UJY A;  3CD6 A;  4CC7 A;  1M5Q 1;  2CH4 W;  4V2S A;  1DJ7 B;  3PMT A;  2B8A A;  2DKG A;  2K5L A;  3TCJ A;  2LCL A;  3CXC S;  1JJ2 P;  4N0A A;  2E70 A;  2RA2 A;  2KVQ G;  2Y4Y A;  3JCM h;  3G71 Q;  2D9T A;  1RAA B;  4C92 E;  2L8D A;  4HKE A;  3QG1 A;  2QQB A;  3E19 A;  3X26 B;  2EQI A;  2QI2 A;  3QO3 A;  3EG0 A;  4E47 A;  4DQ2 A;  2F2V A;  3AHU A;  1MMG A;  4M78 A;  2LQW A;  3BFM A;  3VU3 C;  3TU4 K;  4LDW A;  5CKF A;  2O9S A;  2JVV A;  5CKD A;  1SRM A;  2J6F A;  4M75 F;  1SRL A;  2EFI A;  2FHD A;  1YIT T;  4M75 B;  3A1P A;  2RJE A;  1ZX6 A;  1TUG B;  5KYW B;  3I35 A;  3C95 A;  4JRI A;  1YIJ Q;  2AIR B;  1N8R R;  3THK A;  1XNI A;  2XU8 A;  1TU0 B;  2DEU A;  4JRK A;  3CC7 A;  1BK2 A;  4FIB A;  1YIJ T;  3EG2 A;  2OI3 A;  1ABO A;  4ATO A;  2M16 A;  1QCN A;  1UGQ B;  2A3L A;  2DVJ A;  5GAN 8;  1EIF A;  3OSV A;  2DL7 A;  2DNU A;  3MCA B;  1WHK A;  4HA8 A;  1T0H A;  1EX4 A;  1WLP B;  1Q7Y R;  3G1J A;  4IIO A;  2CSQ A;  2RI2 A;  4RTZ A;  1RLP C;  1TUC A;  5CAI A;  3M5A A;  3LWI A;  5I2S A;  2LTO A;  2ZCF B;  4RKU E;  3SHW A;  2EPD A;  3CCE Q;  2JXB A;  3A8G B; 
#chains in the Genus database with same CATH homology
 3TRE A;  1VQO T;  2DTO A;  2RH2 A;  5CVI A;  3MEA A;  2RHX A;  2LX9 A;  2DO3 A;  4XTX A;  3OMC A;  1NJI U;  1OI1 A;  4M75 E;  4XTV A;  5A2Q E;  3CCE T;  3PTA A;  1M1F A;  2QQA A;  2ZGW A;  4N4H A;  5GAN 6;  4E7H A;  2ZPE B;  5A0G A;  2HQX A;  2EQJ A;  2HQE A;  3LGF A;  5GAN 2;  4RMO A;  4R56 A;  1NPR A;  2E64 A;  3H8Z A;  4C92 A;  4EDU A;  2M9U A;  1YI2 T;  2K5F A;  2MWP A;  2RHU A;  2KAF A;  3FDR A;  2R5A A;  4XK8 E;  5HY6 A;  3H6Z A;  4KUL A;  4OGC A;  4X34 A;  4ZGD B;  3PT9 A;  5GAN j;  5CKE A;  2VV5 A;  4A4F A;  1NE8 A;  5J39 A;  3QDR B;  5IAY A;  2DTI A;  5GAM j;  3QJY A;  3G6E T;  3VYG A;  3OSS C;  5GAN h;  5GAN f;  4JRP A;  2G3R A;  3GPL A;  1OYX A;  4OGE A;  1ZBX A;  2EAY A;  2WSC E;  5GAM h;  3QII A;  3OYF A;  2Y90 A;  1YJN T;  3X28 B;  4M7A D;  3SDZ A;  2JN0 A;  4IUR A;  4EMK C;  2CZ1 B;  4C92 G;  4KT0 E;  2X4J A;  2X4W A;  3VYH B;  5A0D A;  5DLQ E;  1N27 A;  2FB7 A;  3CMA A;  5J3B A;  3CCU T;  1QVG S;  4F7U E;  2EJF A;  4M75 D;  5GAO q;  1M90 U;  3L2Z A;  4J6X A;  3OYL A;  1BI0 A;  1VQL A;  1QVF A;  3UDC A;  4BB7 A;  1S72 T;  3M4G A;  4QVZ A;  1UGP B;  4C0D B;  4ELZ C;  2E5Q A;  1VQ8 A;  1RI0 A;  4JS4 A;  1P92 A;  1JB0 E;  1LNX A;  3FEO A;  4MDW A;  2RI5 A;  2YHT A;  1YIT A;  4PJO C;  4E7K A;  1JJ2 A;  3DLL A;  2JNG A;  1WGS A;  2E12 A;  2VUB A;  5GAN 7;  4R55 A;  2MF2 A;  3OYD A;  2I2L A;  1VQM T;  1OZ3 A;  5DM7 R;  1KQ1 A;  2RB6 A;  3JCM W;  2D0Q B;  2AHJ B;  3HPW A;  2QTX A;  1VQ5 T;  5LJ3 e;  1YIJ A;  5CKB A;  2PVD B;  3QBY A;  4KBM B;  1Q86 C;  4QQG A;  3OYH A;  1PSE A;  3X20 B;  4D6W A;  4NL2 A;  3CPW A;  2OTJ T;  3M57 A;  2DD5 A;  2EQK A;  4OB2 B;  4C5H A;  1XOV A;  5CK9 A;  5HK0 A;  5GAO m;  1PSF A;  3V7S A;  3JB9 D;  3CC2 A;  3QPH A;  2PVO B;  1O9S A;  3HFO A;  4RCC A;  3G71 T;  1KG1 A;  3M53 A;  3NFC A;  4M7A A;  1K8A U;  4M77 C;  1M1K U;  4P5N A;  2KY9 A;  3CBP A;  1QVP A;  2LRQ A;  1SSF A;  3L2W A;  3SWN C;  2DIQ A;  5GMK m;  3OQ5 A;  2K2V A;  5FU7 C;  3G7Z A;  1KD1 C;  2E1H A;  4QQ6 A;  4M75 A;  5GAO r;  3BY7 A;  2V8I A;  4MML A;  4XU3 A;  1Y96 A;  2GFA A;  3QZ5 B;  2QQR A;  4ZTJ A;  3PIO A;  2K3Y A;  4TVR A;  2KQW A;  2CZ0 B;  4A4H A;  1VQ6 T;  3MEU A;  2KMT A;  2R5M A;  2JTF A;  1Y96 B;  3P8H A;  3JCM e;  1QVG A;  2XD0 A;  4M7A G;  3BDU A;  1M9S A;  3PMI A;  2DXC A;  4A53 A;  1VQO A;  3OS2 A;  4JJN K;  3HP9 A;  3KBG A;  3MET A;  1I4K 1;  3VJP A;  3OYJ A;  3CCE A;  2WAC A;  3JB9 I;  2P0K A;  4OB3 B;  5L8R E;  4O5V A;  4BE2 A;  1VQN T;  5LJ3 g;  4M75 G;  4IUP A;  3QZ9 B;  4PL6 A;  1G3T A;  3RKW A;  3LGL A;  5GAN d;  3GP8 A;  2DXT A;  3OYY A;  2LT1 A;  5GMK e;  1YI2 A;  1K73 U;  1AHJ B;  1OZ2 A;  4OVA A;  4LDV A;  4M7D C;  3MO8 A;  4C8Q F;  4NL3 A;  5M9O A;  4J5Y A;  2PU9 B;  2BIV A;  1Y7X A;  1W2B S;  2VGN A;  4C8Q B;  2PUO B;  5FRN A;  4F7U A;  3QYH B;  3DLM A;  3G6E A;  1H3Z A;  3CME T;  1YJN A;  2VYT A;  3CXC A;  2H3J A;  5GMK i;  3GIB A;  3GNF B;  2KSS A;  2PUK B;  2Y4X A;  5GAN 5;  4M77 F;  4BY6 B;  4C8Q G;  5HK3 A;  1HK9 A;  4UC4 A;  3LW5 E;  3CCU A;  2VXE A;  1Q7Y C;  5DY9 A;  3MEW A;  1BKB A;  2CZ7 B;  1VIF A;  2EYQ A;  2L3R A;  4LDU A;  4XQ3 A;  5FU6 C;  4XTW A;  2ZPF B;  3SWN B;  4BD3 A;  4J8O A;  4F7U G;  1Y07 A;  1YCY A;  2E6Z A;  2RJF A;  1H64 1;  3JCM g;  4C5E A;  3L2U A;  3RES A;  4BUG A;  1S72 A;  1KHI A;  3G4S T;  1ZQ1 A;  1G3Y A;  4JRQ A;  4EMG A;  3JB9 G;  4XTU A;  2RJC A;  3M9Q A;  1JRI A;  3L2V A;  3J7A F;  4Y91 A;  2JZ2 A;  2EKO A;  2QDY B;  3EAE A;  4J6Y A;  3FJP A;  3LH0 A;  4N4G A;  1G5V A;  1BI2 A;  4KUD K;  2IVW A;  2VXF A;  3OYM A;  1VQM A;  3C94 A;  4PJO E;  4A4E A;  3OYK A;  1B34 A;  4Y28 E;  1VQ9 T;  1JBM A;  5HKC A;  3V7R A;  3OYE A;  2L5Q A;  2WSF E;  3MEV A;  1VQ5 A;  3HL8 A;  2XG8 D;  4ZGE B;  4QVC A;  4HCB A;  4XAX B;  1B34 B;  2RM4 A;  4L59 A;  5LJ5 g;  4M7D F;  2M0O A;  2LDM A;  3FRN A;  3Q1J A;  4MZM A;  3UT1 A;  2RI3 A;  2LCC A;  3MP1 A;  1FXX A;  2E6N A;  4JLI A;  4ZN3 A;  4M7D B;  2OTJ A;  2FL7 A;  2HAX A;  3CCV T;  3M54 A;  1YJW T;  1WJQ A;  5I2M A;  4C8Q E;  3VUZ A;  1YJ9 T;  3HRT A;  3I55 T;  2LQ8 A;  3G71 A;  5J26 A;  1WJR A;  3JB9 H;  1NJI C;  2RHY A;  3V8K A;  2K4Y A;  1XQH A;  1VQ7 T;  1U1S A;  3WVD B;  2PVG B;  3QSU A;  3HRU A;  4L6V 5;  4N0A C;  1WQW A;  2DZ9 A;  2RJD A;  1FWZ A;  2VC8 A;  3SD4 A;  4C0F A;  4EMH A;  5KCO A;  4M77 E;  4A54 A;  2EJG A;  3ZFJ A;  3OY9 A;  3I56 T;  2HD0 A;  5GAN 4;  1VQ6 A;  4J7F A;  2X4Y A;  2RO0 A;  3P8B B;  3L42 A;  2LQK A;  3OYC A;  3S3M A;  2GFU A;  2YRV A;  5LJ3 j;  1D3B A;  5GAM e;  2V8K A;  1WPY A;  4O6J A;  1FX7 A;  1UGS B;  5LJ3 h;  5LJ3 f;  2DK3 A;  4ME7 A;  2ZZD A;  3M4Y A;  4JDS A;  4M78 C;  3WXM B;  1VQN A;  1D3B B;  4C8Q D;  1Q86 U;  3MHX A;  5D6X A;  4B9X A;  3OYG A;  2DEQ A;  1I5L A;  4M75 C;  2QQ9 A;  4HT9 A;  1UEB A;  2E10 A;  1VUB A;  1X01 A;  2DXB A;  2XHC A;  3UWN A;  3CCM T;  4OP0 A;  2LC4 A;  3A8M B;  5C0M A;  1M90 C;  4YTL A;  2IG0 A;  1YBY A;  4BI4 A;  4OMF B;  5KE3 A;  2CZ6 B;  4MZP A;  3OW2 S;  1YHQ T;  4M77 D;  4EMK A;  4BDZ A;  2C06 A;  3M59 A;  4FT4 A;  3CME A;  4M7D E;  2RK2 A;  3BDL A;  1I8F A;  5CIU A;  3VV0 A;  1U1T A;  3EFR A;  4IUU A;  4JUV A;  3DKM A;  5LL6 S;  4IUQ A;  4EMK B;  4XU2 A;  4NOY A;  3VUB A;  3NTI A;  2DPP B;  5GAO l;  3URG A;  1HXD A;  1KHC A;  1NPP A;  3JCM J;  3JB9 J;  1BIB A;  2RHZ A;  3CC4 T;  4RG2 A;  5CQY A;  4MMK A;  3SB2 A;  3JCM f;  2X35 A;  2VGM A;  3TEE A;  4JS5 A;  2JUF A;  5IT9 E;  5GAN g;  1V29 B;  4JLG A;  3G4S A;  2ZPB B;  4IKF A;  5GAM g;  4PJO F;  5GMK l;  4RCB A;  4XTZ A;  3M55 A;  5GMK j;  1BI3 A;  2DZC A;  2E41 A;  2EIF A;  4PJO B;  1N8R U;  3OA6 A;  3NTK A;  3V8L A;  3KXT A;  5GMK h;  1WNL A;  2HNI A;  3OS5 A;  3QYG B;  1KQ2 A;  4QW2 A;  3L1A A;  4M78 F;  5EG2 A;  5CQX A;  2LNV A;  5KCH A;  5DLO A;  4HCZ A;  4C8Q A;  1K8A C;  3CCS T;  1M1K C;  1VQ9 A;  4M7D D;  2DIG A;  1WQ7 A;  2FYK A;  2K3X A;  2CGH A;  3HFN A;  4FL6 A;  4PJO G;  3KUF A;  1N6A A;  3BW1 A;  5GAO n;  2XI9 A;  5LJ5 e;  2MWO A;  3CD6 T;  2EWN A;  3VKI A;  2QQS A;  2KDS A;  3NTH A;  3SFM A;  1U8R A;  3CCV A;  1K9M U;  3OBY A;  1YJW A;  1Q82 U;  3HKS A;  4M77 A;  5CKH A;  3X25 B;  2LT4 A;  3I55 A;  1VQ4 T;  1YJ9 A;  3CPF A;  3RER A;  4C92 C;  3SWN A;  5IN1 A;  3JCM b;  1TH7 A;  2RHI A;  3RMQ A;  4M77 B;  2M1H A;  2DVE A;  3P8D A;  4X9C A;  2LVM A;  4A4G A;  3JCM X;  1VQ7 A;  1O75 A;  1UB4 A;  4J7I A;  4E7J A;  2DJZ A;  3L2R A;  3F70 A;  1WJS A;  3FLG A;  3LWH A;  5FU7 B;  3GNG A;  4C0Z A;  1VQP T;  3JCM V;  4N4I A;  3DB4 A;  5LJ3 d;  1K73 C;  2QXF A;  3QKJ A;  1N9S A;  3I56 A;  3RIR A;  2XDB A;  1W4S A;  2CKK A;  2OAU A;  4M77 G;  3J80 E;  3C12 A;  4EPC A;  4OB1 B;  3S3O A;  1KC8 C;  3CCJ T;  1XTD A;  3JAM E;  4OB0 B;  4ZGJ B;  3OYB A;  4LDY A;  1MGQ A;  1M8V A;  2EQU A;  2F69 A;  5FLX E;  3ME9 A;  4XU0 A;  2O4X A;  3M56 A;  4C0G A;  2JTM A;  3PFS A;  4C0D C;  3JCM P;  2P0Q A;  3DB3 A;  2DTH A;  2XID A;  4CRI A;  1M4Z A;  4M7D A;  3OS0 A;  4X9D A;  4BE0 A;  2O4X B;  1KQS S;  2QEX A;  3WVE B;  2F5K A;  1Q81 C;  4L5G A;  3CCM A;  2MMP A;  2HBP A;  4M78 E;  2QA4 A;  4FSX A;  3CCR A;  3GF5 A;  3CCQ T;  4E7I A;  5AYF A;  2K57 A;  3CBM A;  1YHQ A;  4OF1 A;  1BIA A;  2XDP A;  3M58 A;  1LJO A;  5CO7 A;  4QVD A;  3JCM d;  3CCL T;  3CPW S;  1VIE A;  1W2B A;  4IUV A;  1NZ9 A;  4A4K A;  3OYI A;  3JRZ A;  3CC7 T;  3E9G A;  4RG8 A;  4C92 F;  4M7D G;  4MZT A;  3PNW C;  3N5B B;  1G3S A;  3JCM Q;  4C92 B;  5D6Y A;  3QHS A;  1I81 A;  1LOJ A;  2R57 A;  1QW1 A;  4J6W A;  3CC4 A;  2XKO C;  4PJO D;  5GAO p;  5FU6 B;  2A7Y A;  2MAM A;  3EFS A;  2FVU A;  4BI3 A;  3ZEH A;  4MDX A;  3MP8 A;  1QP3 A;  3FB9 A;  3RKY A;  5GAM f;  4LD6 A;  3A8O B;  5I21 A;  2OTL T;  3LYI A;  2XDD A;  4E7L A;  5GAN e;  4HCC A;  2RK1 A;  3R6O A;  4FT2 A;  4M7A C;  3O8V A;  2CYZ B;  5LJ5 d;  4M78 D;  2DXU A;  2L89 A;  3RUX A;  3ER0 A;  1Y71 A;  4BDY A;  3CEY A;  3ZBD A;  4B9W A;  3A8L B;  3MP6 A;  4HT8 A;  1VQK T;  2RD1 A;  2ZPG B;  4GY5 A;  3S6W A;  4NS5 A;  5CCA A;  5GAN 3;  2QEX T;  2DAQ A;  2X4X A;  5C6S A;  3CCS A;  2JOY A;  4PLI A;  4C5G A;  4ELY C;  4DOW A;  2QA4 T;  3A5Z B;  3CBO A;  3CCR T;  3UPU A;  4KUI A;  3OMG A;  2P0P A;  2BKD N;  2WSE E;  3QXE B;  2MI6 A;  2O01 E;  3CD6 A;  2CS7 A;  1G3W A;  3QUI A;  5FRM A;  2V8J A;  1M5Q 1;  3A8H B;  2EQM A;  3PGG A;  1KD1 U;  3PIP A;  4V2S A;  1DJ7 B;  3OYA A;  1KQS A;  3PMT A;  2B8A A;  4ZTF A;  3X24 B;  2GF7 A;  1VQ4 A;  2DKG A;  3L2Q A;  2K5L A;  1M1G A;  3QJ6 A;  3T9N A;  3TCJ A;  2LCL A;  4C8Q C;  3CXC S;  4N0A A;  4DOV A;  2E70 A;  3OYN A;  2D6F A;  2YLC A;  2RA2 A;  2KVQ G;  2Y4Y A;  5D6W A;  3JCM h;  5KE2 A;  4II1 A;  2D9T A;  1RL2 A;  4C92 E;  2L8D A;  1VQP A;  3OB9 A;  4HKE A;  3QG1 A;  4PJO A;  1BYM A;  2QQB A;  3E19 A;  3X26 B;  1BI1 A;  3HHT B;  2QI2 A;  4DA4 A;  4BY6 C;  3QO3 A;  1IZ6 A;  4Q5W A;  3C4S A;  4E47 A;  5A0L A;  2NLU A;  4J83 A;  4DQ2 A;  3FC3 A;  3JSC A;  3RMS A;  3CCJ A;  3CMA T;  3AHU A;  4M7A F;  4BI8 B;  4LD9 K;  4IUT A;  4M78 A;  2YLB A;  2XK0 A;  4GLK A;  1R8O B;  4PNO A;  4M7A B;  3BFM A;  3VU3 C;  3TU4 K;  4LDW A;  5KH6 A;  1VQL T;  1UGR B;  5CKF A;  5LJ5 j;  2F5T X;  2JVV A;  2ZPH B;  5CKD A;  4M78 B;  4M75 F;  1X75 C;  3JCM c;  2BUD A;  1VQ8 T;  3HSB A;  2EFI A;  2FHD A;  4WF2 A;  5LJ5 f;  5LJ5 h;  1N9R A;  4C5I A;  1YIT T;  2KK4 A;  4M75 B;  4LDX A;  3LX7 A;  2ZPI B;  2RJE A;  4CI0 C;  2GCX A;  3C95 A;  3ASK A;  4JRI A;  3CCQ A;  3GOX A;  3E1S A;  4M78 G;  4C92 D;  1Q7Y U;  3FIF A;  4QQD A;  4BE1 A;  1XNI A;  1KC8 U;  3CCL A;  2XU8 A;  4JRK A;  3CC7 A;  4FM4 B;  4FIB A;  5GAM d;  2PQW A;  1YIJ T;  1N8R C;  4ATO A;  3OW2 A;  2K5I A;  2GQV A;  2M16 A;  1QP2 A;  4ZN1 A;  3HRS A;  4BAC A;  3GLX A;  4VUB A;  1UGQ B;  2A3L A;  2XIC A;  3INZ A;  5GAN 8;  5FRO A;  1EIF A;  3CC2 T;  3OSV A;  1IRE B;  4F7U F;  2EJ9 A;  3MCA B;  2DD4 A;  4HA8 A;  3OS1 A;  3V7C A;  4F7U B;  2OTL A;  1QVF S;  3JB9 F;  1ZHI A;  5CR2 A;  1X6O A;  2RI2 A;  1MHN A;  3OBW A;  4PLL A;  4PKC C;  5CAI A;  3M5A A;  1GXI E;  1K9M C;  3LWI A;  5I2S A;  1Q82 C;  2LTO A;  4Z02 A;  1Q81 U;  2ZCF B;  4FU6 A;  4RKU E;  4XTY A;  3E9F A;  3S3N A;  2P4T A;  3LLR A;  3RKX A;  1JJ2 S;  1VQK A;  4M7A E;  4XU1 A;  3V8J A;  2E65 A;  3A8G B;  2R58 A;  3J81 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...