4PQUA

Crystal structure of hiv-1 reverse transcriptase in complex with rna/dna and datp
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
545
structure length
545
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/rna
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
total genus 146
structure length 545
sequence length 545
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4pquA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pquA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pquA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pquA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4pquA05
1JX4A 4F2SA 4K4XA 1DTQB 2R2RA 5CYQB 2XO7A 4DSIA 2GIRA 3MR5A 1DLOA 4CHPA 3HVWA 5HRRA 4JLHA 5KFTA 3S9HA 3K57A 1VSLA 3T3FA 3NH1A 3RRGA 3TAFA 3OY9A 5KFCA 1S0MA 4M3YA 2KW4A 4CGFA 2WCXA 4NLTA 3LPTA 2ZQBA 1IKVB 2NUBA 4QPXA 5DGBA 4O4GB 5EWEA 1NK5A 4E7HA 4F4WA 1L3SA 3DMJB 2RPIA 4Z4CA 1TP7A 4CJ4A 3OYHA 3ALYA 4CEDA 1Z26A 4LH5A 4MKBA 1I39A 1SKSA 3N6LA 2XY7A 2V0NA 4Y2AA 4O5BA 1KFDA 3V6KA 4KHSA 2WK4A 1S1XB 2DFFA 4K4TA 4J9QA 4I2PA 1S5JA 3ZSYA 1X1PA 5C42A 2JGUA 4N41A 4MIAA 5EDWA 3BGRB 3RAXA 5FRMA 3QERA 4DF8A 1TAQA 5DQHA 3NGYA 3PVXA 4CGDA 1ASWA 2QV6A 1UWBA 2QKBA 2QK9A 5DLFA 1C0TB 4Q43A 3SFGA 2B6AA 4DQIA 1RT4A 1FKOA 1XR5A 2W42A 2HWIA 1WSJA 3MEEB 4CGGA 1KCFA 1TL3A 1S49A 2DY4A 2IS3A 3ZT1A 1XR7A 5FDLA 2YHBA 4CJUA 1XWLA 3CFRA 3FQKA 5EU7A 3CM5A 3AVAA 3P83D 4H8KA 1NK8A 5KG6A 3PO5A 4O3NA 3MAQA 1BQNB 2BQRA 4ZP6A 1SH0A 4RW9B 3PO4A 1HMVA 4TLRA 1HQEB 1D9DA 1A5VA 3SUNA 1CSJA 4Y34A 4JRQA 4JUZA 1B9DA 4H54A 2BGGA 2C28A 4C8KA 1NK7A 4RW4B 3RWUA 4XO0A 3RB6A 5KGWA 3LP0A 1RT6A 2EC0A 2IJNA 4K4ZA 1D0EA 1RYSA 3DMJA 4CJQA 4F4KA 3OS0A 3HO1A 1TK0A 1LW2A 4R5PB 2W7OA 3DOKA 3LZJA 2OPPA 1RT3B 3AVCA 4CJ5A 1CZBA 4NLRA 1ASVA 1C1CA 1C2PA 2I5JB 3IRXB 1JLQB 3UDLA 1S6PA 2I1RA 3OSPA 2ZD1A 1D8YA 2HVHA 3NF8A 4BDZA 1K1SA 1IH7A 3OS1A 3RTVA 3G6VA 3AA4A 4EBDA 1L3UA 1C0MA 2D5RA 4I7FB 1VSEA 4CEEA 4ZTJA 2XGPA 4FJJA 4O0JA 1TL1A 4O55A 2XGQA 1B92A 4FM0A 3Q8PB 2WRMA 4XIUA 3I5CA 3VQ9A 1L3VA 2D41A 4KO0B 3PR5B 2ASJA 2Y1IA 3AVJA 2DFEA 4ZP9A 4FM2A 4DTOA 3TR8A 2D7SA 1JXLA 1JLFB 2XCAA 4RW8B 3CWJA 3BSNA 4LY7A 4I9QA 1KHWA 4FJ5A 3KLEB 1IKWA 4E7IA 1CLQA 3H4BA 3HPHA 4Z4EA 4ZPBA 4AHCA 3M9NB 3C95A 5F8LA 4Z4IA 2OPSA 1WNEA 1IKXA 3T19A 3GQCA 1D9FA 2ETJA 1ZBIA 4NYZA 1U49A 2HB5A 4RU9A 2BE2B 4Y1DA 3OYAA 5KFXA 3KOAA 5KFWA 3NAEA 3M9MB 1C1BB 1XR6A 1YVFA 4KTZA 5CYMA 3DLKA 4BE1A 4DWIA 5KT3A 1KFSA 4CCHA 5EWGA 3QLHA 4JV1A 1LW2B 4R5PA 3KKSA 2W9AA 4YQWA 4MFBA 1SL0A 4CF9A 3SFUA 4DSEA 2BANA 3LAKA 1LAWA 1RDCA 1GX5A 3OYKA 1EP4B 2FBYA 3CIZA 5L1LA 1RDDA 3IGVA 4ED3A 1ZETA 1U09A 1S4FA 5I42A 3IAYA 3KJVA 4CF1A 4B9TA 3KMQA 4XPCA 3KLVA 3K2PA 1NHUA 4DFJA 1FK9A 3M8PA 3VA0A 5KFZA 3AVIA 2B5JB 5J1EB 2UVVA 3TANA 2FBVA 4URSA 1UOCA 4I2QA 5J2MA 1QSLA 3CO9A 1LWCA 5JS2A 4HTUA 5EUHA 2A1RA 3TAPA 4J2AA 4Q0BB 3OLAA 3GIJA 3KLHA 1DTTA 4ECTA 3ZCMA 1LV5A 3LALA 2YV0X 3DDKA 1QSYA 2IAJB 3P1GA 4WZQA 2IM3A 4IR1A 3HVAA 5L1JA 4MIBA 4TQSA 4FLTA 1BL3A 3LZIA 3NGIA 1BIZA 1XC9A 2HNYB 1GOCA 5KG5A 4KB1A 4B9NA 3DLBA 5KFFA 3IRXA 3T5KA 1S6PB 4TN2A 2P5GA 1QTMA 4Q8FA 2C2EA 3KHHA 2AJQA 3AA3A 4KHNA 5DG9A 2R8KA 1RBRA 4RNHA 3BSOA 4FLUA 1S1VB 4K4YA 1SH3A 3DLGA 3PV8A 4E89A 4EYHB 5HLFB 4DSJA 2X74A 1RT7A 4CFAA 2BRLA 4YNQA 1T8EA 4FJHA 4FYDA 2ILZA 5D3GB 1TV6A 5KG1A 3O3GA 5KFJA 4AH9A 5KT5A 4HCCA 4RNFA 4RW7A 3I8DA 3CM6A 4CF2A 1JXEA 3ZT4A 5DG7A 2JEGA 3ICLA 4Q44A 2HHUA 3T5LA 2KZZA 4N5SA 5KFAA 5KFMA 1WN7A 4Q0BA 4J2EA 4DL5A 1FKOB 1FK9B 3BSAA 2GUIA 2G8FA 3KK3B 3ZT2A 4FJIA 1J5OB 1S1UA 2R2SA 1J5OA 3L8BA 2HAIA 2W9BA 3PR4A 4ELUA 3PW5A 2G8HA 2RDIA 5HP1B 5KFUA 5KG3A 4B3OA 4KKOB 3EPGA 4DFMA 3DI6B 1G15A 3K58A 4U7CA 2YKMB 5HBMA 1S1WA 4ZP7A 1L3TA 3NGDA 4CFBA 4HUGA 2XRIA 4DL3A 1RDRA 3N6MA 3AVLA 1KLMB 4DU4A 4G3IA 3GYNA 4C8LA 4OGCA 2D3UA 4FK0A 1VSKA 3AA2A 3T5JA 3G0ZA 4O3PA 3VQ8A 1HYSA 4L8RB 2RKIA 4LSLA 1WSGA 3NBPB 2HNZB 4KFBB 2XY6A 3WNFA 4OL8A 4ED7A 1SV5A 2RDJA 2Z1JA 3KLIA 3RR8A 4FZZA 2HHQA 1U47A 4TQRA 3T1AA 3NKYA 3PX6A 1TV6B 3N6NA 1RT5B 3AO1A 2VA3A 2X6SA 1BGXT 5KRSA 4C8OA 4WXWA 2I5JA 4DFPA 1GOBA 4NLXA 3D5MA 4GVMA 1S9GA 1CXUA 3WNGA 1S97A 4OLBA 3AVMA 3V6HA 3I0SB 2E6MA 1UA1A 3MEDB 1X9MA 1S1UB 4QCLA 4I7FA 3WNEA 1UWBB 3KK2B 1TK5A 4NCAA 2WOMA 4DSLA 4HYKA 4M3TA 1NK6A 1NOZA 1KVAA 4IDKA 3GV5B 5DMRA 1DTTB 3MF5A 4M3XA 1RTDB 2UVUA 1U48A 4FJLA 4ZHRB 4KHWA 2BRKA 3PW4A 1SKWA 3DYAB 4BDPA 4OKKA 5HROA 3SJJA 3DLEB 1WSHA 3ITHA 5SZTA 4B3OB 3V1OA 4ELVA 3KLFB 4FJNA 3HPGA 4OVLA 2E4LA 3LP2A 3VQSA 3F73A 4RW8A 4WYWA 4ED1A 4IFVB 4R8UB 1R0AB 4RNNA 5KGXA 4W5TA 1N5YA 1RT2A 2QKKA 2GV9A 1QHTA 1S0OA 1HYSB 4NCBA 3TVKA 1HJRA 1TKXB 3QNNA 4CJ3A 4CJTA 2FBTA 4WE1B 4DMNA 2IBKA 4NLWA 4Q5VA 1RTHB 3QZ7A 3TAQA 1JLEA 4ICLA 2YNFA 3SI8A 2VG5A 3OL7A 1VSDA 1VRTA 1LW0B 5KFOA 2A1SA 2RN2A 3AVBA 3FFIA 3OS2A 1C0TA 3C94A 4M3ZA 3S3NA 4IDKB 1BI4A 3AO4A 1HNIA 3SUQA 3CJ2A 3PX0A 1TL3B 1JL2A 2IC3B 2F8EX 3KNAA 2YNGB 1VSJA 3E01B 3NGZA 5J1EA 3DLRA 4KREA 4CK3A 4H4OB 4DG1B 1KVCA 3PHEA 5I3UB 4O44B 3PX4A 4K4UA 2B6AB 1RT4B 4DTMA 3CDWA 4HUEA 3CJ3A 4B9UA 2C22A 1S1WB 3NCIA 1CXQA 1JLGB 3I5AA 5J2NB 1JLFA 5DQGA 4NYNA 3EZ5A 3TAMB 4R8UA 4AHTA 2VG7B 1QAJA 3OYIA 4E0DA 3OL6A 3NF6A 1RT2B 2Z1HA 4TYAA 4O3SA 3B6OA 4C8MA 3B6PA 4O4GA 1RT1A 3V81A 1REVA 4KHMA 2D3ZA 3DM2B 3MEGA 1Y97A 4ECXA 4F4ZA 2WHOA 3VQBA 3H5SA 4IG3A 2VG6B 2JC0A 3CYMA 3MXIA 1WSFA 4NLGA 1RA6A 3CDEA 1IKXB 1S1TB 3OYFA 4CJWA 1RT3A 3H4DA 4LSNB 1N48A 2UVRA 1C1CB 3OYJA 2DTUA 1JLBA 3LP0B 4DTRA 4Z0UA 4WE1A 3MR3A 4CEBA 1NKCA 2UUWA 2VWKA 4DL2A 1HQUA 3HSTB 5T7BA 5JS1A 3Q8SB 3C6TA 1WNSA 1RNHA 4RW6B 1YTUA 4KSEB 4NLYA 1HYVA 5F8HA 5KFRA 3K5LA 2KQ2A 3PJXA 2QE5A 4J2BA 3PJWA 2Z1GA 4WYLA 3GIMA 1JLQA 4EEYA 5KFQA 1RA7A 1W25A 2YNIB 4BWMA 2ASLA 2OPRA 2VWJA 3DOLB 4O3QA 2B43A 5FROA 1IM4A 3RR7A 4CJPA 3KLGB 4FK2A 5EWFA 4K50A 1I3AA 4MK7A 4MK8A 1S9GB 2JC1A 2HNDB 3V6DB 3V1QA 2WONB 4ZVGA 3HPOA 4J9PA 5SWMA 4W5QA 1LWCB 1FKPA 4CFCA 1RILA 4Y1CA 1RYRA 4IOBA 2OPSB 3LDSA 4QWBA 5HP1A 4PUOB 1YVUA 3QETA 3QEIA 4ECYA 1B9FA 5KFLA 4IH7A 3GILA 1QS4A 3AVFA 1NJYA 2ALZA 3V1RA 4ECSA 2G8UA 3VQEA 4OGEA 5KFGA 4ZHRA 4O4RA 3VQAA 4F50A 1JLEB 4ICLB 1QQCA 3V9SA 3RBDA 2XC9A 3VA3A 1XHXA 3NH0A 4PWDB 4FJ8A 4CE9A 3SQ1A 3KD1E 1NKEA 4J9LA 4ECUA 5HRSA 3SQ2A 2B4JA 2P51A 3CJ5A 4OPKA 4BDYA 1R0AA 5CZ2A 4IFYA 1KVBA 3CFPA 4IFYB 5HLFA 1TQLA 4CK2A 4AILC 1S1VA 1TKZA 3RMBA 4KHUA 3KKRA 4MFBB 4O0IA 2CJQA 2CKWA 1K6YA 1SH2A 1TKDA 2O5DA 3LP1A 5KFEA 2AGPA 3QGGA 1IO2A 1X9WA 4WZMA 3M9OB 1NK0A 3I0RB 4CJVA 1ZBLA 4DLGA 3GV8B 2D0AA 3NFAA 5KRTA 4RW7B 3UIQA 1W9HA 1U04A 2P5OA 3H2LA 1EETB 2IOCA 3M8RA 3L2WA 4K4WA 3PUFA 2WB4A 4J9MA 1HNVA 1EXQA 3BDPA 4QWDA 4QWCA 5F8MA 1T7PA 1JKHA 1A5XA 1U4BA 3NF9A 4ZTFA 1LWEA 1RTJB 5JXSA 4FM1A 1QSSA 2FJWA 3JYTB 3RBEA 5HROB 4CJSA 4DL7A 3HL8A 1T03A 4W5NA 3TAGA 2ZE2B 3SNNA 4OKJA 1QAIA 3BJYA 3HP6A 2JEIA 4F4XA 3D45A 3K5MA 3V9ZA 3AO5A 3DRSB 4DQQA 4FS1A 4RNMA 2G8WA 4DS5A 5J2QA 1J53A 3ZSVA 1HARA 2IM1A 3QLHB 5C5JA 4CJFA 5C25A 4EP5A 1IKWB 1TKXA 4EZ6A 3ZT0A 4CF8A 3PW7A 3QNOA 1RAJA 4B8CA 1SV5B 4CJKA 2W9CB 1NK9A 2VG6A 4C8NA 4RUCA 3TAEA 4YR2A 2FVCA 4HCBA 1UA0A 1ZYQA 1S48A 2OPRB 4X2BA 4M95A 3TI0A 3KLGA 4M94A 1T05A 4TYBA 4B9VA 2Z1IA 5CYMB 4J9SA 1X9SA 2VG5B 1YTAA 1HYZA 1VRTB 4ZVEA 2VA2A 1NJWA 5DK5A 3VQ4A 4CIFA 1N6QA 3VQ6A 1VSHA 4IR9A 5KFPA 4Z4HA 3AO3A 1WAJA 4R0EA 4IKAA 2IM2A 3PW0A 5K14B 4NLDA 5E41A 4DSFA 3KK3A 3BREA 2E9ZA 1VRUB 5FDLB 4NLSA 4PQUA 1A5WA 3MXJA 4CGHA 2OH2A 1MMLA 4E7KA 4FBUA 4NRTA 4DL4A 2G8VA 4B8AB 3ZSZA 2RF2B 5I3UA 2JLEA 2RF2A 5C25B 3KLFA 1TKTB 3G6YA 4YR3A 4KKOA 4LD0A 3QYYA 4RW9A 1MU2A 2BR0A 3U3YA 3CVKA 3EYZA 3QO9B 3OL9A 1RT5A 1C0UB 2HHXA 4LH4A 4TY8B 1EX4A 3DLGB 2R8JA 1WSIA 3NF7A 1T94A 4JV2A 1JLBB 4F8RA 2Q3SA 1C1BA 3Q8QB 4IRDA 1JLAA 3FQLA 1RCHA 3SV3A 3VQDA 3LP1B 1Q8IA 4W5OA 4ZMMA 1S10A 2HVIA 3OL8A 3OYEA 4YMEA 1NJZA 1IKYB 3HKWA 1EP4A 2C2DA 5F9LA 2O4GA 5F8NA 2WTFA 3VQCA 4KHQA 3SI6A 3RMAA 3NHGA 3CFOA 1Q9XA 4BWJA 4EP4A 2FBXA 1WSEA 1HNIB 4B08A 5CZ1A 1ZTWA 1GX6A 3KK2A 3WNHA 4H4OA 4DG1A 1C1AA 1RDAA 5C24A 2IGIA 3LWMA 4RZRA 2FVRA 2V4QA 2OYQA 4O44A 3JYTA 3RB4A 3VQQA 4E1MA 4ID1A 4ID5B 1NHVA 4I2QB 2FVSA 1BQNA 2AX0A 3H98A 5F8IA 4NLVA 4B9LA 4KAZA 3MXMA 3BQ1A 1MU2B 3H5XA 1W0HA 3NAIA 4IBNA 4KB7A 1KLMA 4NLPA 4IFVA 5J2QB 3M8PB 4CK1A 1VSIA 2HMIB 4MH8A 3HVTB 3SQ4A 4E7JA 4OPJA 1NJXA 4KFBA 3TQ1A 3O3HA 1FKPB 1JLAB 2W9CA 1EKEA 1S9FA 3QEWA 3BQ2A 4G1QA 3SUPA 2XCPA 5KFIA 3RMCA 4F2RA 4NLQA 2PY5A 3H40A 1D1UA 4FZYA 4H4MA 4HUFA 3UPFA 5C42B 3BR9A 4DLEA 2ZD1B 1HQUB 3HXMA 4CGJA 1WLJA 2W8KA 3AV9A 3P5JA 4WXOA 4AHVA 3KTQA 2YNFB 2UUTA 1ZBHA 5DQIA 4IRKA 4CEZA 4ECRA 4RW6A 5KG7A 2HNZA 2FVPA 3AA5X 1XHZA 1GOAA 1JLCB 4CJLA 3MECB 5JUMA 3KHLA 1NNDA 2FLPA 4CHNA 2R7YA 3OYGA 4AHUA 3K5OA 4W5RA 1VRUA 1LWFB 3AVHA 1BISA 1S1XA 3CJ4A 4FLWA 2XY5A 5C24B 3DYAA 3MR6A 4Q45A 3OLBA 4MK9A 1TKTA 1TGOA 3RMDA 1HMVB 4K8XA 1O1WA 3U3GA 4J9NA 2W8LA 4MKAA 2X78A 1T3NA 3GIKA 4M41A 1S9EA 4CEFA 3V4IA 2HHWA 4ED8A 1I6JA 4CIEA 3UQSA 1DLOB 3NE6A 3CG7A 4FLVA 2E9RX 2VG7A 1S1TA 4WFZA 2XWYA 4KRFA 3IGNA 1HRHA 4BE2A 2ZKUA 1RT6B 2F8SA 4CIGA 1HPZB 2O4IA 4FJKA 1RTJA 3E51A 2W9BB 5CY4A 2KFZA 1LAVA 2ITGA 3DOKB 4RNOA 4ZP8A 1BIUA 5J2PA 4FXDA 4DF4A 5J2PB 4Q8EA 4ZVHA 1JLCA 2P1JA 4CEAA 3VQ7A 3OJSA 3QO9A 3SV4A 1N4LA 4KHYA 4M3RA 5KFHA 2OPQA 3NBPA 2GIQA 4I2PB 4CHZA 2OZMA 4IH5A 3LANA 4FLXA 1T05B 2IA6A 1S6QB 1XI1A 3QEXA 2ASDA 3S3OA 4ECZA 2KFNA 2YKNA 3DRPA 5L1IA 3RAQA 2OPPB 4M3UA 3KHGA 4QW8A 3TARA 5KT6A 1EETA 4O3OA 5J2NA 2V4RA 3V4IB 3DOLA 4RUAA 3FFIB 2R8GA 4DFKA 3THVA 4PUOA 4ED0A 4J9RA 1ITGA 3TWHA 3MEEA 4FBTA 5KT7A 2XHBA 1RTIB 3SPYA 5KFDA 4NCGB 4CERA 1BHLA 3QINA 1CZ9A 2FJVA 1HPZA 3L2UA 3D0PA 3FDSA 1J54A 5CYQA 5L1KA 2D0CA 2AU0A 4CFDA 1KHVA 4FJ9A 3ASMA 4DTSA 3ZSWA 4CGIA 1RTDA 3BQ0A 3HT3A 4PWDA 2HHVA 4KI4A 4K4SA 1SKRA 3NMAA 1JLGA 2BQUA 3GIIA 4E1NA 3LPUA 4CHQA 2IAJA 1QUVA 4TXSA 1C0UA 4IQXA 4HHTA 3S3MA 4PA1A 1IKVA 3HP9A 4E19A 3VQPA 3U6FA 1BCOA 2OPQB 3AVGA 3HM9A 5KT2A 3ISND 2AX1A 4K8ZA 2RKIB 2HNYA 4M3WA 1HQEA 2R8HA 4ELTA 4DTXA 1RT7B 1SUQB 1SUQA 2ILYA 3NDKA 4G1QB 3CQ8A 4CEOA 3ZT3A 3KLIB 4QWAA 3L3VA 4DQPA 4ZPDA 3OYMA 2DPIA 2YKNB 3NAHA 2LSNA 4NZ0A 1JIHA 4FS2A 3MFHA 3SYZA 4WFXA 5KG4A 4ZVFA 1BCMA 3KK1B 4QWEA 4Z4GA 2Y1JA 3BGRA 1BI4B 1NOYA 5DG8A 3QEVA 1S6QA 2HNDA 3JSMA 2DPJA 2WONA 1VSFA 2AGQA 1RTHA 3G10A 3GV7B 3JSMB 2HWHA 2FJXA 4CECA 3RB0A 3IN5A 4FVMA 2YNGA 3DRRB 1S9EB 5HRNA 1SL2A 3ULDA 4J9OA 1QE1A 3M8QA 4KV8B 2W7PA 2AGOA 4FW1A 1NKBA 3ZSOA 3PY8A 4FZXC 2C2RA 3QEPA 4NYFA 4KO0A 4ED6A 4IH6A 3IG1B 3Q8RB 4B9SA 2ZE2A 3VQ5A 5F9NA 1LWFA 2YKMA 4JS5A 2FVQA 1ZBUA 5I42B 4MQ3A 4F3OA 4M45A 4NRUA 2YNHB 5KFVA 3KHRA 4J9KA 1ZBFA 1LWEB 4IRCA 3V9XA 3OYCA 2B5JA 2EHGA 3VN5A 1REVB 4WFYA 3DM2A 5KFYA 4E7LA 4CHYA 3ITHB 4I9LA 2BDPA 3QIOA 3LAMA 3HHKA 4DEZA 2XY8A 3MFIA 3MR2A 3T5HA 3QIPA 5HBMB 1ZTTA 4DQSA 2AQ4A 1UAXA 3QIDA 3ZSXA 4M42A 3C6UB 4F4YA 3O4NA 3TAMA 3OSNA 2J6SA 1KLNA 2IJFA 3I5BA 1SL1A 5KT4A 1RDBA 4RW4A 1KTQA 2IDOA 5T14A 3L2RA 1BQMB 4CJRA 1KRPA 1ASUA 4AHSA 4IG3B 4ECVA 2BQ3A 3BSCA 3MEDA 2KZMA 3H5YA 3OYLA 4DTPA 4CJEA 4OLAA 4RG8A 3DRRA 4DTNA 3H59A 4LQ9A 3EY1A 4FJGA 4ZPCA 4EO6A 2HHSA 4FK4A 4IG0A 4HVJA 3G86A 3O3FA 1N56A 4IG0B 1IG9A 2E6LA 4EYIB 4AHRA 3C6TB 2PYJA 2HHTA 3OHAA 4KTQA 1JKHB 2ATQA 3KMSA 4CEQA 3ZSRA 2EX3A 4K4VA 3RB3A 3L3UA 4KPYA 4TSXA 4GC7A 4OJRA 2QXFA 2G8KA 4HKQA 3ISNC 4EBEA 1NK4A 4ID5A 3EZUA 2R8IA 2F96A 3LP3A 4FJ7A 2E9TA 4Y2CA 2JEJA 2G8IA 4UQGA 3V6JA 3DRSA 1RBSA 1TVRA 5KG2A 2JEFA 4GW6A 2YNHA 4O3RA 3AVKA 3O4QA 3KLEA 4EZ9A 3MTKA 5F8GA 2FLNA 1VSMA 2PZSA 3V81B 3HVTA 3HJFA 1RTIA 4DQRA 3MEGB 3FRZA 2FC0A 2OZSA 5KFSA 1D5AA 5KI6A 2D0BA 3H5UA 3LP2B 4XPEA 4DL6A 4BACA 3QESA 1Z25A 2HW3A 4JV0A 3C6UA 4DTUA 5KG0A 4LSNA 1T03B 4H4MB 1IKYA 5L9XA 4OKEA 2BE2A 3CJ0A 3UR0A 1C6VA 1N5YB 4DTJA 2DFHA 3H08A 4N56A 1BQMA 2X6NA 4FJXA 4KHRA 1K1QA 3L2QA 3DLKB 4KBIA 4TY9A 3F9KA 3QZ8A 4FCYA 3SCXA 2GBZA 2FLLA 4CHOA 4ZPAA 3K59A 4CF0A 4LSLB 2V9WA 1QE1B 3M8QB 2XI3A 1TL1B 3MECA 2BANB 4CESA 5D3GA 2R2TA 3IG1A 3KIOA 1TAUA 3I0RA 2YNIA 2F8TA 2PYLA 3NH2A 3OYBA 3IS9B 3KK1A 4EBCA 3IS9A 4YP3A 4DU3A 3DLHA 5HRPA 4KTWA 3E01A 3SPZA 3V6DA 2HMIA 4DSKA 4FLZA 4QW9A 4DU1A 5J2MB 4NLOA 1YT3A 3PW2A 3DLEA 1RT1B 4F3TA 2KTQA 3NL0A 4NLUA 4E3SA 3AVNA 4PY5A 3OJUA 2IMWP 2OA8A 3QIPB 1N6QB 3OYNA 1DTQA 3FSIA 4N47A 3CDUA 4N76A 2R2UA 3V9UA 3HVRA 1RBTA 4EO8A 4LQ3A 3KLHB 4URQU 1WAFA 5FRNA 1L5UA 4YFUA 5K14A 3RRHA 3DI6A 2J6UA 1FXXA 4JS4A 4NCGA 5KFBA 3QGHA 4PQUB 2YHAA 1OS5A 4GC6A 4JRPA 5KFNA 3ZSQA 2IM0A 4ECWA 3HYFA 3V9WA 1F21A 4Y3CA 2UVWA 4ECQA 4URGA 4FW2A 3A2FA 4QAGA 4B9MA 4KB0A 4U6PA 4KI6A 3SUOA 2XI2A 1Q9YA 5DLGA 5DGAA 1JXBA 4IKFA 5KTQA 3PZPA 3LWLA 1KSPA 4ED2A 4FLYA 1TK8A 4TY8A 3KJVB 4BE0A 3D28A 1Z4UA 4GMJB 4DS4A 4QOZB 3OHBA 1TKZB 4KE5A 3M8SA 2GC8A 1RBVA 4FJMA 3L2VA 3I0SA 3OYDA 3DRPB 2J6TA 3AO2A 3SQ0A 1J9AA 2WOMB 3KD5E 3TABA 1LW0A 5F8JA 1TVRB 4KV8A 4Z4FA 4J2DA 4YR0A 3G6XA 1HNVB 3HK2A 3K5NA 1S0NA 3SZ2A 3OVNA 1RBUA 1JL1A 1U45A 2AWZA 3QGIA 3EPIA 1VK0A 4KAIA 2IC3A 5KFKA 2ATLA
chains in the Genus database with same CATH superfamily
4F2SA 4M8LA 2Q1NA 5A8KB 3RSEA 3MR5A 4CHPA 4EFAC 2V4JB 1EQYA 1XIQA 3ZZOA 1VSLA 3T3FA 3CCMN 3TAFA 5KFCA 3O9RA 1BA0A 2A6MA 3G96A 4NPOA 2WCXA 2LDYA 4JI5F 1XNRJ 5BPNA 2ZQBA 1IKVB 2GO8A 1N32J 2D9PA 1NK5A 1U2CA 2EK6A 4F4WA 3AD9C 3DMJB 4CJ4A 3ALYA 1R8HA 4MKBA 1SJ3P 4M7XA 1XTZA 2XM3A 4Y2AA 4O5BA 3M32A 4JI3F 2MQ8A 2ROPA 1S1XB 2CZ4A 3CCVS 4P74A 3VETA 3KNGA 3NLCA 3RAXA 2Y9HA 4EFHA 1H0HB 2AJ1A 4DF8A 5DQHA 3PVXA 3SBTA 3TX8A 3WZ0A 2DR6A 4OYXA 3PXGa 2QKBA 1C0TB 1S0VA 3OQ2A 3TA1A 3BGOP 1N88A 4DQIA 1GT8A 2DH7A 2UP1A 1XR5A 1WSJA 4K43A 1YSJA 4NXMK 3KJFB 1S49A 3I82A 3WC0A 2UU9F 3ZT1A 1REGX 3QT7A 3Q7BA 4JYAF 5IZHA 2E1MC 3DNCA 3SLCA 5GAEI 4RLEA 2BQRA 1RK8A 4FVCA 3U27A 1HQEB 5L46A 4A5BA 3THYA 1A5VA 2E7VA 4PXCA 1CSJA 4Y34A 4JRQA 2KI2A 1HQ2A 1TL7A 3CCRN 2QJ3A 4RW4B 2VIHA 3SCIE 5GAGI 5AE1A 5EGYA 2EC0A 3BN7A 4FKYA 1IJJA 2OEKA 2EXUA 1D0EA 5D15A 5C10A 5A2QY 2W7OA 4KC5A 4K59A 3NGUA 2N3OA 1RT3B 3AVCA 2A2CA 3G71S 4NASA 1CZBA 4NLRA 5JVGL 2I5JB 1JLQB 2LMIA 1S6PA 2I1RA 4LR8A 1D8YA 4QR0A 2HVHA 1P90A 1IH7A 4FZVA 5LJVA 4OYIA 3VGTA 3OS1A 3WX8A 3CERA 4EBDA 5C0YA 1I5OB 1NHKL 2DNZA 2D5RA 1VSEA 4LBIA 4FJJA 5C2DA 6AT1B 4WFAQ 3O9UA 1TL1A 4FM0A 5IC6B 5CHCB 2BE9B 3Q8PB 2WRMA 3VQ9A 4CZEA 2FHMA 1Y00A 2BE7D 3AVJA 4FM2A 4ZP9A 4DTOA 2D7SA 2G9OA 3PYGA 3F56A 3E3XA 4CTAA 1JCEA 4RW8B 3FK4A 4LY7A 3QJJA 4A62A 3W62A 2YHWA 2GVZA 1NXIA 3ZZUA 4F4AA 3H20A 4AHCA 3DGPA 2R42A 3HT0A 3M9NB 1VBXA 2VBWA 1JCFA 4CZLA 5F8LA 4Z4IA 4CLSA 2G13A 2OPSA 2JLFA 3GQCA 3R1LA 4NYZA 3J7Z5 4IQMA 3PNIA 1U49A 3FCVA 2NZCA 4X65J 3MCAB 3OYAA 3KOAA 1C1BB 1GLAG 1VFJA 3DLKA 5EXWA 1KFSA 2QWPA 4GV3A 2NXNA 1Q0NA 2PIIA 2KU7A 4CZHA 3QLHA 4YDUC 3BV8A 2FYXA 4R5PA 2NZTA 4YQWA 1WWHA 4MFBA 3R27A 4UUXA 3CC7N 3KK7A 1FE4A 2LLZA 4AQYF 1RDCA 1VHIA 3ZEUA 1UW4A 2FBYA 1DFDA 3MPYA 3IGVA 1H3DA 4ZJOA 3IAYA 3MDFA 3AFGA 4KGKA 2OGUA 3KJVA 3D6HB 3HFVA 3K2PA 1HD0A 5BPLA 2VUGA 5D0GA 5AE2A 4DFJA 3M8PA 1XK8A 3HM8A 2UVVA 4URSA 3FVYA 2RQCA 4DUZJ 1K73T 2APOA 2YHXA 1YI2N 1LWCA 4HTUA 4JP8A 3GOIA 1QVGM 2QLJB 2VJVA 3TAPA 2GWKA 4Q0BB 3RAMA 2PFFB 5LMUK 4I56A 4OX8A 3ZCMA 3G8SA 1LV5A 2ZDOA 2Q0RA 3LALA 3TUZC 3CJBA 4J9UE 2HK3A 1QSYA 4WZQA 4IR1A 4OX6A 3HVAA 5L1JA 1O6XA 4MIBA 3CCEN 2C3UA 4CRJA 2NSCA 1M1GA 1GOCA 1B0PA 5AQSA 4JV5F 5KFFA 7FD1A 1QTMA 1Q81O 4HACB 3KHHA 2AYGA 3AA3A 3P39A 2FY1A 4FLUA 4FPBA 1WOSA 4OYWA 3DLGA 3VALA 1UMJA 3GCXP 2JH3A 3PFOA 4JYAK 3CJTA 3C0BA 1SJ1A 1FWLA 3EEQA 1KS2A 1CULA 1YX2A 5KT5A 4RNFA 4KBOA 4M5HA 4EGLA 4LF4K 2Z56B 3ICLA 4N5SA 2J8AA 5KFAA 1WN7A 4Q0BA 2GUIA 2G8FA 1SCJB 5EHHA 1VHXA 2VL1A 2DCUB 2B4PA 5E3CA 1PILA 1WHYA 3QRPA 2Z0GA 4WP8A 2C3YA 3MMBA 4L6V3 2XULA 3UNYA 4OHVA 1HWJA 4B3RJ 4N77A 5ETMA 3SEOA 5E26A 3CJKA 2P9KB 4A8QA 2B9XA 1JXVA 5KG3A 3BZKA 4LF9F 4DFMA 1VQ8S 2GJ2A 3NGDA 4AM6A 1RHKB 2QA4N 2P5VA 4XH1A 1KLMB 3VGVA 4LRBA 1YITS 3G0ZA 3VQ8A 2VB6A 2UUAK 5F41A 4L8RB 4LSLA 3NBPB 2HNZB 1NDLA 2BYCA 4C2MA 2ZJRQ 2XY6A 1PO6A 1H74A 1U2FA 1SV5A 4IYQA 2RDJA 3RR8A 1XBWA 2KB2A 4TQRA 3C65A 3PX6A 3AJ2A 1XQSC 4PYDA 2NXUA 4FWKA 2UV8A 2X6SA 2IY5B 1BGXT 4GO5X 3QB0A 4BROA 5KRSA 2I5JA 2UUBJ 4GVMA 4KQZA 1S9GA 3WNGA 4AL7A 1S97A 3D7EO 3AVMA 2UUCK 3I0SB 1UA1A 4DZDA 1DRZA 2NRXA 5B8HA 4QS8A 3UNGC 2E1ZA 3U02A 4LR9A 1TK5A 3K0SA 1OY8A 2L3MA 3W3SA 2XNQA 4USJC 1KVAA 3NMUA 1K8KB 4GV9A 1SQFA 1VK3A 2V4JA 1KQKA 3J81Y 3PRBA 2X1AA 1P9YA 1U48A 4FJLA 5BR8F 2NYHA 1XMQF 1IBLK 2BRKA 3PW4A 3DAWA 2FDNA 1DY3A 4XTTA 2CUYA 1N33F 4BCAA 5SZTA 4B3OB 4ELVA 3V1OA 3HPGA 4ZIWA 2GEMA 2W01A 3T6JA 2UXDK 2ZJQQ 4WYWA 4ED1A 2LA4A 1M1KT 3OTCA 2YCHA 1R0AB 1NMEB 3AOBA 5KGXA 1NJIO 2O67A 2QKKA 2GV9A 1QHTA 1YJWN 4NCBA 2YBVA 3UKRA 5AQNA 3MMCB 4ZCIA 1FJ7A 1NBEB 2FZCB 2BEFA 3L0QA 4NLWA 4ZVSB 4BRQA 3DGVA 2V7YA 3R1XA 3QZ7A 3TAQA 2P9NA 2BOPA 4HVZA 1VSDA 1VRTA 2PC6A 2A1SA 3ZEUB 4RPFA 3FEYB 3AVBA 4CLLA 1RAFB 3OS2A 1C0TA 3AQPA 2Z58B 4M3ZA 4IDKB 2JWNA 3H45C 4JKEA 2XMVA 3EE9A 1ATNA 1BI4A 1UFKA 3SUQA 3W9JA 1JL2A 1D8ZA 2V68A 2J4RA 3PHEA 4OZ5A 8ATCB 1FDNA 3UE2A 1GMVA 4DTMA 1YGYA 2I8EA 1K0TA 2NXCA 1RHQB 3I5AA 4OQJA 5J2NB 1JLFA 1GMWA 5DQGA 5GMDA 4OIXA 4NYNA 3TAMB 3VAMA 4E0DA 3OL6A 2GHPA 1UVIA 2ZGZA 1FRLA 2Z1HA 4O4GA 1REVA 4KHMA 2HZVA 4I67A 3DM2B 4N7TA 1G99A 4Z94A 3L7PA 1RKJA 3H5SA 1QZ6A 1V4SA 4IG3A 3VQBA 3CJQA 2X3GA 4WK1A 1FXLA 3AXKA 1WSFA 2P9KA 1S1TB 3H8YA 3ETOA 4CJWA 2NNWA 1HR0F 3QRQA 1DKGD 3T7ZA 3P8BB 4B3RK 2LEAA 1X7VA 4DTRA 4LF5J 1AB8A 3M6VA 3MR3A 1NPPA 2VWKA 2UZAA 1HQUA 2AHOB 3H7HB 3Q8SB 4RW6B 4KSEB 4YY3K 4KY3A 3KG0A 1Z05A 3O44A 2Q6CA 4B1ZA 3ZC4A 4EEYA 2VH7A 1VS3A 4LF4J 3CIPA 3D68A 5CH7B 2OPRA 2KXFA 2MZQA 1WD6A 1UJ4A 4X62F 5FROA 3RR7A 4CJPA 5EWFA 2GVDA 4MK7A 3CETA 2CVEA 3QMQA 1S9GB 2Y8WA 3V1QA 1SC1B 2V69A 1RWVB 1FVQA 1YJ7A 4CFCA 3TQEA 2Y0BB 1XMOF 4Y1CA 3HJVA 4FF1A 1HX1A 1HIYA 4QWBA 3LDOA 1OYEA 3FKBA 3O9SA 3QETA 5BR8J 2Q97A 3PIOQ 1NJYA 4JN4A 2UUBF 2OIHA 1PJ6A 2DTJA 4FWQA 1UFWA 2V8PA 4O4RA 2K3KA 2HGLA 2O8DB 3V9SA 3JB9k 1B0TA 4BC4A 1YIJS 1T9YA 2KKHA 5JVHQ 2A41A 3KD1E 2NZ4A 1FJGF 4X4OA 1DT9A 1YJUA 2B4JA 4BDYA 1R0AA 2A42A 4WU3A 2HFVA 3SCLE 3MWTA 1KVBA 3D0HE 5LMUJ 4IFYB 1BO5O 5HLFA 3UCGA 4KH5A 1SI9A 2P6SA 4CK2A 4OJGA 1RAIB 3SQGA 4X66F 4KHUA 5ETLA 4MFBB 4O0IA 4FYXB 2CQPA 2ZOFA 3QGGA 1B0VA 1UEUA 3EGNA 4ES3A 3OVSA 3M9OB 2WZ1A 8AT1B 1ZBLA 4QQBA 1H7XA 2O8FB 3R7NB 4QIVA 4CZMA 2P5OA 3H2LA 2HBMA 4NWBA 4MKYA 1VQSA 3L2WA 2OUGA 3PUFA 2WB4A 1AW0A 1GFWB 1OH5A 1YVNA 5D0EA 2L9NA 3TUIC 1A5XA 3SIPB 1U4BA 1V3ZA 3BH6B 5HI7A 4DR3K 1S72S 2FJWA 3JYTB 4CBXA 5HROB 4K0KJ 3OBIA 2MHNA 2ZE2B 4JD2A 3FRYA 3BJYA 3D45A 1N0VC 4A5AA 2RIJA 3F2KA 4X4PA 3Q8VA 2G8WA 3IBWA 2AJ4A 4DS5A 2C2OB 1N52B 3QLHB 3CD6N 2XZTB 1W26A 3ZT0A 5HVHA 2AYEA 2JFKA 2IPOB 4BR5A 1UVLA 2VG6A 3R3TA 5K8OA 3TAEA 4HCBA 4K5SA 4U9RA 2QMWA 3GR1A 2GWJA 7AT1B 1VQLS 3TI0A 3DXMA 3ZTRA 1MN9A 2W40A 1QY7A 4B9VA 3OFEA 4J9SA 4LF7F 3T1YK 4JEPA 1T9UA 1GMUA 1X9SA 2P9NB 4QU6A 2PEBA 2D0OA 1SC3B 3VF2A 1HYZA 2OHDA 1NGEA 5DK5A 4CIFA 3WDOA 2W2QP 2XSFA 2VF3A 5AXNA 5ADXA 3DCAA 2LQ9A 4R0EA 3TU5A 3HCXA 4NE9C 3TTCA 2DH9A 3D7SB 2NRRA 1I94K 5E41A 4DSFA 3H46O 1X5OA 3BREA 3ZTSA 5FDLB 3VVTA 1B4SA 4OX9F 3QQCD 5K20B 1YITN 1N34K 4FBUA 4NRTA 5IWAF 4DL4A 4BRIA 4X4RA 4XDCA 4NMXA 2RF2A 2DGQA 5C25B 1IR2A 3G6YA 1Q18A 3P6YC 4KKOA 4LD0A 3QYYA 2RRNA 2KDOA 1GXLA 4FL9A 3U3YA 2CA9A 3QO9B 4LH4A 1CS4B 4CWBA 4ENOA 3P5BP 3AY0A 1PG5B 4TY8B 1VJWA 4CZFA 1T94A 1JLBB 4F8RA 3HHLC 3FQLA 2DH8A 1XUPO 5H9FJ 1NBWA 3LP1B 1YLXA 4MAKA 3M8ZA 1S10A 5C15A 1F6TA 3OL8A 4WFAL 3HKWA 1M5KC 2R9LA 5THWA 4P2FA 3PSFA 1SJQA 5F8NA 1BU6O 4YEAA 4DUZF 1HFEL 3F0NA 3SI6A 1IWAA 3RMAA 1Q9XA 3CFOA 2ZJPL 4BWJA 3HRGA 1WSEA 1VBKA 3TO8A 4F36A 4HTJA 4CLPA 3MUMP 2QWRA 3KK2A 4RR5A 5B0BA 3Q86A 4RZRA 2E66A 2YWHA 3VQQA 1EQ0A 3KWMA 1N33K 1QUPA 4LF2A 2FVSA 1FD2A 2AX0A 4M5NA 4MDBA 4RWWA 1HNZF 3GJTB 4NXNF 3SJHA 1W0HA 1ULRA 4KB7A 1KLMA 1P27B 3TNVA 3CCRS 4CK1A 2CXEA 3MX5A 2WB1D 4U67Q 3SQ4A 3KZBA 4JKHA 1NJXA 5FPNA 2YVSA 3ET6A 1TMJA 4J91A 3BF3A 5LJWA 5GAHP 2D3O1 4KHPF 3MDQA 5LOQA 4DQ8A 4X64K 1Q5YA 4DV1J 4WCEQ 4NLQA 1ILYA 2PY5A 1F1BB 1OWXA 2OMOA 1IVZA 1S72N 4HUFA 3UPFA 1HW9A 2DXEA 2LQBA 3MWPA 4C3LA 4CYUB 2W1BA 1FTCA 3AV9A 3UKUA 1KC8T 2RMLA 3MXHP 4AHVA 2DNKA 5DQIA 3QFWA 2V2QA 3HD1A 1YJWS 3DOMB 1KXPA 1XHZA 1GOAA 1H72C 1WG4A 3W2VB 4DX8H 3CCWA 2RU3A 3MECB 1NNDA 4KH4A 3OYGA 4AHUA 3K5OA 2HOEA 3UDCA 5AQWA 2E7XA 2MEWA 3C15A 3AVHA 2HHPA 2HVEA 2BVZA 2IIRA 5B0CA 1S1XA 2OTLS 4KHPK 3DYAA 3MR6A 4Q45A 4H0YB 4PG4A 3OLBA 2MLYA 1KOHA 3MCSA 1U25A 3O1BA 2JHEA 1O1WA 4J9NA 2W8LA 4MKAA 2QMXA 4M5IA 1T3NA 4M41A 2VQFJ 1N54B 3DN9A 4ED8A 1DLOB 2XMTA 3ISZA 1S1TA 3CUNA 2ZKUA 3TW0A 1KN6A 2N4CA 5A0YB 1FRXA 2LU2A 2B51A 1RTJA 3AB4B 4AUKA 2IRUA 1I94J 1LAVA 3DHWC 2CG4A 2ITGA 3DOKB 2CPHA 2ASYA 4WK3A 1BIUA 3D6RA 4H03B 3R5AA 5J2PB 3W60A 2BXJA 3SMZA 2B7BB 2XYGB 4Q8EA 2RHQB 5JLHA 4CEAA 2QXLA 3VQ7A 3PRDA 3TA0A 4DB3A 3OBYA 3QO9A 2DR7A 4A8XA 1DARA 2LFVA 3PKYA 5KFHA 2UUCJ 2V94A 4L3KA 2GIQA 2OZMA 4IH5A 3NGTA 2IA6A 1RABB 4DR5K 1EJ7L 4C1NK 2YX7A 1VBYA 3QEXA 4HHJA 1T95A 3FLCO 2OPPB 1WACA 2R7QA 1DBDA 3CCUS 4RUAA 1IBMJ 1HBMA 4DFKA 2RQ4A 4D3HA 2PN6A 1NB7A 4ED0A 4NA3A 5KT7A 1DQ9A 1RTIB 5KFDA 1KD1O 4ED5A 3CD5A 4UOHA 1HPZA 3FDSA 2WVCA 1SJ4P 1J54A 3DLJA 3VAFA 3EDQB 5L1KA 3OR1A 2CYYA 3MN7A 3W3DA 3OR1B 1KHVA 4FJ9A 4DTSA 4CGIA 1RTDA 4FPIA 3BQ0A 2VGMA 3H3OB 2BQUA 4E1NA 3LPUA 5JMVA 4PA1A 4O5FA 2HQIA 2EEYA 4JNEA 4E19A 5E3AA 2OPQB 2AX1A 4LF6F 3UB5A 3D2WA 2R8HA 4GKKF 1HKGA 1RT7B 1SUQB 2MQMA 1SUQA 1XC3A 1HNZJ 1L3KA 4G1QB 3CQ8A 4K0KF 3KLIB 4DQPA 3L3VA 3OFHA 3OYMA 4C1NI 4NZ0A 2HPUA 3MFHA 2DYAA 4WF9Q 3O6QA 4ISFA 4KRWA 2UXBK 4JOUA 4DPTA 4Q2LA 3BGRA 2WVEA 4LFAJ 1S6QA 2B8PA 1RTHA 2GA7A 2LEBA 3ULEA 5TKYA 4DHYA 4WP3A 9RUBA 2LVWA 3IN5A 5HRNA 3ULDA 3U8XA 4KV8B 2AGOA 3ZSOA 4KGXB 3Q8RB 2IFXA 1S22A 4B9SA 4C7QA 3KHYA 3VQ5A 3CCMS 4JS5A 4MQ3A 1IBKF 4BVOA 3HHLB 1ROFA 3WXKA 4IRCA 1PJ5A 2B5JA 2EHGA 1S7HA 2OCEA 5FLXO 1NJIT 4E7LA 1F9HA 3CCJS 2Q2RA 3ITHB 2HBKA 3HHKA 3T5HA 4F3MA 1NMDA 1VQPS 3GSIA 2ZUGA 2J6SA 2KG0A 2F9WA 3R2CJ 1XNRF 1FJCA 2IJFA 1Q82T 2NPIA 4ZLNA 4HTIA 3UO0A 1WSRA 5T14A 4ALZA 1O51A 1ASUA 4AHSA 2ASMA 2FHKA 4ECVA 1R0CB 2BQ3A 3AHPA 2FSJA 4JI4K 3H5YA 3OYLA 1NUEA 3DRRA 4DTNA 3T6BA 1SC6A 3H59A 3LDQA 2MZ1A 1TFWA 2P9IB 3AD8C 3N5FA 1U2VA 1Q95G 3QFUA 2IVPA 4OHZA 3O3FA 4A47A 1XQIA 4C9DA 3R2DJ 4K4VA 5J1PA 5G4DA 1NU0A 3ZTOA 4CJ7A 3GU0A 2G8KA 4EBEA 3UE5A 1RWKB 1SS6A 2HGMA 1IBMF 4ID5A 2R8IA 4FJ7A 3H25A 5CCMA 2E9TA 4Y2CA 2G8IA 2YWKA 4QR2A 5IT9U 3CMAS 4WWSA 3V6JA 2JWLA 3DRSA 1RBSA 1P9QC 1G6BA 2LECA 4P6QA 4GW6A 2O8EA 2YNHA 4AXJA 1RJJA 2A5XA 3AOCA 2ZUAA 4EZ9A 2F1FA 1KBRA 3CJRA 2PSZA 5A76A 2FLNA 3O80A 2PZSA 1HBUA 2MQQA 3GPAA 5DDOC 1P1TA 3VAIA 1FJGJ 2OZSA 4P2MA 3BEGB 4NYOA 2D0BA 4IUFA 2MSSA 2X1BA 1U6FA 2UXDF 4XPEA 4W98A 4Q7AA 4DV2K 5CYJA 1A6LA 3UVJA 4USVA 2NUUG 1BY9A 4OKEA 2BE2A 1FD8A 3EX7B 3UR0A 2DFHA 4PG8A 2ZNYA 5HAOA 4PL8A 2KVQE 3GJQB 4H0XB 1U2VB 2X6NA 5ITHA 1UKUA 4TY9A 1ZM9A 1U02A 1J2VA 3K59A 4NXMJ 1QE1B 3M8QB 3MPUB 4UT4A 3VTIA 4OI2A 4LF9K 2GQQA 1AFJA 2QL9B 2HBYB 3KK1A 2G2ZA 3IS9A 3H42A 5IQQA 3WQPA 2O8EB 4KTWA 1WSVA 5JICA 4QW9A 4NLOA 2VQEF 1H2VZ 2IVYA 1NNEA 3PW2A 2WBNA 4TVAB 4NLUA 1UVNA 4JI2J 4PY5A 2IMWP 2WSFC 1N6QB 2JZ5A 2QLFB 1NO8A 4N47A 4URQU 1WAFA 1YZ7A 5C7PA 5BJRA 2J6UA 3R6LB 1DEJA 5KFBA 3MM7B 4KT0C 2YHAA 1VC6A 3G87A 3HYFA 5DDRC 1ZH5A 2XHWA 1CEZA 4DUTA 4A8MP 4URGA 2P8IA 2EFNA 4KI6A 1BD6A 2XI2A 1KR4A 2RUSA 4PXEA 5DLGA 2QSWA 1JXBA 4CH0S 3PIOL 2MZSA 2LEPA 5AZIB 1X9JA 4DV4J 4C0BA 2NCKL 2W6LA 5AQIA 4FLYA 2P9LA 5AJ3K 3NOCA 2MKYA 4TY8A 4X4UA 5ETKA 2Q31A 2R7WA 1IR0A 3ADAC 3D28A 1E6YB 1ELOA 3R5GA 4OI0A 1TKZB 4MMOA 2B0GA 1VMBA 3DRPB 5AFUA 2J6TA 2V67A 3SQ0A 3MPDA 4Z7YA 4BRLA 1LW0A 3M2UB 1WUAA 4KV8A 2HBZB 2Z2MA 4YHHJ 2VFUA 4YR0A 2V8VA 3G6XA 1NLVA 1S0NA 1HBUB 1FDBA 2VWBA 2GX8A 1U45A 1JL1A 3P4UB 2OP5A 4PQAA 2XYHB 1VK0A 5E0OA 3SAFA 4K4XA 1DTQB 3GSDA 3FGUA 2XO7A 4DSIA 3PFEA 2FIUA 2GIRA 4NA2A 3TVZA 3I4HX 4DR7J 2V8HA 4Q2MA 5KFTA 3R5DA 3DU5A 1S0MA 3IM9A 2BJ7A 2PFDA 4LUBA 2H5JB 5AQXA 2HFNA 5IQ6A 4CM0A 2XSJA 2NUBA 1TUGB 2UXCF 3SMPA 5DGBA 4B1XB 1RHUB 2IVNA 4ZN1A 2HZCA 4IDHA 3GYGA 2DGOA 3FUYA 2FHOB 1L3SA 2H3GX 2G2OA 4Z4CA 3OYHA 3CMAN 2DK2A 4CBWA 3D6FB 3HHEA 2QN6B 3MEKA 1UEKA 1I39A 3AY9A 2JRSA 1YJRA 5M1OA 3P38A 2WK4A 2HFOA 2DFFA 2AT1B 1YRTA 2F9DA 4OYAA 4EWTA 4PG5A 2HQCA 4CLZA 1R6YA 1TFYA 4NXMF 1OMSA 5FRMA 3QERA 2NREA 1TAQA 3M1VA 4CGDA 1ASWA 2QV6A 4YDUA 3GFHA 2E1CA 1FFWB 3SFGA 2J8SA 4WTYA 3HD2A 2F4VF 2B6AA 4P2SA 2BACA 2DNNA 4LJMA 4CH1A 1Z2LA 2DY4A 3OW2R 2VQEJ 2ASPA 3D3BJ 1XWLA 3CFRA 2RRAA 3U1MA 3VAJA 3IWNC 3Q22A 1GTHA 3CM5A 4H8KA 3P83D 2FUG9 1GXUA 1DZ5A 4RW9B 3Q89A 2MJNA 4FSVA 3DGPB 4GVEA 3B4MA 3KDOA 3MM5B 1EZZB 2XWXA 2BGGA 1Q8BA 2C28A 2AV5A 3RB6A 5HMWA 2YX4A 4QYZK 5KGWA 1RT6A 3SXLA 3UI3A 4H4KC 2W2MP 2KM8B 4K4ZA 3CXCM 1Y5IB 1RYSA 4CJQA 3L9ZA 3OS0A 4I0WA 5AQTA 4R5PB 3DOKA 2OPPA 3GONA 1KAYA 4B1UB 4CJ5A 2B4OA 2H5EA 1RAAB 2H3EB 1ASVA 1KQFB 2YWGA 3S01A 4H5NA 3PTWA 4C98A 5GADI 5E5NA 3MGJA 1NGJA 1XNQF 2B9EA 4G1PA 2MKHA 4CEEA 3GTYX 2GZOA 4FOEA 1SB6A 4LFCF 2FC9A 4XIUA 3I5CA 1RDUA 1L3VA 4ILGB 4KO0B 1RBLA 1NG9A 3MD1A 4CW7B 3TR8A 2UUAF 2Y1LB 1JLFB 3EICA 3CWJA 2CPEA 4I9QA 3D9BA 2DO0A 5ETRA 3TVYA 3VF4A 3KLEB 5HQ8A 2A6AA 2XNRA 4FNIA 1CLQA 3HPHA 1WB9A 1KQSM 5B08A 3VAHA 2EFQA 2DXDA 5F0XA 3QSYB 3PYFA 1VQMS 4KJIA 2IMOA 1IR1A 1RWMB 3QBCA 2RRBA 1WNEA 2QWMA 3T19A 1D9FA 2E5JA 1TL7B 4TU9A 2VGNA 3K89A 4DL0C 4RU9A 2BE2B 4Y1DA 1NAQA 1FRKA 3NAEA 3BO2A 3M9MB 1X3NA 5AZIA 2OSQA 4KTZA 4ZN3A 2LXUA 4DWIA 4DV0K 5KT3A 1OSCA 1KAZA 3N28A 1FXDA 2FZGB 2MHEA 2W9AA 2MQPA 1SL0A 4CF9A 4JKDA 1LAWA 1Q8KA 1JK9B 1FO1A 2RHSB 3OR2A 3OYKA 3AJ1A 5L1LA 4ZCMA 1RDDA 4ED3A 1ZETA 3CCTA 2YX6A 4TKTA 3K5PA 5IM0B 2HMPA 1NM2A 4DR6K 1OH8A 3PYEA 2CQ2A 3M6XA 4PXBA 4B9TA 3KLVA 1NHUA 4JI0J 1URRA 3AVIA 5J1EB 3TANA 1UOCA 4CNZA 5J2MA 2ZNZA 3O8MA 1PYTA 4K5RA 1K47A 2RNEA 3EO3A 5JS2A 2N3LA 4DUZK 1FI4A 2A1RA 1E6VB 3TRGA 1U1QA 2M2BA 1UFLA 4WFBL 3OLAA 3GIJA 3KLHA 3OFFA 3L4BC 4F3QA 2E5LJ 4BRDA 2ZF5O 2ZH3A 2O3DA 1X3MA 4H0OA 3C16B 5B0DA 3DDKA 3P1GA 1U8SA 3OUYA 5BR8K 1ZAXA 4H5VA 4DV4F 4DV7J 2I6WA 1R7IA 3P31A 1X31C 3R9LA 2CDQA 1HNZK 1BIZA 1XC9A 4WPAA 5C2GA 4LRDA 4KB1A 4Y28C 4PKIA 2F4VJ 1HHQA 4LBPA 1XEZA 5A8WB 4Q8FA 3WC2A 2AF6A 3GP9A 5DG9A 1OKJA 2R8KA 1RBRA 1YJTA 4RNHA 4A46A 1CS4A 4QIEA 4J90A 3A4TA 2ZBCA 2GGPA 1PKUA 4EHUA 2E7WA 5FLXY 3LOUA 3BO4A 1RT7A 3MMAA 7FDRA 2YTCA 4FYDA 4FJHA 3MI7X 5K8PA 4LIWA 1TV6A 3KUHA 1KQSR 3U9DA 3O3GA 2MGZA 3M30B 4AYBD 3I8DA 3D6TB 3N9UC 1JXEA 4DPWA 3ZT4A 5DG7A 2JEGA 3R6GB 3DXSX 2EK1A 2CFXA 4G65A 1FNMA 3VTHA 3BSAA 2DJWA 2VV5A 4FJIA 2R2SA 2OMLA 5T7LA 3OUYB 1EQMA 4CO3A 2W9BA 2B9WA 3M2RA 3PR4A 4ELUA 3NGKA 2G8HA 5EOYA 4DZ6A 5AFUH 3HLUA 4CI6A 1YBTA 2PMWA 4U7CA 1S1WA 1L3TA 2XRIA 4DL3A 1QD1A 4ZDNA 3AVLA 1NGCA 3LQVA 2D3UA 3AA2A 5DETA 4FWOA 1HYSA 2IJRA 3GJSB 1WSGA 3ILOA 2XSJB 2QZ8A 3ZX2A 1TL4A 3S8SA 3CIMA 3WNFA 2YY3A 2VODA 2W2OP 1FXRA 4FZZA 4M5JA 4YB6A 5A2QO 2F65A 1CJTB 1U6ZA 3PEHA 2JSXA 5AR0A 3MCPA 4C8OA 4WXWA 3E2EA 1ZAVA 3PSIA 1CXUA 5KPTA 1UW9A 3V6HA 1W97L 2E6MA 3D2EA 5BPMA 4DV5J 3NS7B 4L73A 3WNEA 2YJEA 1NWKA 3JQMA 2XTJP 5IWAK 2ATCB 1RAGB 4HYKA 4DSLA 1HI8A 3GV5B 1IWGA 4OV1A 3R9PA 2C3MA 3IR6B 1H38A 1NGBA 4ZHRB 4YOUA 1U7LA 5BXIA 2FF3B 3WQUA 4BDPA 5G0RA 4I64A 1C4CA 3SJJA 3DLEB 1WSHA 3ZZYA 2Q79A 1F5CA 2E2OA 2POKA 3VQSA 5AQHA 2H4YB 4R8UB 4RNNA 3MAAA 1N5YA 1S0OA 1TKXB 4OJHA 3Q8UA 4WE1B 4DMNA 4FF4A 3D2FA 3G8QA 1FJEB 2E2NA 2KJWA 1U0HB 2RDDA 1N33J 2CIMA 2DGXA 4KGMA 3RZAA 2ZBRA 2VG5A 2M4MA 2CNNB 1LW0B 3ZLJA 5KFOA 3PKMA 3R7BB 4GVLA 2F5GA 3C94A 1GLLO 2Y3YA 4HT5A 4OHWA 3ZYYX 4DR6J 3AO4A 3VCDA 1HNIA 2BJEA 4V19J 2XYPB 3PX0A 4BHQA 2UUAJ 3M4XA 1WKJA 3M1VB 2IC3B 4HHHA 2HSEB 1JMTA 3FE1A 5J1EA 3UCUP 3DLRA 4CK3A 2CZ9A 4H4OB 1KVCA 1T6DA 5I3UB 4DV1K 5M1FA 4WTOB 2V52B 4B9QA 2QSFA 2ADBA 3X3UA 3CDWA 3W5ZA 1C0GA 2C22A 3NCIA 1CXQA 2UXBF 3BB5A 2IDEA 2RS2A 4C97A 3BP8A 3MN5A 4R8UA 2VG7B 1QAJA 3NF6A 2PMZD 4TYAA 4C8MA 3B6OA 4ZVOB 3KKFA 2DKOB 2D3ZA 4F4ZA 4OZLA 3CQYA 1OVQA 1TUVA 3KUEA 2Z2ZA 3CYMA 2GJFA 4JHDA 1HLWA 2QYGA 4QS9A 1IKXB 5JVGQ 2DGTA 1N48A 2UVRA 3GL1A 4FXVA 2GTDA 5AJ3J 2DTUA 2ZEJA 3LP0B 1GK8A 1HWKA 5AZJA 3FFKB 5B0AA 4WE1A 4Z0UA 2DT9A 3VR1A 2UUWA 2VPWB 2ROEA 3K7RA 4OJ1A 4ANDA 4F9OA 5T7BA 3R5CA 1BHNA 3C6TA 2NPFA 3WXMB 1YTUA 4DV3J 3K5LA 3QAUA 3QJPA 3PJWA 4YY3J 3GIMA 1OPZA 4YUDA 5HK4A 2YWWA 5LJ3Y 2CPJA 1IQZA 2DRAA 4BLGA 3DOLB 2B43A 2W2PP 1BA1A 3PLAA 3KLGB 2ZHAA 2J0QD 4CO0A 2WVBA 1RBAA 3WX4A 4ZPWR 1YXQA 5IFMA 3O9TA 2VYPA 1FKPA 1RILA 4R0JA 4IO1A 2CQ1A 1RYRA 4IOBA 4JHDB 2UXCJ 1HPMA 5HP1A 4PUOB 4LF4F 3JQJA 1YVUA 4ECYA 4BG8A 2OI2A 2VQFK 2ALZA 5IWAJ 3V1RA 2V9KA 3AT1B 3I9V9 4YDXA 2C2MB 2G8UA 4OGEA 5D78A 1QLNA 1CC8A 3VQAA 2O1PA 2HFUA 2CQ4A 1R59O 4ICLB 1QQCA 4E1JA 3RBDA 2XC9A 1ZAWA 1ZA2B 3E9PA 4PWDB 4XH5A 4ZVTB 1NKEA 4J9LA 3LM2A 1SIZA 2P9UA 4RBTA 4PL7A 4F0HA 2E5LK 3LL3A 1HHSA 3PDNA 3JSRA 1ZPVA 1Q4RA 3KKRA 4JI5J 2V2KA 2M5YA 4B02A 3NVMA 2M9KA 1SH2A 4HI2A 2MQNA 5ADZA 3ZFVA 4C3KA 5KFEA 1EWRA 4QJVA 4P52A 3I0RB 4GV6A 3IM8A 3KXDA 3OTOJ 3C46A 3GV8B 2EWHA 1WHXA 1TTHB 5KRTA 5HN0A 3UIQA 2P9GA 1EETB 3M8RA 4JKFA 5B09A 2M0GB 1QVFR 4WIIA 4J9MA 3S6EA 3BDPA 2GUPA 3TSPA 4QWCA 2GVZB 2CPFA 3QT6A 4DR4F 5F8MA 2JOQA 1HR0K 1VBZA 1K8AT 5ADXH 1RTJB 5JXSA 4ZKAA 4ZLLA 4FM1A 1QSSA 3RBEA 1VQ5S 4CJSA 4DL7A 1T03A 1XERA 4W5NA 3SNNA 3HP6A 4UY8O 3AO5A 4K0KK 3CSKA 4QYZJ 4FS1A 4DX7A 4RNMA 3CJCA 2AEMA 5E2QA 3Q0AA 1LCUA 5J2QA 1HL6A 4EUVA 3BKFA 4EP5A 5C25A 1RWXB 4KGZB 3IP0A 3PW7A 4GY2B 2FGCA 4C11B 1SV5B 4GVBB 3QBWA 2Q0UA 2NXJA 4JI2F 4C8NA 4RUCA 2FVCA 2MKIA 1VIXA 3PCOB 1ZYQA 1HWLA 3MK6A 4ED4A 3AB2B 2K8GA 4M95A 3EDRB 2J76E 1VQNS 3BPDA 1NMNA 3MUVP 1HUXA 1T05A 3MMVA 1VQ9N 3D6MB 1YI2S 1NCLA 4NLBA 5CAAA 4PR6A 3JTPA 1YTAA 3HFKA 3VQ4A 2CJKA 3BF1A 4USTA 4MYUA 1X4AA 1VSHA 3O8WA 3AO3A 1WAJA 1YJ9N 2AW0A 2VKZG 3PW0A 3C7NA 1Q81T 5AJ3F 4JI1J 4JI6J 2E9ZA 3H3NO 1VRUB 4OLPA 4NLSA 4LFCK 2DNGA 2DHXA 4DXLA 4B1YB 1A5WA 4CGHA 2FF6A 2OH2A 1MMLA 1RAEB 3A5NC 2G8VA 4FO0A 4B8AB 1Q82O 3KLFA 1TKTB 1S7IA 1TUYA 4PHTX 3RW6A 1MU2A 3I96A 1ACMB 3MM5A 2BR0A 4CM2A 1NSKL 2V50A 4M5DB 3EYZA 1HNWK 3OL9A 1RT5A 2HHXA 5TKWA 2ADCA 3C3LA 4L74A 1H2UX 3NF7A 4JV2A 1JLAA 2DNPA 2KM8C 3W66A 2VJUA 3R97A 3QRRA 3CCLS 4YMEA 2M7SA 1HNWF 4ER8A 2AMCB 3IWLA 2V8DA 4DR7F 4Y0FA 3HHNB 1TUUA 2XS7A 3VQCA 1MWYA 3VEOA 3MM8B 1O5JA 4JI3J 1X8DA 2HF3A 2DR9A 3FBEA 1VQKN 5I3PA 1GX6A 3LW5C 3EE8A 3W64A 4DG1A 1C1AA 4F0KA 4H5RA 4WQ5C 1EKSA 2BTFA 2OYQA 2LQ8A 3ENQA 2CQ0A 1NSPA 2ZJPQ 1BQNA 5M2RA 1EIYB 1Q78A 1YWXA 1GLJO 4F25A 3MXMA 1BMQB 3BQ1A 1MU2B 5GMKa 4V19X 2GW8A 3H5XA 4LF6K 3PHTA 4FOIA 1K44A 2BJ3A 2HMIB 1RDWX 4E7JA 4WIQA 4LFBF 3OPKA 1IG8A 3TQ1A 3O3HA 4GVBA 1RWPB 3QEWA 4G1QA 2XCPA 3RMCA 2CZVC 4KH0B 3H40A 1D1UA 3HSZA 5HL7Q 2RH3A 4X64F 3BR9A 4DLEA 2P9PB 1KTVA 3EVMA 2EBEA 4YY3F 1RCOB 3RGIA 2W8KA 3P5JA 3KUGA 1LOUA 2GAHC 1FKAF 3KTQA 5F3ZA 4ECRA 2PBDA 1E4FT 4J8FA 3AA5X 3IA0A 4JKCA 1B3TA 3KHLA 4FVUA 1FNXH 2FLPA 4CHNA 1VRUA 1LWFB 3CMQA 2QRRA 1BISA 2BKNA 3QATA 4MLEA 3CJ4A 4DU7A 4ANCA 1HR0J 3RMDA 4DR4K 4K8XA 3U3GA 4OPAA 3M30A 2EPIA 3HMJG 1NGIA 1VDHA 2XMKA 1S9EA 2MXYA 5CXTA 3V4IA 1O8BA 3CPWM 1U26A 3NE6A 2DEIA 2BUNA 3JTOA 3K9JA 1OY6A 2KO1A 2XWYA 1M0SA 3IGNA 1HRHA 2CJYB 2PA3A 5LMNJ 4CIGA 1HPZB 3VQTA 4QU7A 2O4IA 1RI7A 2W9BB 4ZVUB 5CY4A 2KFZA 2DRDA 1WOPA 3OXGA 1RUSA 5J2PA 4DF4A 1KP6A 3QAEA 4TU8A 4BR0A 2LA6A 3CO0P 3W2VA 3UCZP 3SV4A 4KHYA 2RU9A 4C8ZA 5DO2A 1FT8A 3TZXA 2PE8A 3G82B 2CGKA 3SCJE 5A6PA 2FD2A 4FLXA 2Z57B 1YHQS 1XI1A 4ISEA 2MKCA 5L1IA 3Q83A 4DPOA 1LXJA 5KT6A 4X62J 3DOLA 1VQ4S 2IA0A 1JWWA 1NH8A 4NA1A 4MKVA 3MPWA 1NGHA 2KT5A 4J9RA 4ETXA 4C6AA 4M5MA 5ETVA 3SPYA 2RT3A 1N34J 3FCWA 4B1WB 2D69A 4CERA 4DX6A 3E9LA 1BHLA 3QINA 4OZNA 4H4KA 3L2UA 5JMNA 3D0PA 2ITMA 2CNLB 2XLIA 4CFDA 4M1KA 4E8UA 5F1XA 2NRWA 2HHVA 4KI4A 1SKRA 1JLGA 3GIIA 4LF1A 3K8VA 4CHQA 2IAJA 1C0UA 2Y0SD 3L7OA 1LNQA 1IKVA 3HP9A 1KDNA 6FDRA 5CE3A 1BCOA 5H9FK 3HM9A 5KT2A 3ISND 4K8ZA 4PCQA 4DTXA 2P6TA 1VC0A 3NDKA 2KXHA 4QWAA 4NB4A 3NAHA 1TZ0A 4FS2A 3QT5A 1RB0A 3CCUN 1BCMA 3KK1B 5AQJA 2BOAA 4QWEA 1Q86T 2Y1JA 3TWZA 3TR5A 3QEVA 2HNDA 3JSMA 4BC2A 1VSFA 5LM7E 3GV7B 2UXBJ 1BWVA 4L3NA 2CGJA 2HWHA 2H51B 4CECA 2DEJA 4JBCA 4FVMA 1S9EB 2QX0A 3WUHA 2Q36A 1FA0A 3DU6A 2W7PA 4V1Ak 2EW9A 1NKBA 1IJFB 4KR0B 2DXFA 3IG1B 3E1YA 1VQPN 1N5SA 1DQ8A 1LWFA 2YKMA 2FVQA 1ZBUA 4F3OA 4M45A 4DV1F 2HQGA 4NRUA 2ZKTA 1R43A 4J9KA 2EFPA 3WT0A 3HFZB 1CVJA 3V9XA 3VN5A 2IVFB 3IDHA 4BR4A 1REVB 4WFYA 3R6MA 2F8MA 2BDPA 3LAMA 3MR2A 2DPNA 3QIPA 5HBMB 4DQSA 2AQ4A 1UAXA 2QFIA 4E2FB 3C6UB 4F4YA 3GDQA 3MAAB 4UTGA 4M5DA 1KLNA 1WC5A 1UPMB 1VOMA 2W7AA 1UVKA 3M8WA 3CJ9A 4HH0A 2I38A 5KT4A 4JI6K 1Y10A 4RW4A 4H0VB 2JJ4D 2RQKA 5LL6Z 5CR4A 1VLOA 4YHHK 1Y11A 3BSCA 3MEDA 3EXYA 2KZMA 4OLAA 4X4QA 2O8FA 1LFWA 4PWUA 1NGFA 2BKOA 4JAXA 4OZ2A 4LQ9A 3EY1A 5B0FA 2DNMA 3M1FA 1T44A 3N79A 4ZPCA 5A8WA 5CZVA 2HHSA 4CNYA 2ASOA 4IG0B 4PEOA 4DPUA 4IO9Q 1NDKA 4R25A 3ULEB 4CEQA 1T9WA 4ZCKA 3SK3A 3VENA 4ILLA 3RB3A 3L3UA 4I6MB 2A0FB 2OKQA 1VQLN 4HKQA 3ISNC 2MB0B 4D3GA 2K1RB 4GMKA 2R3VA 3LP3A 5DM7L 3DLLQ 2R7SA 3D4JA 3UD4P 2E5IA 3G4SS 3MURP 1QHAA 5KG2A 2DIUA 2JEFA 1U24A 1ZM2A 1Q5VA 2W2NP 3GE9A 4CO2A 4B3MK 3JSYA 4DPXA 1U1MA 3V81B 4ZK7M 3HVTA 3HJFA 3WXLA 1IV0A 2D9OA 3DHXA 4BS2A 1RTIA 3FRZA 2AJFE 1APSA 3QFPA 5KI6A 3W2WB 2J0WA 3LP2B 4DL6A 3QESA 4N8NA 1XMOK 2ZH1A 3QICA 1EAYC 5C2FA 5KG0A 3THTA 4IFEA 5E3RA 2ZM6K 1N5YB 3D1OA 4MO5A 1VK8A 3ELHA 4P75A 4FJXA 3HI0A 4BRGA 1WORA 2XZDB 3L3CA 1BWEA 1WC1A 1ZZNA 3SCXA 1N36K 4ZPAA 3NWGA 1AXQA 4YOTA 4V19S 3O4WA 3MECA 3NXZA 5B0GA 5D3GA 1CC7A 3M8YA 4FWSA 3KIOA 1TAUA 2QYCA 1VQ6S 5ETSA 2V51B 2F8TA 1TR0A 3NNCA 4IOAQ 3WEEA 5D6GA 4EBCA 4XDDA 2QA2A 1VJQA 4UOGA 4BRKA 4Z2XA 4DU3A 1SXLA 3H6EA 3V6DA 2HMIA 4B3RF 3B4DA 4FLZA 3GG1A 2UYTA 2IVOA 2KTQA 3NL0A 2VKRA 2J0XA 2QTDA 4E3SA 4LFBJ 3ZTQA 5HMXA 1F2HA 3C8YA 1GNKA 1DTQA 2CH5A 3CDUA 3V9UA 3A13A 1QJHA 4MTPA 4DN0A 1X5PA 1L5UA 3RRHA 3SDEB 3RBXA 3TEHB 1RFQA 3EVWA 2YWFA 4A2AA 1OS5A 3CCQS 4JRPA 4M63A 2YKQA 2IM0A 3M2RB 1M5VC 5LJ5Y 4Y3CA 1F21A 2UUBK 2UVWA 4JV5K 2YQ1A 2YQ3A 3M6UA 5AT1B 4KB0A 2PMHA 2C2KB 1Q9YA 2V2ZA 1RU2A 5DGAA 1AZSA 3BY5A 1WJ9A 2MY7A 1G4CA 2ZWPA 4JI8K 3LWLA 2QC3A 1KSPA 1S59A 1VQ6N 4CLWA 3GIRA 5CCLA 5HJYA 2KH9A 4UZCA 3M32B 3VAGA 3B8HA 1HWUA 1FJGK 3IR7B 3FJ2A 4O0NA 4BE0A 5I9EB 4DS4A 4QOZB 3BYRA 4P72A 4RCHA 3OYDA 2WSCC 2LKZA 3TABA 4GNIA 2W4PA 2IVMA 1F60B 4NI2B 4J2DA 2DB1A 3K5NA 4DN9A 2UXDJ 3J7AP 2GVDB 3Q2SC 5AQLA 1HNXF 2J9DE 2AWZA 2GQCA 2ZM6F 4TU7A 4KAIA 4J7CA 4USUA 3MM9A 2XMWA 1H1VA 2HS3A 1JX4A 1RWOB 5CABA 1WG5A 4CZJA 2R2RA 4NEYA 5D0RA 3HVWA 1JJCB 1ZM3A 3THXA 4JLHA 3NEKA 4M5LA 2V5HG 3VEZA 5C2CA 4P73A 2G0CA 1RQ0A 4S0MA 4X62K 4UOFA 3OY9A 3VAKA 3BKUA 4M3YA 5AXLA 3CC4N 1PCAA 2MJUA 2HRYA 2WW8A 3VPZA 3O3LA 2X51A 2ZH4A 2VD3A 3ETMA 4O4GB 1I1GA 3D54A 3T1HJ 4JI4J 2EFOA 4RWTA 2ZHOA 4CEDA 1Z26A 3DRYA 4LH5A 1N5QA 4IOCQ 4UY85 2V0NA 3ATVA 2K06A 1KFDA 3IMXA 3V6KA 2CJ9A 5HL7L 4K4TA 2VFTA 4J9QA 4I2PA 2E2QA 5C42A 4N41A 4MIAA 1OQ6A 1MLAA 3BGRB 4MDAA 2V7ZA 4WU2A 1E4GT 1HW8A 2PI5A 2G1HA 3NGYA 2RE1A 3SCKE 1M90T 3VZIA 2RE2A 1UWBA 2VOPA 2JWKA 4Q43A 2HHHJ 1RCXB 1FKOA 3MPVA 2HS0A 2W42A 2HWIA 5JLFA 3AGRA 1KCFA 4HWIA 3RJMB 2IS3A 5FDLA 2W41A 1U0SA 3AAWB 5KOXA 5EU7A 4DHVA 3BBCA 3T9NA 2EC2A 1NK8A 2NSBA 3BN4A 2OFGX 1SKUB 5RUBA 3MAQA 1T9VA 2NRHA 4A61A 5GAGU 3GWCA 1IBMK 2FPHX 3IKMA 1D9DA 2DHHA 1MROA 3SUNA 2A1BA 1HBOB 4JUZA 5HO4A 4C8KA 3CB4A 1JNRB 3MOZA 2QG9B 4LFBK 4XO0A 2CRLA 3E66A 3JXUA 3LP0A 1FF2A 3Q2TC 5AZJB 3QPIA 2ZWOA 4A4JA 5EX3A 3MMAB 2KFYA 2CVIA 1UZDA 2QO3A 2XLKA 1TK0A 1LK7A 3C19A 4BRCA 4DUYK 1HLUA 5FPEA 2C2NA 5M2UA 4HTLA 4X84A 3ZZRA 2V8GA 3IRXB 1KAXA 2VASA 3UDLA 2C1EB 1AUDA 4BDZA 1H7WA 2AYBA 3AA4A 3D66A 1L3UA 1QAYA 2ZVIA 1FX2A 1SVDA 4AD6A 2CJAA 4ZTJA 3AXMA 4O0JA 1UEVA 3J7YP 1RTZA 4G1IA 2XGQA 1B92A 4AE5A 1CBKA 1K8KA 3FMBA 3LUYA 2ASJA 3TUPA 1JNZB 2DFEA 3D1HA 4ZVRB 2DRBA 3BSNA 5L8RC 3DDNA 3JTNA 1JJ4A 1H98A 2MYFA 3EWGA 4USHA 4CLYA 3AA8A 4E7IA 4Z4EA 3QDKA 5F0WA 2CPIA 1UJ6A 2MKSA 3C95A 2COLA 2B3TB 2IIHA 1IKXA 3KJNB 2BKPA 1FEEA 4TLQA 2H9ZA 5GIOA 2ETJA 2KJVA 3G6EN 2VPXB 4BGAA 4JI8J 3I33A 2ERRA 5KFXA 4EMDA 2BA9A 5KFWA 3NCPA 3VMFB 1YVFA 4BE1A 4FWRA 2HK2A 3JQKA 4FDFA 4I68A 2GFFA 2HKEA 1LW2B 4JV1A 3KKSA 4BBYA 3SFUA 4DSEA 3MM6B 2BANA 3LAKA 3IRWP 4DV0F 2QWQA 1EP4B 3CIZA 4DR2J 1J5EF 5AQQA 3LPYA 3N4QA 4YOXA 1V4TA 2ZH9A 1NB2A 3DXKA 2HBQB 1N8RT 4WF9L 2OANA 3KMQA 4XPCA 2VONA 4F67A 2YHYA 5E84A 3OFGA 3VEXA 5BREA 2VDIA 5KFZA 2B5JB 2FJBB 2AZ3A 2EFGA 4I2QA 3ENAA 4B3MF 1AUSL 1MWKA 2ZOMA 5EUHA 5CQGA 4UF4A 2O8CA 4Y2KA 1ZS6A 2J0SD 2E5LF 1IBCB 2VBXA 3MN9A 1NPRA 4ECTA 3J80O 5FIIA 3QNWB 3MMJA 5CD4H 2YV0X 1F0XA 3AH6A 2IM3A 5H9EK 4U7UK 3VEVA 2GS8A 4WFBQ 4TQSA 4FLTA 3NGIA 3SAGA 4H5WA 3W7BA 3IRXA 4TN2A 2NUHA 4CD1A 1G3OA 4KHNA 3DXKB 2RB7A 3BSOA 4PYAA 4LBHA 1SH3A 1T9TA 3WEEB 3CJ1A 3PV8A 3KVGA 3EE3A 1E6YA 4E89A 3CPWR 4EYHB 2DHAA 2N4DA 2X74A 2BRLA 2ILZA 5D3GB 1Q7YT 1VCTA 4OPHA 1G1XA 3FGVA 3FMWA 4UQTA 1O13A 4HCCA 1HKAA 4RW7A 2VC1A 4X65K 2HHHK 3QT8A 2HHUA 1RADB 4Q44A 3T5LA 3Q8YA 3OW2M 3THWA 4J2EA 4DL5A 2VICA 4DMZA 3ZT2A 3R8YA 2HFZA 1MNEA 1S1UA 3W63A 5T7LB 2RS8A 3CXCR 1EARA 4ZS6A 3L8BA 2DITA 3GFXA 3MOJB 2QIFA 4CT8A 3J7ZT 3O2IA 3G8TA 5HP1B 5KFUA 4B3OA 2E29A 4KKOB 3EPGA 2AJ2A 3DI6B 5ETNA 3DWLA 3HOTA 1VC5A 5JVHL 3DRXA 2YKMB 3CCQN 4ZP7A 4CFBA 1R8PA 5LT5A 3CC2S 1R3NA 3R3LA 4DU4A 1RBOB 1UCNA 3D3CJ 4G3IA 4C8LA 2BMBA 4OGCA 4FK0A 3T5JA 4O3PA 2O8BA 5BN8A 2RKIA 2BUPA 1W7AA 2NLWA 4KYZA 1HKBA 3S41A 4OL8A 1N0UA 2Z1JA 4OHXA 2HHQA 1U47A 3JAMO 3NKYA 1V5VA 3N6NA 1RT5B 2JLGA 4ILHA 4YOWA 3WIVA 1X4CA 4YOYA 1QZ5A 4LFCJ 4DFPA 1GOBA 1CJUB 4LF7J 1OH6A 4NLXA 3D5MA 4YDDB 3LDLA 1TMMA 2G0JA 3CTRA 3FBFA 1VQ8N 4A8FA 1V3RA 1XN9A 2DNYA 2VFRA 1WUUA 2AJ0A 4LR7A 1UWBB 3KK2B 4O8KA 4M3TA 5EX5A 1H73A 4B3TK 1T3VA 4IDKA 5BN9A 1HNWJ 5B7WA 5DMRA 1DTTB 4K42A 1PAUB 2PI4A 4M3XA 4CZCA 4DOZA 5M1QA 1RTDB 3ULHA 1JB0C 3U7JA 3GLJA 2UVUA 1P1LA 2R7OA 2WW4A 5FPDA 3MM9B 2K3IA 1Q16B 2E1AA 3G9CA 3DYAB 3A5LC 2D1KA 1NGDA 3WQTA 5L9NA 3KLFB 4FJNA 3GFYA 3FNNA 2YQ0A 3F73A 4RW8A 3BBBA 1NZAA 1TELA 3UD3P 5K8MA 3HI9A 2N82B 3IO1A 5GADU 2K2PA 3F44A 2IBOA 1VQ7S 2FB0A 2LCWA 1RT2A 1HYSB 3TTDA 4CJ3A 4CLKA 2FBTA 2ZBPA 2IBKA 1SBRA 3IXQA 4Q5VA 2NLXA 1SC4B 1JLEA 2YNFA 3SI8A 4P2XA 2AP6A 3VHQA 2VFSA 4H0PA 3FFIA 2JDJA 4I6YA 1VI7A 2AYMA 2ZH6A 4QS7A 3EZWA 5DM6L 3E9OA 2XS2A 4XH4A 3CJ2A 3DXBA 4YS2A 3KNAA 1VSJA 3NGZA 2BZ2A 3PEJA 2HBRB 1YBAA 4K4UA 1N5VA 1RT4B 4K7QA 3CJ3A 2MGZB 4ITSA 1NSAA 6FD1A 3K9KA 4AHTA 2WBRA 3OYIA 4QOTA 3ZXWA 4MJKA 1Q8LA 3C6HA 3L4QA 1F5AA 4L76A 2ZBQA 3AJDA 4ZPTR 4RTFD 2VG6B 2JC0A 2Q1LA 1H6KX 2GNKA 3US5A 4JI7F 2PGCA 1RA6A 3OYFA 1RT3A 3EGWB 3F5TA 3H4DA 4LSNB 5IT4A 1C1CB 3ZETB 1QDUB 3TEGA 4DR1F 2YJFA 2WBMA 3B54A 3MMCA 4CEBA 2KL8A 4JB8B 4DL2A 1ITPA 1RNHA 4TNOA 3EM1A 3JSBA 3J7A1 4NLYA 2RQMA 1VQ5N 3PJXA 2QE5A 4J2BA 2Z1GA 5KFQA 4AL5A 3EMTA 2YNIB 3MM8A 3IFRA 1WOOA 3R8EA 2ASLA 2DGUA 2VWJA 2FSNA 2OD6A 2EG2A 1DHMA 4UW2A 1I3AA 3NOGA 1MMDA 4Y0WA 2HNDB 3V6DB 1CPZA 2WONB 1EO1A 4ZVGA 4W5QA 4EHTA 4BC9A 4F26A 1LWCB 4PKGA 3FEZA 3CCSS 1FFSB 1RAOA 4JI1F 2F9JA 4C3MA 2OPSB 3LDSA 2X7IA 3GBTA 2DCLA 1B9FA 3FC9A 3AVFA 5E3PA 2HRTA 2ACYA 2OLWA 4ECSA 1K73O 1N32F 3AARA 1BUPA 4F50A 1N34F 5E7OB 3FR0A 1JLEB 4LFAK 3EL2A 3H1VX 1B70B 5D8HB 1XHXA 4ZCLA 5AQYA 2B4UA 4C0OC 4RJVA 4CE9A 3SQ1A 4A8SA 3VWSA 3CE8A 2P51A 5CZ2A 4IFYA 2ZITA 4RBVA 3GB0A 3CFPA 3CCVN 4AILC 3W9IA 1TKZA 2ZJRL 3G2XA 2HG4A 4FP9A 3HSJA 2FJAB 1KC8O 2Q66A 1TKDA 4ZVQB 3LP1A 3OTOF 2AGPA 5I3QA 1U1NA 4WZMA 4LF8K 3VGUA 1EWQA 2GJIA 4CJVA 4DR5J 2D0AA 4RW7B 2DR5A 1KVJA 4ID8A 1U04A 1W9HA 1WC3A 2SXLA 3LH2S 4CIOA 3THPA 2E8AA 1EXQA 1VQYA 1WEXA 4ISGA 5DZ7A 1D3WA 1XNQJ 4FWMA 4ZTFA 4BG9A 3CD6S 3DKDA 1R8AA 3LGMA 3HL8A 5M1PA 3TAGA 2PD1A 2GHWA 4MT1A 1QAIA 2JEIA 4F4XA 3K5MA 3V9ZA 4JI0K 1YJNN 1HARA 3A8JA 4IJNA 1VHFA 4EZ6A 1TKXA 4CZKA 2Q6BA 3SQGB 2YWEA 3D67A 3L6QA 1RAJA 1FRHA 4DUYJ 1AYEA 4USMA 5DRKA 3TSQA 3O5BA 1NK9A 2HAFA 3NY0A 2UXCK 1UA0A 1S48A 2OPRB 2Z8QA 2P9SB 3NS5A 3T9ZA 3TJ9A 3NGSA 2PEHA 4M94A 4TYBA 4DUYF 3CPEA 3I9ZA 5AQOA 5IC4B 2VA2A 4ZVEA 5DDQC 1NJWA 1ZPWX 4JKBA 1N6QA 3T1HF 4IR9A 1FWKA 5KFPA 4UOCA 4Z4HA 4QYRA 2GAGC 1TYQB 2IM2A 1ZC6A 1HA1A 2K1RA 1YKWA 5K14B 2B9YA 2HLUA 4NLDA 1LK5A 4DV2J 3NS6A 1FCAA 3KK3A 3CDBA 2W4CA 4YHHF 1PBAA 3VERA 1KNZA 4PQUA 2F4FA 2ZDPA 1HBNB 3L4IA 3ZSZA 1XMQJ 1E3MA 5I3UA 1Q1KA 3A3PB 1RGIA 3KJQB 1VGYA 3OTOK 4YR3A 1FRJA 4RW9A 4OYPA 5E33A 3NCQA 3HZEA 3CVKA 1C0UB 1T11A 3BDEA 5EX0A 4DJBA 2DY9A 2R8JA 1WSIA 2B8QA 4ES2A 4C11A 3SV3A 1Q8IA 4W5OA 2XZWA 2BJ9A 3OYEA 2CWKA 2L9DA 2HVDA 2U2FA 1RGVA 3DJCA 3VEYA 1EP4A 1UTAA 3KYLA 3WBZA 3GR0A 4CP5A 5F9LA 4F04B 3M3ZA 4B3MJ 4KHQA 1KVIA 2KVIA 1VISA 3F9MA 1S76D 2UU9K 4EP4A 2FBXA 1AROP 4BQZA 2AD9A 2XMJA 4DR2F 3R7SB 3A0IX 2WFBA 2QWLA 4U7UD 1GLCG 1RDAA 8RUCA 4LIRA 3JYTA 4E1MA 4ID5B 4I2QB 3CMEN