4PRFA

A second look at the hdv ribozyme structure and dynamics.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
95
structure length
95
Chain Sequence
b'PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatitis Delta virus ribozyme
publication title New tools provide a second look at HDV ribozyme structure, dynamics and cleavage.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 24
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4prfA00
5IQQA 2X1AA 2CJKA 2EVZA 1WI8A 2CPJA 2DNYA 2MZJA 1QVGR 1OO0B 1JJ2R 1FJCA 2VOPA 2K8GA 3CCQS 1VQLS 1WG4A 2DGVA 2L08A 2LA4A 3MOJB 1YITS 3UD4P 2FC9A 2MKSA 3CMAS 5GAEU 2M7SA 1R8HA 3BO4A 3CCVS 3MI7X 1Q81T 1U6BA 5IFMA 3CXCR 3SMZA 3U1MA 1K9MT 4ZKAA 3P5TL 4PRFA 5DDOC 1WI6A 4F02A 1URNA 2ADBA 3PIPQ 1VQ7S 2HYIB 1BY9A 2DNMA 1U2FA 3V4MA 3NMRA 4IO9Q 2J0SD 3MUMP 2M4MA 3R1HA 1VBYA 1G2EA 1KOOA 1U1PA 1NJIT 4CIOA 1VBXA 4IOAQ 4YB1P 2N3LA 3DXBA 2MKHA 1UP1A 3MD3A 2AD9A 5FJ4A 2CPXA 2JVRA 2WBRA 3G8TA 2RU3A 5CYJA 2M2BA 2G1DA 3FEYB 2DNNA 1YHQS 3L3CA 4WFBQ 1X4HA 2KXFA 4TU8A 1XN9A 2UP1A 2D9PA 3CF5Q 2G0CA 2DGSA 2X1GA 2KM8C 2XS7A 3MUTP 1WF0A 3UD3P 3RW6A 3CCUS 5JVHQ 2DNGA 5LSLA 3CCRS 2KVIA 3VAGA 1N8RT 3UCUP 1YIJS 3J7ZT 1ZH5A 1YTYA 4TU7A 2MKKA 2CQBA 2D9OA 1SJ4P 3TO8A 1U1LA 3MURP 3CTRA 1VC5A 2KHCA 2XB2D 1HD1A 5HO4A 2FHOB 1SJ3P 1R8PA 3H2VE 3H2UB 1Q86T 5EN1A 2U1AA 4LIRA 2M70A 1DBDA 2M8HA 2K3KA 2ADCA 1H2UX 2MQOA 2RQCA 1VBZA 2MSTA 4WF9Q 1FXLA 2KXNB 5CXTA 2DNOA 3FEXB 1RKJA 1WHWA 4M5DB 3SDEA 1U1OA 2LQ5A 1KC8T 4CH0S 2DO0A 2KM8B 2E5JA 2L41A 5JVGQ 3NNAA 4Z2XA 4FXVA 2VONA 3EGNA 1VQOS 1L3KA 1SJFA 3B4DA 2DNQA 3LPYA 1QM9A 2I38A 3UWTA 2M52A 3NS6A 3VAHA 4UQTA 2LCWA 3EX7B 2AYBA 1N88A 2EK6A 2LXUA 4RU2A 2V94A 2FPHX 2BZ2A 2DGXA 3HHNB 3VAMA 4IOCQ 4LMZA 3US5A 1X4BA 4C7QA 2RS8A 1WTBA 3CC2S 2LECA 4PR6A 2CPYA 3G6ES 4BS2A 1WEXA 2MJUA 2F3JA 4UY8T 2YWKA 2N3OA 2YH0A 2MGZB 2LMIA 2MQMA 2MGZA 1Q82T 3UCGA 1M5OC 4YOEA 2MSSA 2VOOA 3NNCA 2RVJA 4U67Q 2RUGA 1VQ6S 2KG0A 4Y00A 3MDFA 5GADU 1IQTA 1M1KT 1D9AA 2HZCA 5D78A 1D8ZA 3S8SA 2M88A 5LXYA 2A3JA 5GMKa 1PGZA 4ERDA 2QFJA 2MHNA 1M5VC 2LA6A 1KOHA 3VAKA 1QVFR 4CQ1A 1FT8A 3BS9A 4ED5A 2OSQA 2DNRA 1DZ5A 4WFAQ 2MKIA 5LXRA 2XS2A 1JMTA 2D3OR 2F9DA 2CPZA 2ERRA 1H2VZ 2VODA 1NU4A 3Q2TC 4YUDA 1UFWA 2J76E 2MZTA 2DNPA 1OPIA 2DGWA 3G4SS 1FHTA 2DH8A 2MZSA 2Q79A 1WELA 1N54B 3VAFA 2OTLS 2HGLA 2DHAA 1WG5A 5LJ5Y 2DGOA 2NZ4A 2RT3A 1P1TA 4F26A 5LSOA 1YI2S 1NO8A 2XSFA 1WHYA 1VQPS 4QU7A 3CD6S 3I56S 3D2WA 1M5KC 2G4BA 3CCLS 1SJQA 1U1QA 3SXLA 1S79A 2OJ3A 1P27B 2GHPA 3N9UC 1KD1T 2MB0B 2LXIA 1H2TZ 2M9KA 1X4EA 1K8AT 1RK8A 4C4WA 2RS2A 4EGLA 3OW2R 1ZZNA 2DGUA 5DDPC 2ZJRQ 2CPIA 2RNEA 1M90T 1AUDA 1FJEB 2CQ3A 3IRWP 1VQMS 2DB1A 2CQ4A 1X5OA 3G9CA 3U1LA 1OWXA 1VC6A 2DNHA 3UE2A 5GAGU 2YKAA 3I55S 3VALA 2OIHA 2NLWA 2B0GA 1PO6A 2HVZA 1JJHA 3S7RA 1X4DA 2DK2A 3CPWR 1M5PC 2XS5A 2BOPA 2JX2A 3CCJS 1HD0A 1X5SA 2LEAA 3SDEB 2JWNA 2CQDA 3CC4S 1UW4A 2X1FA 1U1KA 5DDQC 4WIIA 2LKZA 3MXHP 2KFYA 2DHSA 2JRSA 3MUVP 1X4GA 3ULHA 2YTCA 2RQ4A 5H1SV 4TLQA 1X4FA 4C0OC 2LYVA 2X1BA 4F25A 2DIUA 1YWXA 2EK1A 2KYXA 1X0FA 4W90B 1Q7YT 4FXWA 1FO1A 4WFNQ 5LJ3Y 2MZ1A 4WKRA 2KN4A 2KI2A 4QU6A 3RW7A 1DHMA 4J5OA 4W92B 3JB9k 2DO4A 3J7YU 3CC7S 3K0JA 2DNKA 1A9NB 2CPFA 2MMYA 5BJRA 2AYMA 4PKDB 2PE8A 3BEGB 1S72S 2SXLA 2KXHA 3G96A 5ITHA 2RRAA 2HGMA 2DIVA 2CQIA 1OIAA 2N82B 2KRBA 3NS5A 3P49B 1VQ4S 4WCEQ 1KQSR 3CMES 1YJNS 2GO9A 3THTA 2DHXA 2DH9A 3TYTA 2MY7A 2XNRA 2L9WA 2N7CA 2E5GA 2QEXS 1ZZFA 5DM7Q 1U1MA 1WG1A 3BO2A 2MQQA 2CQGA 3TP2A 1U6FA 1VQ5S 3R27A 1H6KX 2DHGA 2MKJA 1VQKS 5CA5A 2I2YA 1WF2A 2M8DB 3IWNC 3THPA 1WWHA 1B7FA 4OZ0A 2CPDA 2MZRA 5HL7Q 3P6YC 2DISA 5GAHU 2MQNA 1VC0A 5D77A 1N52B 3P3DA 5GVQA 3R1LA 3PIOQ 2MJNA 2E44A 2U2FA 2F9JA 2E5HA 2OSRA 4Y0FA 1SXLA 1W2BR 2DGQA 3ZZYA 2KG1A 2DITA 3UCZP 2J8AA 1WEYA 3MD1A 2MY8A 2PEHA 3VAIA 3LQVA 3VAJA 1X4CA 1SJRA 2LEBA 2CQHA 1FJ7A 4LJMA 2OTJS 2MKCA 1F9FA 2MQLA 2E5IA 4QQBA 3CUNA 2CQ2A 3CCMS 2J0QD 2YH1A 1A7GE 2AYEA 3ZZZA 2DNZA 2CQ0A 1JJ4A 1X5PA 2JVOA 2KT5A 2ZJPQ 2CQCA 2ZJQQ 4P6QA 4CH1A 4OZ1A 2XNQA 2O3DA 3Q2SC 2MPUA 2KRRA 4A8XA 1WHVA 5MLCV 2AYGA 3NNHA 1O0PA 2MZQA 3S6EA 2FY1A 1X4AA 3EGZA 5DETA 1FNXH 2HGNA 3HI9A 1HA1A 4IUFA 3DLLQ 2DH7A 1UAWA 1X5TA 1U1RA 2KU7A 2CQ1A 3S01A 3CCES 3CCSS 1DRZA 2FC8A 2M0GB 4QPTA 1WHXA 1K73T 1U1NA 5IM0B 3CULA 5IM0A 2DNLA 3G8SA 2CQPA 2RRBA 1VQ9S 1WEZA 2MXYA 3BO3A 2MYFA 1HL6A 4V19X 2CPHA 1WF1A 2QA4S 2MQPA 2KH9A 1VQNS 2DGTA 3VF0B 1YJWS 1VQ8S 1CVJA 4TU9A 3G71S 5DM6Q 5DDRC 1YJ9S 2CPEA 3B4MA
chains in the Genus database with same CATH superfamily
2YNHB 4FN5A 1QVGR 4LBPA 3MMCA 4E8UA 4J9MA 4QWDA 3N6LA 2QMWA 3MOJB 2NPFA 2OMLA 2UXCJ 3QNWB 4C3MA 4OI1A 5L1KA 2OPQB 3HVTA 5ETPA 3TJ9A 4G3IA 3V81A 3DI6B 3DLKB 3D1OA 4NMLA 1WI6A 3T1HF 3BPSP 3PIPQ 2HYIB 3UDEA 1IR2A 5GMDA 3NMRA 2UUCJ 4OHYA 1L3TA 4FYWB 3I96A 5T14A 3MD3A 2AD9A 5C5JA 2EXUA 2AEMA 2ROPA 2E1CA 2UP1A 4OIXA 1SI9A 3QJPA 2Z57B 2BYCA 2J5AA 1RHUB 3UCUP 1YIJS 1LK7A 3J7ZT 5DJBA 3QGIA 5IT9Y 4F36A 3G6YA 1HD1A 2KZZA 5HO4A 4J37A 4Y6IA 3R7BB 1UW9A 3H2VE 2DR9A 1KQKA 1NK4A 1KVJA 1S1TA 2MEWA 1RAOA 1QSLA 2YWHA 3UI3A 5DGAA 4LSNB 1P6TA 2LQ5A 2MLXA 2FB0A 2RF2B 3EMTA 3MGJA 4XPCA 3Q0AA 1Q79A 3QAEA 1Y11A 4TN2A 1N88A 2RJZA 2W9BB 2B4UA 2V63A 3G86A 3US5A 4P2MA 2RS8A 1S76D 1JJCB 3ENVA 3MPWA 1C4AA 5AE3A 2YH0A 4DLGA 2LMIA 3K5PA 4Z37A 1JNZB 3ENQA 3EUNA 3CIMA 4RNFA 3CWJA 1D8ZA 5E2QA 4JI0F 2A3JA 5ETNA 3HMJG 2QA2A 2W7OA 1DZ5A 3T1AA 2ZH2A 1LWFA 1MU2A 1WC5A 3OUYB 4RBTA 2HQCA 5K8MA 1UFWA 2J76E 1OPIA 3M30B 1BMQB 2XHWA 4WJBA 2DGOA 2JEFA 1RABB 4DR2F 1R0CB 1NSQA 1SC3B 4A4JA 1EP4A 4NA3A 2F8HA 5J2MA 3THVA 3BYRA 3T41A 4XIUA 4XO0A 4EO8A 2UVUA 4EUVA 5ETKA 3OJUA 2OFGX 2YKAA 1JWWA 5IC4B 1XERA 3FCWA 1S9FA 1WC3A 4B3SJ 3UN5A 3GONA 4KAIA 4UW2A 2V2ZA 3HZEA 3RB6A 1FESA 2DHSA 4N77A 4FYYB 4P71A 3W9HA 1I1GA 3H42A 3Q24A 3I0SA 2J6SA 4N7TA 4WXOA 2HQIA 4NLDA 4ID5A 1GXTA 1JLEA 4HH0A 4WKRA 1IJFB 4ZPDA 2JFKA 3CC7S 3POTA 1PIEA 3HT0A 1RT6B 4JI5F 3M8WA 4YB5A 4J91A 1APSA 5DQGA 1VQ4S 3HHLA 2AT1B 1KQSR 4CZCA 1YJNS 3M8ZA 1R6YA 2XG8A 4QZVB 1HR0J 4I6AA 5KFYA 2Q3PA 5JXSA 4Q2LA 2HURA 3BGRA 1PC5A 1HQEB 4OJHA 2J6UA 3KLGA 2H65B 3KDNA 4ZVPB 5GAHU 3UN3A 4DR3J 1MN9A 2NYHA 4LFBF 2DITA 2BBEA 4MYUA 4YB7A 3M8RA 3PX0A 3UDVA 3OSNA 5JMNA 3VWSA 4M5GA 2CQ2A 3MHYA 4N5SA 1RKIA 1ZTWA 2OPSA 2VA3A 2DBBA 1TL4A 2HNDA 1S7HA 2BJ1A 2KT5A 2MLZA 2GA7A 4ZDNA 4O3PA 3W8PA 2FVCA 4NLOA 4HTJA 1OJ4A 3GJSB 3S6EA 3D6MB 4RUCA 5AE1A 4DPTA 5FDLB 4M5KA 4NCGA 2HNZA 2ATCB 3HKZD 2M5YA 1VR6A 1BXNA 2A1BA 1JXVA 4QPTA 1VI7A 1U1NA 3OL8A 1NPRA 4WFXA 3KYLA 3BKFA 2QZ8A 1SKWA 4P7TA 4YS2A 2RDJA 2BANA 4IFYB 3GR1A 3AH6A 1N6QA 1Z2LA 3OR2A 4M8LA 1KSPA 4F3QA 3JAMU 1HMVA 2CJBA 2K7JA 4DR7F 5CH7B 2LP4A 2CJKA 4JP8A 3W60A 4M1KA 2YNHA 4C0HA 1FJCA 3JTPA 1RAAB 3ILOA 1S6UA 2XYGB 1CC7A 3CCVS 2KTQA 2OPQA 1U6BA 4HACA 4DF4A 3SMZA 3U1MA 3DI6A 3DLKA 3ZFVA 2OGUA 4ZCKA 4B9UA 3TZXA 4YB1P 2B4VA 3KJNB 2BVZA 4WKYA 3G8TA 4A8SA 2RU3A 1FRXA 3IS9B 2UXCF 1U0HA 3IN5A 1RHQB 2C2RA 1KHVA 4ES1A 3PJXA 1ZH5A 2CQBA 2D9OA 1SJ4P 3FSXA 3CTRA 4DR5J 4NXMF 3S1TA 1SJ3P 1Q86T 5EN1A 5D0HA 1FA0A 2VBWA 1C0UB 2F8EX 4YP3A 4WF9Q 2IM3A 1FVSA 3Q8UA 5D4PA 3EPGA 1IM6A 3FEXB 3NOGA 1U1OA 4OI6A 5A8WB 2RF2A 2R8JA 1L3KA 4NASA 2OKQA 4GO7X 4WPAA 2W9BA 2DGXA 3CJQA 1TUWA 1X4BA 3D66A 2F3JA 2JC1A 4ZS6A 1KDNA 4H54A 2CJAA 4DQSA 1N0UA 4DFJA 1Q82T 4IOBA 1M5OC 2RVJA 1FI4A 2NSCA 2HZCA 2M88A 5LXYA 5GMKa 5CD4H 3C6TA 2QFJA 2MHNA 1F9EB 3UN2A 3B8HA 1FT8A 4B17A 2CVEA 1FDAA 2WVEA 4KIAA 2D3OR 2CPZA 1H2VZ 1OY9A 3ZZ0A 4YDXA 1TMJA 3JTOA 2ALZA 1RSCA 2AEJA 3C8YA 3M30A 2DR5A 4YR3A 5GAHI 2UXBJ 1XMQF 2PA8D 4YQWA 1RU1A 1UZHA 5BYQA 3CCLS 4ZPWR 1TV6B 1FRHA 2BM1A 2EI5A 4C4WA 5LMNJ 3OW2R 4J9PA 2CQ3A 2LQJA 3OPKA 2XCAA 2OIHA 2NLWA 2HS3A 2WB1D 5KFVA 1WDTA 2ZH4A 2ZHOA 1Q4RA 3ULHA 2K1RA 5U47A 4W90B 3KJFB 1IR1A 3CB4A 4A8MP 5KG6A 2KN4A 4J5OA 3SCJE 4B3SF 2QT7A 3LA0A 1KRPA 3V6DB 5E3QA 2H48B 1S6PB 1RT6A 4ILMA 1VJWA 3DYAB 3RAXA 1S77D 4WCEQ 4AXJA 4HTIA 4DV7J 2VH7A 1YJTA 1R43A 4K2JA 2LQ9A 2AW0A 5M2PA 5HJYA 1NDCA 2ZH9A 3PYFA 2R7VA 4XDCA 5FLXU 5F0UA 2PMZD 1HQEA 1TTHB 4IH5A 1B4SA 1GMVA 1Y3JA 3CW2C 5HL7Q 2R8KA 3P3DA 5F9NA 3NAIA 3LP2B 4CH7A 1RTDB 5A0YB 4O0NA 5F8HA 1Q5VA 1JLFB 2KKHA 5KFQA 3ZNUA 2J0QD 4F0KA 4JV0A 5HMYA 3MTJA 3ZZZA 1YBUA 5EGYA 2CQ0A 3GV8B 3HJVA 4Y2MA 4RU9A 1RTIB 4QWEA 2E7WA 4KTQA 3KHHA 4YMEA 4DR3F 4DPUA 3WBZA 5FDLA 3Q8QB 1SH3A 3BM7A 4NPOA 3LW5C 1ROFA 1DTTB 2KU7A 2CQ1A 4PXCA 1U24A 1WHXA 3M9MB 2R2SA 3R5AA 2MXYA 5KG4A 2CPHA 4W4MA 1YJWS 3UR0A 3OHBA 2FZCB 1CVJA 5DM6Q 4OLPA 2FJVA 1JLQB 1O6XA 2VC0A 1JJ2R 3ENAA 3MCOA 1W7WA 4E2FB 4B9TA 2YXLA 4DF8A 3MR6A 1BQNB 2FC9A 2MKSA 3CJRA 3FJ2A 5HMZA 1S5ZA 2HZVA 3E2EA 2HK2A 2HLUA 2BKPA 2DR8A 1URNA 2OPRB 1RWUA 2ABYA 3AXMA 2CXEA 2J0SD 4PZVA 4C3LA 3PJWA 2V34A 1NJIT 2JL9A 2DR7A 4LF5J 3DXBA 2MKHA 2V2QA 4J9RA 3IWLA 2HHSA 5IT0A 3OXFA 4LF1A 4TU8A 1FK9B 4O4GB 1RAIB 2NPIA 3LAKA 2H54B 3UD3P 3NGUA 1VYAA 1PYTA 2WSFC 4MYTA 2W8LA 2F65A 4ELTA 4XAKA 4RW9A 3CJKB 2DTJA 4I7FB 4ZCLA 2B9YA 3H2UB 2FDNA 4M5LA 2B43A 4NA2A 2EC0A 2ADCA 2MQOA 2RQCA 5DLGA 1VBZA 1UWAA 5KFXA 1JLBB 1K0VA 3MOZA 3VGSA 4TKTA 2FJEB 3MMJA 3NGSA 4ECXA 8ATCB 5A8WA 2W4CA 2YQ0A 4M63A 3A8IA 3I9V9 2XWYA 3AOCA 3AA9A 2QN6B 3H4BA 2I38A 3EE3A 2IVFB 4MKYA 4LF2A 4PABA 4UQGA 3EJMA 3TAMB 4HHUA 1X7VA 2CPYA 4HT5A 4ZCIA 1RXOB 4K4YA 2JFDA 2CADA 1Q8KA 3ZZRA 4TNOA 2RUGA 1DQ8A 4QIEA 2POKA 4MKBA 4B02A 3EICA 1MMDA 2QMXA 1R7IA 5T7LB 3UNYA 4C9DA 2BUNA 1D0EA 3BR9A 1N5YB 4BC7A 2PIIA 5I3QA 2ERRA 4FNIA 1FHTA 4EZ6A 5C24B 4C2MA 2XMWA 2J7UA 4F8RA 4WFYA 4DPOA 1P1TA 3VQTA 3TZWA 3AD8C 2HBYB 1NO8A 3Q8PB 2G4BA 3VCDA 1TV6A 3QRPA 4LRBA 1KD1T 2NXEA 4AD6A 4Y2IA 2DGUA 4DEZA 4AXIA 5JJBA 1QAYA 1RTHB 5GAGU 2J8SA 2BDPA 3CPWR 1U8WA 3SDEB 5KFDA 4LRCA 3KK1B 3RYLA 4WIIA 1HLWA 1T9YA 3PNIA 2JRSA 1G7CB 3QRQA 3SFGA 2Y8YA 1URRA 1X4FA 5EWGA 4ED2A 1LWEB 1X0FA 1FDNA 1L3SA 5LMNF 1FO1A 4QU6A 4TQSA 3T1YJ 1WORA 4NLWA 3J7YU 1U2RA 2I5JB 1MW7A 3B78A 1PBAA 1S6PA 2EKYA 1HWJA 1R0AB 3DYAA 3QRRA 3MPUB 4KGKA 3I9ZA 2QEXS 1GAOA 3W3SA 3MTKA 1MROB 3EZUA 5D0EA 2HWTA 2W2QP 4ELVA 1NZ8A 4FBUA 1B7FA 4L73A 4IQMA 1N5VA 3HSZA 2YX1A 1HWLA 2CPDA 2DISA 3IBWA 2NSBA 2V8DA 1UEUA 2VJVA 2U2FA 2AJ1A 1WD6A 1X9SA 2OSRA 3JSBA 3LP2A 1CBKA 4ZP9A 2HHHJ 1VOMA 2B3TB 5E3CA 2EFOA 5DS7A 1RTDA 5A0YA 4DV7F 2Q6BA 4RWWA 1Y7PA 1T05B 2JEJA 1F9FA 3CUNA 3QSYB 5F0WA 3DLBA 5C42B 3PHTA 4WWSA 4DMZA 4ZCMA 1RTIA 4FYDA 1YBAA 3TOQA 2QLWA 2XMTA 1LWCB 4ZLNA 4P75A 2LXFA 4NXNJ 4OZ3A 3FKBA 5J2QB 1VK8A 1DTTA 1NSAA 3K5NA 3PRDA 2YNIA 2M0GB 1NNDA 2BJ3A 4S0MA 2AIRB 5KG0A 5ETTA 4CNZA 5KOXA 2EPIA 3IP0A 2ZDOA 1F6TA 3D3BJ 3A3OB 3E3XA 3MEEB 4TU9A 3GYGA 2WVCA 1JLQA 3CDEA 3EGVA 2OEKA 3GYXB 3RB0A 1YITS 1BQNA 4K4WA 2UU9J 3AXKA 1CG2A 4LRAA 4A8QA 3DDKA 1TAUA 4PCQA 5IFMA 3NCQA 1S6OA 2P5VA 3ZTPA 5L9NA 2OPRA 4IO9Q 2DKOB 3A4TA 2JZ5A 3B82A 1ZETA 4IOAQ 4ZPCA 5A2QY 3FGVA 1F5AA 1M1GA 4LR8A 1SJ1A 3PM9A 2E5LJ 4C48A 4YHHJ 2FHJA 3GPAA 3UPFA 4JYAF 2D9PA 1FK9A 4O4GA 2KM8C 3UNGC 1XNRJ 3RW6A 3CCUS 1ZBTA 3SCIE 3HLUA 1YTYA 5IT4A 3IG1B 3LWLA 1T11A 4LVNP 3CJKA 2ZITA 1FKOB 1SUQB 5J1PA 3F73A 1F60B 2AJQA 1LW0B 1H2UX 1B0TA 1I3OB 3V2UC 2CNNB 2JH3A 4C11B 2KXNB 2IRYA 5CXTA 1V6HA 1ZOTA 1TELA 1IKVA 5KFHA 3A1YG 2Z30B 3UFCX 1NB2A 4OX7A 4DV5J 2CZ9A 1SKSA 4C3KA 1QJHA 4UQTA 2LCWA 2FLLA 2EK6A 4OX9F 2FPHX 3ILJA 3L4BC 2JOQA 4ATNA 4LFAJ 2ZBPA 3E8OA 1T9WA 2UXDJ 3G87A 2ZBQA 2FTRA 2PEBA 1Y5IB 2YWKA 5EX3A 1XBWA 4YOEA 3Q89A 5HP1B 4N56A 1D9AA 3ADAC 4DSIA 4URQU 2I6WA 3MPDA 5T7LA 4YR2A 3BF4A 2FD2A 3GR0A 4WZMA 1N5YA 2AP6A 1UEVA 2AU0A 2OSQA 2LFVA 3W5YA 4U8YA 3KUEA 1U6ZA 3FQLA 4JI4F 2AKWB 2ZZMA 1YJ7A 5M2RA 2C1EB 5H9EK 3OR1B 2DXDA 1SC4B 3T9ZA 2KJWA 5C24A 1KWMA 2HGLA 3H40A 3D67A 2RD5C 4PAAA 2NYIA 1IUJA 3EYZA 4K4ZA 4FBTA 4FP9A 1GMWA 2CNKB 4H4OB 3M2RB 1VQMS 3HX9A 1EETB 5FD1A 4ZVRB 3H20A 2FVQA 3QLHA 3WX4A 2JX2A 3CJ5A 3KUGA 3QYYA 4KKOB 3NGRA 4B3OB 3R9LA 2EWHA 3K5OA 1UZDA 4TLQA 2RRNA 4UZBA 5LJ3Y 4CYUB 1VIXA 2HVEA 3I31A 3L95X 3JB9k 1PKUA 2I5JA 3TAQA 2AYMA 5ETRA 2PE8A 4HR2A 4EFAC 2EW9A 2SXLA 5EX0A 2RRAA 2DIVA 3DRPB 1R0AA 1MMNA 3VGVA 2PI4A 2HWHA 5T41A 1LEOA 1MROA 4ZLJA 1YZ7A 3EVWA 1YQHA 3T1YF 2RH3A 4IDKA 5I3UB 5GVQA 3M2VA 2RQKA 1OYEA 3UCZP 2PN6A 4QPXA 4CO4A 2WCXA 2AV5A 1W25A 1WSRA 2RSQA 3GG1A 5C42A 2ZHAA 2ZFHA 3DHXA 4P6QA 3RR7A 1WHVA 1RBOB 2E7XA 2AYGA 2EBGA 2GVDB 1RCXB 2LVWA 1U7LA 2YKPA 1LWCA 5DETA 2XMJA 1U26A 3IM8A 4O23A 4DQRA 5J2QA 1MLAA 1D1UA 1DRZA 5D0GA 1K73T 2EEYA 2R42A 2ILZA 1VISA 1SL1A 2J9CA 1NHUA 2Y8WA 4Q44A 1D09B 4NZ6A 5IQ6A 6FD1A 3BJYA 3EVOA 1KR4A 1S4FA 2P9EA 2WRMA 1FF2A 1HWIA 2ASYA 5A6WA 2MZJA 4NXNF 1VQLS 4PUOB 3BR8A 3NWRA 5AXKA 3DRSB 3ZC4A 4AL5A 2QA4G 1TK8A 3C6UA 1OMSA 3NGDA 2FJBB 4ZKAA 2W2PP 5L1LA 1U2FA 1XTZA 2H4YB 2XY7A 1VBYA 1NKCA 1BWEA 3IWXA 2QA1A 3MMAA 4CIOA 9RUBA 5F3TA 4F4KA 4DU7A 2FJWA 3I32A 4RBUA 2HFNA 3W64A 3SBMA 4JI8J 3QT8A 2W1BA 4ELUA 1WF0A 5J1EB 2WHOA 2DNGA 2VUGA 3C14A 4DUYJ 1RT7B 2GMJA 4M95A 3IG1A 2XB2D 2HPUA 3ZTRA 5K8PA 1WKKA 4AT1B 4QCLA 2DPIA 1SUQA 3T6JA 4DL0C 3CVKA 2K3KA 1LW0A 2XYPB 2E5LF 4K5SA 4YHHF 1QSSA 4DOZA 4LVOP 3K8VA 3NBPB 3OL9A 4Y65A 1B64A 1XNRF 2KM8B 4JI1F 2ZZTA 1DURA 4LR9A 4CO2A 2B7CB 2XZTB 3PZPA 1BQXA 5DG9A 2AYBA 2LXUA 2CDRB 3VAMA 4B3TJ 1S12A 1UCNA 2LECA 4ZP8A 2UUAJ 1WEXA 3LOUA 5KT5A 1O5JA 4KV8B 3UDCA 3G82B 3IO1A 3UQSA 1VQ6S 3DMJB 1IQTA 2O5DA 5D78A 1EX8A 1UEKA 3M7VA 1CULB 2HMIB 1PBUA 1U48A 4DV5F 1N32F 4UUXA 4AFFA 1HKAA 2HFZA 2BEFA 1NZAA 3A3PB 2CA9A 3GE9A 1VLYA 3GP9A 4WYWA 4LFAF 3R2DJ 3FC9A 4DL4A 2UXDF 1JX4A 2FIUA 3OR1A 2H5JB 3LH2S 2Z58B 3FBFA 3OSPA 2XY5A 5CZVA 3W2VB 4AL6A 4JV2A 4LF9J 1HBNB 2Z2ZA 3BZQA 1R6VA 1GEHA 5B0DA 1H2TZ 1X4EA 3T5LA 1AZSB 5F8NA 2UVRA 2ZBCA 2YBVA 2CPIA 4H4OA 1IM4A 2V8GA 3M2RA 1EETA 3QSIA 2UV8A 4DV1J 2MQ8A 1K1QA 4WK3A 1PC4A 5IT9U 3IA0A 1Q8IA 3NMAA 3MXHP 1IBKJ 4LRDA 4JI7J 2BJEA 2C22A 2VL1A 1N5QA 1XR6A 1HNXJ 2DJWA 4NLQA 4CYUA 2FJDB 3BGUA 4AQYJ 2HGMA 1N56A 2OH2A 3DRPA 3DNCA 1DQ9A 5LSRA 3TYTA 4CM0A 9ATCB 2N7CA 3BSOA 4YFUA 2DR6A 3W5XA 3J80U 1MWZA 3R27A 2MKJA 2IC3B 4OX6A 3QT5A 4OZ0A 1HI0P 1UL3A 2BR0A 2UUWA 3ILLA 4USVA 2RE1A 3ZTSA 5I3UA 3J7A1 1JK9B 3QBCA 4Y34A 1GH8A 2F9JA 2E5HA 2XO7A 2HEKA 2G1HA 2QX0A 4CO1A 1D9FA 3WIVA 1U25A 3FNNA 4OZNA 3J81Y 4DV3F 4J9QA 4LBIA 2MQLA 3CCMS 3MAHA 1A7GE 2AYEA 4DL2A 3VHQA 4OYOA 1PYOB 1S9EB 1SVDA 5HQ8A 2FZKB 1YK9A 2ZJQQ 4OZ1A 4Q0BA 3TEGA 2MPUA 4CLSA 4DQPA 4ZMMA 2GVDA 1KN6A 2Y9HA 3CD5A 3M32B 2ZKTA 4KFBB 2V5HG 4G1PA 3NL0A 3TVZA 1RTZA 2DH7A 1I94J 2BW7A 3HFZB 3MEDB 2PC6A 3G6VA 1XWLA 2CQPA 4UTGA 3ZTQA 4L76A 2EG2A 4OJ1A 4V19J 1YSJA 2L48A 2ZH7A 3NP5A 4JI6F 2HHQA 3NGTA 1KFDA 5I42B 2VOPA 3CDBA 1NJYA 4DR6J 4PUOA 5BYSA 2KL8A 4CLPA 3DRSA 4C8OA 2E29A 1Q81T 3PYGA 4PG8A 2WOMB 1HI1A 3W5ZA 1RAHB 1FCAA 2APOA 1GXUA 1K9MT 3HSDA 1S97A 4PRFA 1WKJA 5F41A 2HFUA 3QZ8A 2DCUB 2HNYB 4ZVHA 3V4MA 1FKPB 2W25A 3NWGA 3H90A 2V2VA 1BWVA 4FF2A 2GW8A 2XC9A 2B4OA 2G2OA 4F3OA 5BYRA 5HK4A 1TAQA 3QWPA 1UMJA 3SFUA 1NK9A 1RHMB 4WZQA 4L3KA 5J1EA 2Y1JA 3MR2A 3DLHA 5LSLA 2FLPA 4DPXA 5D6GA 4TU7A 1RTJA 1UVLA 3BREA 1RT7A 1EB0A 2B56A 1YZ6A 3RR8A 3K58A 1TUVA 2HBRB 2M8HA 2KO1A 2KFNA 5DGBA 3C3LA 3ETOA 3SCKE 4M5DB 4JI8F 3NBPA 1Y5LB 3K57A 5H9FJ 2B5JB 1T9TA 1ZM9A 2Y3YA 4PQAA 1UPPA 3D6HB 2DNQA 1QTMA 5HMWA 4DUYF 1GQEA 1S0NA 5I4MA 4A8FA 2OEJA 2V94A 3TJ8A 4Q8FA 5A8KA 3GSIA 4LMZA 1JNRB 2OD6A 3BV8A 5IS2A 4E98A 4DWIA 4KV8A 2IYIA 2MGZB 3G82A 1CPZA 1CJUB 2MSSA 3OLAA 3DMJA 1HBUB 4X62J 2R7XA 3GFZA 4F4ZA 4ZN1A 4OHZA 4JOUA 1CULA 3C46A 1J5OB 5L1JA 2HMIA 2IA0A 2IFXA 4U7UD 4UOCA 3VV2B 4ED0A 2MKIA 2B51A 1Q7LB 2F9DA 2VODA 4K5RA 3KLIB 4B3TF 1OPZA 3HO1A 1PSDA 2MZSA 1N54B 3MR3A 5K8OA 4ECTA 5CYQB 4NCAA 2PFDA 3W2VA 4B3MF 1HBNA 1HHQA 2KDOA 1U1QA 1UFKA 2IPOB 1RAEB 1QAJA 1X9MA 2M9KA 5DG8A 2ZOMA 1AZSA 2IIHA 1A6LA 1UPMB 3IRWP 1J27A 4X4OA 2A6OA 1T0TV 3G9CA 2HQ3A 3HT3A 1N0VC 2ZH3A 3RBZA 3I82A 3CCJS 3TWZA 2WW4A 4LF9F 2XGQA 2GVZB 4Y2AA 1ZYQA 4I0WA 3QWUA 4DG1B 2X1BA 3EZ5A 1YWXA 5KG1A 3GLJA 3R5CA 4DI6A 1LXNA 4DV1F 2BQUA 2EFGA 2HIYA 3G6XA 3LGHA 2I9SA 3TX0A 4EMDA 1S0VA 1IBKF 1YVFA 3OV7A 2NCKL 1ZZFA 4JI7F 1TZ0A 2Y0SD 1VQ5S 1HNXF 1M0SA 3GMGA 3THPA 2IC3A 2R8HA 2HRUA 4CO0A 2ZH1A 2B8QA 2IM2A 4ZIVA 4ED8A 7FDRA 2VG7B 3BN7A 3BPDA 1VC0A 1KS2A 5KFWA 4AQYF 2RHSB 4KPYA 4CNYA 2MJNA 1GX5A 4DCJB 1AFIA 1WC1A 2KG1A 5HLFB 2DXEA 2OUGA 1FRMA 1V3SA 1HNIB 4DV2F 3FBBA 1E6YB 2PD1A 1AA1B 4DR1J 4JBCA 1RT2A 1AUSL 1NUEA 1RAFB 4LQ9A 3Q8YA 2VPWB 1S9EA 3R2CJ 1PG5B 1U45A 4C97A 2DRAA 2NXNA 1O0PA 2OELA 4DFMA 1Y3KA 2VBXA 3G8QA 1KHWA 4KFBA 3JAMY 2E9TA 5KFAA 3LTOA 2OEMA 1XQIA 2ZUGA 2HFOA 1TK0A 1YBTA 3S01A 4B9LA 3MEDA 1UWBB 3JYTB 2VDIA 1V3ZA 1S1UB 2ZM6F 3FBCA 4V19X 1WF1A 2BE9B 2GV1A 1DAXA 3VZHA 2KH9A 1IWAA 3VF0B 5CABA 2VPXB 5B0AA 2GX8A 5I42A 2QSFA 4DUZJ 2C28A 4X4NA 2L08A 3W2WA 1I94F 3W9JA 5GAEI 1R8HA 3P45B 1HQ2A 2WOMA 2R2TA 5KFUA 1Y5NB 2RILA 5IV3A 3P5TL 5HVFA 3OD2A 2KFZA 3QGPA 3MM6B 3DOLB 3P5BP 2HNYA 4UY85 3RBEA 2RHQB 5D3GA 4I4BA 2H51B 2FVPA 4OHXA 4X65F 3GFYA 5G0RB 1S99A 4R8UB 3NXZA 5FJ4A 1H98A 3OTEA 4DR6F 1IN0A 4UOFA 1FDDA 1EHWA 1I5OB 1ZAXA 4OYWA 2XS7A 3DKDA 1U09A 4FVMA 4FF1A 3OL6A 4LREA 1SIWB 4XTTA 4ES3A 4PQUB 2KB2A 2WAQD 2DPJA 2J6TA 2MSTA 4ZLPA 4M5DA 2NXUA 3DM2B 5DG7A 1NH7A 2CWXA 3QZ7A 1B70B 4GKJJ 3D54A 3K7RA 4L6V3 4J9VA 3BQ0A 4IR1A 4P73A 2BJDA 1HWKA 3GIRA 2K06A 2BE2B 4IQXA 1NK8A 2YNGA 4C8ZA 3ZXWA 4Q8EA 3H7HB 4WU2A 2J0XA 3DN9A 2MQMA 2MGZA 1CJUA 2H3EB 1YDLA 2CYYA 5KFRA 3OTDA 5HVHA 1HBUA 1J5OA 1ICEB 2V69A 2CJ9A 2LA6A 2CJYB 3A3NB 5K14B 3BS9A 3AD9C 1RWXB 1H3DA 3KLIA 2CG8A 1YX2A 2DH8A 2GIQA 2AGPA 1NCLA 2RT3A 1IBLJ 3DU5A 1CJTB 1P1LA 3R5JB 2ZNZA 2KZMA 3N9UC 3KTQA 5KOWA 1N5SA 1CC8A 3HVWA 3VALA 4IG0A 1T3NA 2V4JB 5AXLA 1JJHA 2QFIA 4J90A 1KFSA 2PMHA 3KG0A 1UA0A 4OYMA 4DR7J 3GJTB 3IGVA 1EARA 2IVYA 4IFVA 4ZIWA 1HNWJ 2WBMA 2ZE2B 1X4GA 4FYXB 2C2OB 2IHR1 2GVZA 2C42A 1UTAA 4WTYA 4DG1A 2KYXA 4NA1A 3QJLA 2KI2A 3UO0A 1FD8A 2DO4A 1A0OB 2CPFA 4CLYA 4C0BA 5RUBA 4ZVSB 2ZBRA 5FLXY 3D6FB 2JEGA 4C8KA 5ITHA 1NH8A 3EVMA 2DH9A 2GQCA 4ZJQA 1U1MA 3AB2B 2MHEA 4O3OA 4PYDA 2GGPB 2Z8QA 3QIPB 4M5JA 2D3UA 3V5RA 1SH2A 2MZRA 4NXMJ 2P6TA 2MQNA 2VG7A 3AOBA 4I6YA 3W62A 3SYZA 1XNQF 2HLTA 4Y0FA 3Q23A 3OHAA 4DZ6A 1H7XA 3MD1A 1T3OA 1X4CA 1HNIA 2CQHA 1KLMB 1E6YA 2YNFB 3RU0A 2OTJS 4X4QA 5DQIA 4DU8A 3TNVA 2YKNB 3Q22A 3V4IA 2Z56B 1L3VA 1ULRA 2JVOA 4DR4J 4CH1A 2O3DA 2ZD1A 1VDHA 4G6VB 3NNHA 2B4PA 4DX8H 4PG6A 1HA1A 5KT7A 4CTAB 2XMVA 5CHCB 3JSMB 4ID8A 5B08A 1VLOA 3VVUA 4P2XA 1UKUA 1UWBA 2V50A 3JYTA 4DR1F 3TR5A 1RT1B 1S1UA 2ZVSA 1C1BB 1FRIA 4G1QB 3BO3A 3LWMA 2MQPA 2NREA 1IR0A 4ECYA 1IXKA 3CO9A 2JLFA 4ILRA 2V0NA 3K89A 2RU9A 3CCQS 4GO5X 1IQZA 1UVIA 5KFGA 4CLKA 2DGVA 3HCXA 5KT4A 4DS4A 1XMQJ 1HFEL 3M9NB 2HZAA 4P2FA 2FZGB 3CXCR 4UF4A 4O4RA 3HXMA 2OAUA 3IAS9 2JC0A 5BR8J 3MM6A 3DOLA 5JUMA 1VHIA 3QIDA 2QO3A 1NXIA 2BKNA 2V8HA 2XMMA 3K59A 4JI3J 4NLUA 2AZ3A 2XWXA 2OD4A 4R8UA 4DUZF 1AXQA 3A8EA 3BBCA 1Q16B 4X4UA 5SUHA 4UUWA 5L38A 4RZRA 3TUZC 4HEA9 4IRKA 4HH1A 4ZVOB 1NRKA 4EK2A 3FZ2A 4B9NA 3MURP 4ZPVR 3AOAA 4OYZA 1WKLA 3PFOA 4CDIA 3OJSA 3M6UA 2RUSA 1G4CA 1WHWA 1CS4A 4C98A 5L39A 3DOKB 4JV5J 3DM2A 1KC8T 2VC1A 1DJ0A 4O3SA 3NCRA 1QLNA 3GCWP 3DOMB 1GT8A 1QM9A 2WONB 1VHFA 3PYDA 3PACA 2VKRA 2YX7A 1S9GB 3PW2A 4GVLA 2OI2A 3FMWA 4MK8A 2QMUB 4F4AA 4GKJF 4DL5A 3BSCA 1GXLA 1K1SA 5K14A 2Y1IA 2CVIA 3I87A 3L9ZA 1NU4A 4IRDA 1ZPWX 4PWWA 3G4SS 1FWKA 3M2UB 4DV4J 3QATA 2OTLS 3RJMB 4ENOA 1ACMB 3M6XA 3L7UA 5DO2A 1EQ0A 1CJTA 1NKBA 2GAGC 3D2WA 3HHEA 2ZDPA 5A2QU 1S79A 2OJ3A 4KGMA 4KE5A 3HK2A 1K8AT 1HNVB 2LQ8A 3L09A 1VRUB 2RNEA 1FJEB 5ETLA 3LP0A 3N01A 1IKWB 4K4XA 2V4JA 5DLFA 3OFEA 5J1NA 1IBLF 4KQZA 2ZE2A 4ECUA 3KK2A 2YTCA 1I6JA 2WB4A 4A8KA 2EFNA 3TRGA 1N33J 3GJQB 4FXWA 3IR5B 2P6SA 4F3MA 3HFKA 2C2NA 5KFKA 3M9OB 1K44A 4YN3B 3G96A 2EG1A 2BA9A 4HDHA 1HNWF 3PCOB 3CDAA 3M1VB 4MT1A 5CYMB 1UJ4A 2QRRA 3LPEA 1U6FA 3ET6B 3HD2A 1WF2A 2GGPA 3DDNA 1Q53A 2HBQB 3QIPA 4QWBA 5HVGA 3CSKA 1OY6A 3MCMA 2H5IB 3ISND 2RKIB 1RHKB 5D77A 1BUXA 4N76A 4DFPA 1T9XA 1FXRA 4F0MA 2VICA 2HHUA 1TKZB 4RKUC 4BDPA 3VAJA 1SJRA 1ZAWA 3NCPA 3DLJA 1FJ7A 3GV7B 3FCVA 2AX1A 5ETMA 1VS3A 3AJ1A 2NXJA 3GU0A 2CDQA 2YKNA 3ELHA 2XMUA 1OY8A 1R3NA 5CCLA 3SCLE 2O01C 2ZOFA 1DTQB 2W9CB 5EWEA 4CTAA 4RW6B 1C2PA 4DX6A 4LSNA 1FKAF 3Q86A 2UVVA 2DXFA 2A10A 3DU6A 4G1QA 1IJEB 4DQIA 4QR1A 4DR4F 1WOPA 1TL5A 2BMBA 1WDDA 5AT1B 1QY7A 4F4WA 2DD8S 1ZM2A 2J7KA 3MEKA 1RT3B 3NGKA 4LUBA 4KH0B 1SKUB 2BV3A 4O0IA 4F02A 1KQGB 4I68A 1BY9A 1SB6A 2F4VJ 4PWDB 2M4MA 2A6MA 1T9VA 1G2EA 1KOOA 3OUYA 3TANA 3PX4A 2ZKUA 3BGOP 2D1CA 8RUCA 1F3FA 3VR1A 2VDHA 3P96A 3HKWA 3U7JA 3OXGA 3MUTP 3H5UA 5JVHQ 3HD1A 3QO9B 1CEZA 2Q6CA 5BR8F 4QBUA 1FNOA 3TAPA 4LIRA 4JI3F 3SSRA 3FSIA 4DQQA 4PXDA 2FLNA 4X2BA 2VV5A 1TL7B 4LSLB 1L5UA 2VFUA 3MECB 3DOKA 1RWMB 2IYGA 4NLXA 1RADB 4FXVA 2Y1LB 1VJQA 5KFJA 4ZPBA 1AW0A 1W26A 3DRYA 3DOMA 4DCPB 2R7SA 2R7WA 2UV8G 4WXWA 1KTQA 2A18A 2WONA 4RU2A 3RTVA 5AE2A 3LP1B 4CLTA 3MMCB 4BS2A 4L75A 4UY8T 5F8IA 2N3OA 3P8BB 4ZVUB 3GCXP 1JIHA 1F5CA 4UOGA 2DT9A 4Y00A 4JV5F 1PAEX 4QIFA 3S8SA 1SH0A 3AHPA 2R7OA 5HQMA 1RWNB 2RAQA 1M5VC 1QVFR 4CQ1A 2B7BB 2E9RX 4ED5A 2D69A 4NLRA 4ALZA 3R7NB 2OPPB 4QYZK 4H4KA 3GV5B 4JI2J 2W2NP 4WFZA 3BH6B 4R25A 2C3YA 5LJ5Y 2VHGA 1M5HA 4B9MA 4DFKA 2ZH6A 2FYXA 5KG5A 3ZZPA 1M5KC 1HNVA 1T7PA 4EGLA 2QYGA 1BLUA 3SI8A 1VRUA 2JLEA 3AAWB 3VGTA 2CQ4A 1X5OA 4FXDA 1IKWA 1RAJA 2JLGA 3P4UB 2IM0A 3KG4A 4ANCA 2DK2A 1QTNB 4X4TA 3VZIA 4DV4F 1U4BA 1U2CA 1FFGB 3WC0A 1U1KA 1EZZB 3CCWA 3EM1A 1LFWA 3F56A 3GIJA 1TR0A 2YKQA 1FVQA 2CAJA 3RG6A 4RNMA 4QW8A 4P72A 2R7QA 3O8WA 4IFYA 2MMYA 2WZ1A 2G2YA 3J81j 3RBDA 1HBMB 2K3IA 4ICLB 4RW4B 4Z7YA 4C8MA 4USJC 1IBCB 2XO6A 3CMES 3GIMA 3THTA 3SV3A 3M1VA 2HIQA 4JYAJ 5CYMA 4N41A 1PILA 1NLKL 1N33F 2JHEA 3A8KA 1LWFB 3ET6A 4OV6A 4Y2CA 2QTWA 1YJRA 4ITSA 3DGVA 2IDLA 4RW8B 1K47A 3D28A 3TQEA 2Y1RI 3TA0A 4F67A 3T9NA 1T03B 1SXLA 2DGQA 4RJVA 2LEPA 1TKZA 2PEHA 2WW8A 3ISZA 3IS9A 1Q1KA 2V9WA 2IM1A 3N5FA 4QQBA 2IAJB 3G2XA 2Q1LA 1TP7A 1FNMA 5KAKA 4ZITA 1CQMA 3AD7C 4LQ3A 4OX9J 4MFBB 2MZQA 1Y0HA 1DTQA 4F04B 3RB3A 4IUFA 2W9CA 3IC1A 3DLLQ 1C0UA 1S6QB 4RW6A 5HANA 1KP6A 3RBXA 4TYBA 1C0TB 4I69A 2KVQE 4ID5B 1R8AA 1JLEB 4OX8A 3G8SA 3QJJA 1P9YA 4LF7F 2GMLA 2R2RA 3LF0A 2BOAA 4DSFA 1LKZA 1O8BA 4NLVA 1DQAA 5DDRC 2G9OA 4OYPA 2CPEA 2IDEA 3CE8A 5HN0A 3TZYA 4JI4J 1IWGA 2N7YA 4DBQA 1NAQA 3OFGA 3HHDA 1RT3A 3RB4A 1NM2A 3OVSA 4HI1A 1R89A 3HULA 5HAOA 1H0HB 1X0PA 2XEXA 2CNOB 1VQ7S 4N8OA 3KLGB 4PWDA 3IGNA 3RUBL 1BQMB 3OTOF 3E01B 3NG8A 1FEHA 3GTYX 2JSXA 2WBRA 5IXUA 5CYJA 1NHVA 2G1DA 1R0BG 3X1LB 3L3CA 1IBMF 1XR5A 2OPSB 3QO9A 3PEHA 1SIZA 1PJ6A 2VBYA 4FKYA 2F4VF 2D7SA 3KMSA 3HPOA 4G65A 1HWUA 1IKYB 1FWLA 1WOSA 1S7IA 4PEOA 2U1AA 5H9FK 5BXIA 3TUIC 5B0BA 1TL1B 1FXLA 2E1RA 1NK6A 1TL7A 4LSLA 2VFRA 2KT2A 1RKJA 2IBKA 4A48A 3GG0A 4Z2XA 4XPEA 3CD0A 2BANB 2OP5A 4R5PB 2D3ZA 1SJFA 4KBIA 3RAMA 2W2MP 1AB8A 3R6LB 4C7QA 2KJVA 3LP1A 2ZH5A 1V9OA 2Z4PA 4WIQA 4EU0A 3SV4A 3PX6A 1KEKA 1V5VA 2E9ZA 3V6DA 2J7WA 4HACB 4EWTA 4OI4A 2CUYA 2HHWA 4ERDA 1JKHB 2C2EA 2R3VA 1XIQA 2BXJA 1NBEB 1R8CA 1PYSB 5DZ7A 2OPPA 4HHJA 5J2PB 3IRXB 3FSYA 3R3TA 1QUVA 1U0HB 1NMEB 4IO1A 2NZ4A 4F26A 3M6WA 1LFPA 2XLKA 1QDUB 1RE1B 5DZ6A 1WHYA 2NS1B 2GHVC 1HW8A 3D4JA 2XLIA 1JLAB 2GHPA 4ZN3A 1JLFA 1RK8A 3V6JA 4W98A 2EC2A 1M90T 2FHJD 3WC2A 2HWIA 3EXCX 4K59A 3MCSA 1RWPB 3R5BA 3I55S 4ZJLA 5D4OA 4XK8C 2RIJA 4CO5A 1QAIA 2BOPA 4JI2F 5E3AA 3T5KA 4Z7CA 2JWNA 4USIA 4HYKA 4EEYA 2NZCA 1TKTB 3FZBA 4X84A 4MKAA 3PY8A 1RT4B 1FDBA 2Y0BB 4NI2B 1MN7A 2XULA 4U7CA 2ATLA 4U8VA 2LYVA 4AL7A 2M3DA 5KT3A 2D41A 2DEIA 4MIBA 4ANDA 3KWMA 4PG4A 1PJ5A 3J80Y 2DNKA 1A9NB 5B0FA 2HSEB 1HBMA 5HBMB 1TQLA 4C8YA 4USKA 4U9RA 2Z2YB 4PWUA 4ICLA 4RW4A 4FYVB 3M6VA 2FJAB 2VFSA 2YY3A 3C6TB 1H73A 4V1Ak 2OMOA 1JB0C 1RZMA 4FZVA 2XNRA 1ZM3A 2L9WA 1J5EJ 4OYXA 4GC6A 3SIPB 4LR7A 2YKMB 2I2YA 2M8DB 4OJGA 2G2ZA 4LT6A 4ZK7M 3LALA 4RW8A 2ASDA 2VG6B 2CRLA 2E44A 1GTEA 5MAOA 5F8MA 3MAQA 2QG9B 2XSJB 2YX4A 1T03A 1RCOB 1WEYA 5K8NA 2WVBA 3LANA 3VAIA 4B3RJ 3OVBA 4J9SA 2PA3A 2HQDA 1SQGA 3FUYA 3JSYA 2GNKA 2IAJA 2HRYA 4AE5A 4JI1J 2G0IA 2ALYB 2FHKA 3W63A 1REGX 1RGVA 3I5BA 2LU2A 1FX2A 4I7FA 4MFBA 1GMWD 1GX6A 2K1RB 1S6QA 4KGVB 4GKKJ 3C15B 3UW1A 3CCES 2XHCA 1JLBA 2W2OP 1MSWD 1HIYA 2HKEA 1C0TA 3CULA 4LRFA 1YKWA 3VTIA 3TQ1A 1UVNA 2YWEA 3CDWA 1N32J 2CWKA 3CNQP 1TKXB 3PV8A 2X1AA 4ETXA 3KLEB 3RRHA 2K8GA 3TAMA 1RHRB 1WG4A 2L9DA 4EYHB 4RUHA 3DGPB 4HHHA 1PJ7A 4LBHA 2BABA 1EAYC 2F4FA 4RNHA 4A8YA 2LU1A 1GMUA 2ZC3A 2XZDB 3MUMP 2Z2LA 1CLFA 3BBBA 1BQMA 4ZA1A 4NCBA 1RI7A 3E01A 4NMXA 2JJ4D 2I0XA 3RZAA 2DNNA 3LGNA 1FD2A 1S59A 4RNNA 2YKOA 3CF5Q 2H5EA 3T6BA 5KFCA 1XK8A 4H4MB 1IVZA 5K9FA 3TVYA 3MAAB 1VK3A 2ZWOA 5C2CA 2MKKA 2GZOA 3GFXA 1VC5A 3J7AN 4U6PA 4NEYA 3QGHA 1IKYA 3H5SA 2WSEC 5B7WA 1RTHA 4HT7A 3M4XA 1TL1A 3AFGA 4YY3F 3ENWA 4FVCA 3MM7B 2RDDA 4IR9A 4ZP6A 3SDEA 2QLFB 1RBLA 3KK1A 4DSJA 3NNAA 1EQMA 4R5PA 2XQCA 2VD3A 1OQ3A 3UWTA 1LWEA 3W9IA 2PMWA 3U1NA 3HHNB 4DJBA 3G6ES 5ADZA 1HHSA 4J9NA 3UCGA 3NNCA 4U67Q 2EFQA 2HK3A 3MDFA 4P10A 4URGA 4C6AA 3FMBA 2GIRA 1JKHA 2GC8A 1S49A 4DV3J 3VAKA 2F5GA 2C3OA 5CQGA 5J2PA 2MZTA 5HATA 2DGWA 3IRXA 2VFVA 3VAFA 3FBEA 1WG5A 4HLBA 1S0MA 4USTA 4K7QA 3OTBA 4KH1B 4DL7A 2XSFA 2HRTA 2CFXA 1FFSB 1QE1B 2MDAA 4DUTA 3JQMA 1JXEA 1CJVB 1JLAA 2XBPA 3O3LA 2LXIA 4RW9B 1T05A 4HVZA 2PI5A 3PW4A 2UUCF 2ZJRQ 2DYAA 2BJ9A 1HBOB 3JQJA 4KSEB 1RP5A 1PO6A 3KLVA 3H8YA 2PSZA 5E3PA 2OHDA 1M5PC 2XS5A 4JI6J 3DRXA 4WP9A 2Q66A 1UW4A 1TKTA 4M5MA 1RT4A 4OZJA 1EKSA 3PEJA 1KONA 3IBCB 4NI2A 5D0RA 4C0OC 3C19A 3MCNA 5D15A 1YGYA 3GSDA 2GQ2A 4Y3CA 2HVDA 2GFFA 2HAIA 4ECVA 1VBKA 4JB8B 4U95A 4F4XA 5CCMA 5BJRA 2B8PA 1D9DA 1TUGB 3IBFB 3BEGB 3MEEA 4A46A 5HBMA 2BJ8A 2CQIA 3CEDA 1P9QC 1GNKA 3KG1A 1WG1A 4EYIB 2CQGA 3TP2A 3ITHB 5HI7A 2YKMA 2YWWA 2E1PA 5ETSA 2H4WB 1HI8A 4NOHA 4RPFA 3FCHA 2QL9B 3W61A 4J9UE 4GMKA 1CJKB 2VG6A 1WC4A 4USUA 2MTLA 2HW3A 4ZHRB 2XSJA 1R27B 5D4NA 3LQVA 5LOQA 5HMXA 3PDNA 2LEBA 4RLEA 2GJIA 3KJQB 4LJMA 4DV6J 1J5EF 2YH1A 1T8EA 1YRTA 1X5PA 3N6NA 4K2XA 5EHHA 3FRZA 3U27A 5AJ3J 3VQSA 4BBYA 1FTCA 4LF8J 1FKOA 1T02A 3EGZA 1LW2B 3HP6A 3M05A 5FIIA 4B3RF 1UAWA 4C11A 3FEZA 1U1RA 1VFJA 4RBVA 3C15A 1YRUA 1ZAVA 3PHEA 5A76A 3NY0A 1NDPA 2FGCA 1TFYA 2R7RA 4NLSA 1VQNS 1VQ8S 1E6VB 1TKXA 3KLFB 3B4MA 1D8YA 5IQQA 4ED6A 2DNYA 2OO4A 3KLEA 4O3QA 4O3NA 3LUYA 3CMAS 3NOCA 4GKKF 2M7SA 3TVKA 4MK7A 3DGPA 5HP1A 5SZTA 5M2UA 4B3MJ 5DDOC 4I1TA 3KLHB 1U1PA 2VG5B 1FTRA 2ZBIA 2XI3A 1FFWB 4CLUA 3AJDA 3CO0P 3DHWC 3FEYB 1YHQS 1DY3A 1HR0F 2G0CA 2MKYA 2ZH8A 4H4MA 3OBIA 4QYZJ 3SZ2A 3O6QA 3IR7B 2XLJA 3AB4B 1IKXB 3MAAA 3ICLA 1SL2A 4NYOA 3TO8A 1U1LA 3AQOA 1EKRA 2VIHA 2IMWP 1R8PA 4ZJOA 3GILA 1DBDA 1RWWB 4P9SA 6AT1B 2YNIB 3MM7A 5L8RC 3MEGB 4L3NA 4DLEA 4KKOA 4CH0S 4HL9A 2E5JA 5JVGQ 4B3OA 4YDDB 2ZOGA 3EGNA 4EI2A 2A2CA 1EIYB 5A8RB 2IRXA 3OTCA 3DRRB 1RWVB 4P74A 3KHGA 4ZVFA 1RBAA 3GFHA 2VKZG 1LOUA 4NRTA 1RA7A 4LFCJ 1WTBA 5EDWA 3PFEA 5L46A 5LT5A 3R6GB 4G1IA 5F8JA 2AF6A 3PR4A 3WZ0A 3LO3A 4OMFG 4DV2J 3LGMA 5LL6d 1HNZJ 3JXOA 5CD4A 5KFLA 4DX7A 4WFAQ 1R8BA 5IV4A 2J0WA 4CLLA 1BHNA 4PG5A 4DXLA 1WELA 2G13A 5KG3A 1RT5B 4KGZB 4K4UA 4ECWA 3PW5A 1TFWA 1SPBP 1FE0A 4OV1A 1QE1A 2HS0A 1FRKA 1CQNA 3OL7A 3SXLA 1CJVA 1FE4A 4ETZA 5I3PA 4ANEA 4J7CA 4PG7A 5DDPC 2HHTA 1HBOA 2ZM6J 1OWXA 3UE2A 1F2HA 3TX8A 1N34J 1J2VA 4MAKA 3HVAA 1RAGB 3M8QB 3CC4S 3F0NA 1IKVB 2BJ7A 1WC0A 4FF3A 3ONQA 1H74A 1KQFB 2D3O1 2KFYA 4K0KJ 3MUVP 4ECRA 4WTOB 1FWPA 2DIUA 2W7AA 4DR5F 2AEFA 1TKDA 2GO8A 4DDFA 1Q7YT 2QC3A 3QFHA 2C2MB 3RW7A 7FD1A 1JLGB 3K0JA 4RUBA 2UVWA 3UVJB 4KHPJ 4NX9A 3X3UA 3H25A 5EWFA 1WC6A 4X65J 2KXHA 2O66A 3KOAA 3KHLA 3U02A 1SV5B 1FX4A 3AQPA 2F63A 2R8GA 4P7VA 2BACA 4FNHA 2RMLA 4K4SA 2HFSA 3T5HA 5DM7Q 2LQBA 4EBEA 4DSEA 3ITHA 1H6KX 4U7UK 5CA5A 3D68A 2X3DA 1G3OA 3KKFA 3WIUA 2AJ0A 4NZ7A 4ER8A 1CJKA 1RJJA 2AMCB 1JXLA 3L7PA 4ZHRA 1W2BR 2PDAA 3K2YA 2OFHX 2IBOA 4KYZA 2O67A 6FDRA 2V8PA 2HHXA 2YVSA 1SCJB 4F4YA 2DNZA 4ED4A 4KRWA 3PRVA 1DARA 4DN9A 3QLHB 2XNQA 1F2GA 1QAXA 3HF5A 2VASA 4A8XA 1XEZA 2UXBF 3UDLA 2RB7A 1X4AA 3CMQA 1Y4ZB 5KFBA 1LW2A 2VA2A 2WK4A 3BKTA 4DSKA 3CCSS 2FC8A 2N4DA 4DV6F 5D4LA 1RUSA 1WOOA 5ETVA 2FJXA 3F44A 2W8KA 2CZVC 3D1QA 1S57A 2MYFA 4RX6A 2DGTA 1PCAA 5AJ3F 1E6VA 2LLZA 2F40A 4LF8F 2AX0A 3DLGB 3KLFA 2E1MC 4M94A 2WTFA 5IOLA 2LA4A 3UD4P 2HHPA 5GAEU 5HROB 1OS5A 4TVAB 2C2KB 1BD6A 2ZNYA 2VQEJ 2PO4A 2ADBA 3AA8A 4IDKB 4RR5A 3KLHA 3R1HA 3I6PA 3M2VB 1Q95G 5F3ZA 2VG5A 3MZIA 5DQHA 2N3LA 4M5NA 2GJFA 1KTVA 2OLWA 2ILYA 2CPXA 2HVIA 4ZVQB 3W65A 1NJXA 1X4HA 2KXFA 2GS8A 4ZP7A 1AT1B 2HG4A 4RW7B 4Q7AA 4ZPAA 5E7OB 1OYDA 4USMA 1GFWB 2VQFJ 3PTWA 4NLGA 1IKXA 3W7BA 1ZA2B 5THWA 1XMOJ 3K5MA 1RISA 3CGIA 4ED3A 3C16B 2XMAA 1TK5A 1Y9OA 4EZ9A 4LSZB 2COLA 4KHRA 2DNOA 2VB6A 3MEGA 5KFIA 4GRSA 1V5IB 3O44A 2QSWA 1NB7A 2WSCC 5A8RA 4J9LA 1H38A 3DRRA 4PXBA 4RO0A 2E1AA 2X51A 2V2KA 4F2SA 1WUUA 4IOCQ 5KFPA 3DC2A 4NLTA 1Y10A 3EDRB 4WP8A 1XNQJ 2KHDA 1NK0A 1N5TA 1Q8BA 3C6UB 1M1KT 4X4VA 3PO5A 2DCLA 3OQ2A 2RQMA 3QAUA 3ZZUA 3CIZA 1RWKB 3W1YC 1TU0B 2BRKA 2ZUAA 1Q0NA 4K8RA 4MIWA 4OI0A 2YQ3A 3PVXA 4FF4A 2DNRA 3MMAB 3D0GE 5CAAA 3FVYA 1UVKA 2DEJA 3Q2TC 4YUDA 2AWZA 4LFCF 1HARA 3HZGA 4JV1A 1RT5A 5KFZA 4KC5A 1YI2S 3RAQA 4MTPA 3IMQJ 5A6PA 3C14B 3CD6S 3MR5A 3QMQA 3DCAA 2HBZB 4TY8B 3IXQA 1Q8LA 4I2QB 4RNOA 4LF6J 2R4FA 1AYEA 2FUG9 5KG2A 1G6BA 3TZZA 3QT7A 3CCTA 1HNZF 2ZZNA 2VPZB 3EGWB 4ECZA 4LF5F 3U1LA 1S1VB 1VC6A 2DNHA 4ZVGA 1MWYA 5GAGI 2HHVA 3NS7B 2X3GA 3CJSA 1F1BB 4A47A 4NLPA 2ROEA 2AGOA 3M8QA 2EFPA 5DDQC 3M32A 4GVBB 4CRJA 2RQ4A 3JTNA 1LXJA 2GIFA 4AUKA 3QQCD 3HSJA 1S4EA 4A8OA 3PKYA 3KNGA 1DHMA 4HKQA 3T5JA 1JLGA 1B7YB 3J7YI 2QV6A 1N34F 2VPYB 4PXEA 3UVJA 3KFWX 2BQ3A 1C4CA 2D74B 2VU5A 4OFZA 1R31A 1RYSA 2UUBJ 1OIAA 3H98A 3WQPA 3P49B 1UVMA 3VVTA 1SV5A 4K0KF 1SL0A 1Z4UA 2DHXA 2QL5B 2IVMA 2NXCA 4MKVA 1VQKS 2XYHB 2VZ9A 2XMKA 3JS9A 2EBEA 4LF4J 1FKPA 3P6YC 1HYSB 4KHPF 4OZ2A 3R1LA 2K2PA 3IR6B 4I67A 4AYBD 2P9GA 2HQFA 2QJ3A 1VQYA 1GTHA 3VGUA 4CLFA 3D9BA 1HQUB 4KR0B 3D1HA 1F9HA 2QIFA 1YRXA 3CJTA 2DHHA 2W01A 1PAUB 3KNAA 3N79A 2K7KA 1JJ4A 4QIVA 3HSGA 3NEKA 1VRQC 3DXSX 2XCPA 2ZHBA 1RU2A 2KRRA 1W2IA 3BGLA 3D3CJ 3D7SB 1VIOA 4CT8A 3R8YA 4OL8A 1NK7A 4MJKA 2HVHA 3FRYA 4K50A 2Q43A 1RHJB 3WX8A 4L72B 2DNLA 1N4LA 2GJ2A 4O3RA 2B5JA 4OJ3A 3IM9A 5HQLA 3IAM9 1HL6A 3GIKA 4OZ5A 4CM2A 4UOHA 3SSQA 7AT1B 3Q8VA 2W4DA 4K4TA 1KBRA 3G71S 2FY1A 5E0OA 2AGQA 3DLGA 1OO0B 3CDUA 4Y28C 1QUPA 1NSPA 4NYPA 3AT1B 4ED1A 4WE1B 3D0HE 3FDSA 1TMMA 3V6HA 5HROA 4JUZA 2L9NA 3SQOP 4DL6A 3MWBA 3N0VA 3TUPA 4KY3A 3QT6A 2QLJB 2V9KA 2PGCA 4C8NA 4KJIA 5K5MA 1NEEA 3KJVB 2CJQA 5C2GA 1JLCB 1UP1A 3NRBA 4Q45A 5E41A 3I4HX 1DFDA 2M2BA 4DZDA 4UT4A 1KKHA 1XN9A 3D5MA 2X1GA 1T9UA 5CYQA 3MM8B 4RW7A 1QD1A 3CCRS 3VAGA 1N8RT 2VQEF 3R7SB 4Q0BB 1UJ6A 3RRKA 2W7PA 4OYAA 2KHCA 3C16A 1N36J 4DCOB 4ILLA 5E5NA 1HPZB 1XMBA 2HHHF 3A13A 3RRGA 3K5LA 2QL7B 4NLYA 1SBRA 3ZZTA 2ASLA 4QR2A 3H4DA 4X4PA 4DV0J 4A8WA 2L41A 2C3MA 4BCAA 5B0EA 2VQFF 4OI2A 2DY1A 3TEHB 2DVIA 3LPYA 1BGXT 1XMOF 5E33A 4NYZA 3TI0A 3EX7B 4X66J 1T94A 3OFFA 3OLBA 3LAMA 2BZ2A 4DHVA 2Z0GA 3HJFA 4Q2MA 4PR6A 4C8LA 4J9KA 4B9SA 5KFSA 4ZPTR 2KG0A 5GADU 1DLOB 2QGFB 2C2ZB 1NHKL 1KOHA 4QIGA 2DRDA 2JEIA 3CD7A 4MIAA 4N8NA 1U02A 4O44B 4Y2KA 2WVDA 3ILIA 2XS2A 1D3WA 3QPIA 1JMTA 1VRTB 4E0DA 4DSLA 2B6AB 2BE7D 1S48A 1UVJA 3MM5B 2ZVIA 4M5HA 2UU9F 4I56A 2CKWA 3N5BA 3SSSA 2XM3A 2G0JA 4DS5A 4QU7A 5HLFA 1SJQA 4TY8A 4USWA 1RTJB 4I2QA 4D3HA 2MB0B 1V3RA 3D0IE 2QYCA 5IC6B 4QOTA 3HVRA 1C1CB 4J9OA 4CT9A 4B9VA 4IRCA 1S1VA 2A0FB 2B0GA 1F0XA 2HVZA 3MPYA 3D6TB 5DRKA 2R9LA 1X60A 2CQDA 2X1FA 1GK8A 4GVBA 1S1XB 1ZTTA 1FJGJ 3JQKA 4TY9A 4DN0A 4LF6F 1REVB 4QYRA 2YQ1A 3BSNA 2J9DA 1K0TA 5A8KB 1U47A 1TL3B 1VMBA 4W92B 4N47A 3RGIA 3R5DA 3IFEA 4L74A 1S72S 3PO4A 2N82B 4F7VA 2GO9A 2FQQB 3N6MA 2E5GA 5LMUJ 4OHVA 3IWNC 2B9XA 1WWHA 5KT6A 5AXMA 4ZVTB 4CWBA 3HHLD 1HYSA 1N52B 2BKOA 2X7IA 4ZOSA 2UUBF 2DY9A 5G0RA 5C25B 1FRLA 3HFVA 4ZLLA 3N4WA 2GHWA 1HQUA 1S1WB 4DX5A 2MKCA 2FHMA 4FPRA 2CNLB 2AJ4A 4ES2A 3A12A 1NDKA 2ZJPQ 2ASJA 2IMOA 2J9EA 1S10A 2ZWPA 4BWJA 4LF4F 3Q2SC 5KFFA 3H5YA 3O2IA 3ZNJ1 2FGOA 2F1FA 2NQPA 1FNXH 3PYEA 4PQUA 2JDJA 2IJNA 4OYIA 1X5TA 3J7Z5 3KK3B 4MK9A 4BC9A 2YPZA 3ZZOA 1UA1A 1MWQA 4DPWA 2C3UA 2F8MA 5HSPA 3KUHA 3B54A 5KG7A 3MFIA 4F50A 2EVZA 4CP5A 1FEEA 2GCFA 2NR0A 2BE2A 1KNZA 2GAHC 3NLCA 4TLRA 2VF3A 1X8DA 1YG0A 4WE1A 4M5IA 1UETA 3BO4A 1MNEA 2PT0A 3MI7X 3QFWA 2BRLA 5GADI 1CSJA 4R0EA 4QWCA 5IWAJ 3EPIA 2DNMA 2UZAA 2BM0A 3MF5A 3CJ2A 3CCZA 2B9WA 4EBCA 3A8JA 3KJVA 5L1IA 1JLCA 5EUHA 3MM9B 4KO0B 4Q5VA 4DPYA 2CJXB 1G1XA 1JQGA 1TVRB 2BW2A 3CJ0A 4WFBQ 2P8IA 4YEAA 2HFVA 2DGSA 2N4CA 4I2PB 1RT2B 2QLXA 3MM8A 4P52A 2KVIA 3CJ3A 4EO6A 1OQ6A 2AJFE 2ACMA 1X9WA 2BQRA 4WK1A 2HQGA 3MR7A 1ZPVA 3AODA 2M70A 1RDRA 3L7OA 1HPZA 5ETOA 2R7TA 1Z1ZA 4WP3A 2C3PA 5LM7E 1MG7A 4ECQA 4UZCA 1FXDA 2VONA 1VQOS 4HDGA 4P2SA 2YPYA 3AY0A 4MMOA 4QJVA 4NWBA 3I0RB 4B08A 2FY8A 1N36F 1P8GA 1YLXA 4TQRA 2MJUA 1SC6A 3W2WB 1ITPA 2V8VA 1SQEA 4YR0A 2VOOA 1NJWA 1OSDA 2JNJA 4DV0F 4LIWA 2R8IA 1PGZA 1HHTP 1DLOA 3GIIA 5D3GB 1LNQA 4XDDA 3M8PB 3CJ4A 4O44A 5LXRA 1WSVA 4X66F 1VRTA 1KVIA 3Q8SB 1WACA 4OI3A 2PFFB 2B6AA 2DNPA 3MM5A 3K17A 3NKYA 4CO3A 1SC1B 5CZXA 2DHAA 3WDOA 5F8GA 2DRBA 1VQPS 1Q5YA 1UJ5A 4IG3B 1P27B 1KLMA 2YNFA 1VGYA 1C1CA 2RS2A 1ZZNA 3HHKA 4URSA 1YJUA 4IH7A 4KGXB 4LF7J 1ZM4A 1B99A 1X5SA 2AZ1A 1XJWB 2LEAA 2AJ2A 1ELOA 3QGGA 2ACYA 2CG4A 4KT0C 4OHWA 3WHIA 3HHLC 5GMEA 3MFHA 1S1XA 2L3MA 3OXLA 3FFIB 4PPZA 1REVA 3JSMA 4TXSA 4FS1A 3UD5A 1FRJA 2EK1A 4X64J 3M8YA 1RA6A 1NSKL 1RT1A 4WFNQ 1C1BA 1TL3A 2YNGB 2ZEJA 4K4VA 4CCHA 2EKNA 4USHA 4PKDB 4CLWA 3OTOJ 2XY6A 4I6WA 2YWGA 3CJ8A 3CT9A 4QW9A 2ROGA 2KRBA 3NS5A 5KFEA 3BB5A 1FJGF 4GC7A 1XR7A 3T3FA 4YB6A 2VFTA 4PPDA 3PRBA 4BHQA 4X4RA 1IBMJ 4NE9C 2DHGA 1WTFA 3TW0A 1H72C 4PYAA 2UUAF 1NPKA 4QWAA 1RACB 1UFLA 3EXYA 2H9ZA 3PIOQ 2P9CA 3N28A 5E3RA 3GJRB 3HM9A 1SQFA 3ZZYA 5C25A 2FLOA 4ZVEA 2J8AA 5KFOA 1Q78A 1B0VA 4KHMA 3SQGB 1S1WA 1WNEA 5LMUF 2E5IA 1O51A 3GZ7A 5C7PA 1NJZA 3EDQB 4IG0B 1LQ9A 2XGPA 1NKEA 1MMLA 2CQCA 3GWCA 1LK5A 2B9EA 5MLCV 4I64A 2UUTA 5AXNA 4NZ0A 4IFVB 4ECSA 2HGNA 3MMBB 3HI9A 3I5AA 1AFJA 5HJXA 4ED7A 3DFEA 3KK3A 4RL1A 1F3VA 2QLBB 2FVRA 2VJUA 5IM0B 3R5GA 2RRBA 1VQ9S 3T1HJ 1SKRA 2R7UA 2IJFA 2RDIA 2GMHA 1ZS6A 3DLEB 5J2NB 4OLOA 2VBZA 1YJ9S 1I51B 1NK5A 1WI8A 2CPJA 2AHOB 1S9GA 2V6AA 2YWFA 3BDEA 3HVTB 2LDYA 2H1YA 3V81B 2O1PA 1Z2ZA 2AQ4A 3I4PA 5K20B 3MPVA 3GYNA 5KFMA 2IA6A 1M1HA 1KVKA 5B0GA 1VBXA 5ETQA 5IZHA 4D3GA 3KHRA 2WVFA 3MM9A 1VCTA 4RWXA 2JVRA 4KO0A 5D8HB 4EBDA 3M2UA 1TVRA 3UR3C 1XC9A 4I2PA 3ZTOA 3V4IB 5KT2A 3JSRA 4OZLA 3PJ9A 3H0PA 5IWAF 3C66A 5F8LA 2ZD1B 3BBFA 2FHOB 2EFVA 2V4QA 1S1TB 3TARA 5F9LA 3OFHA 4IYQA 2XTJP 4X4SA 3I5CA 1N48A 3BSAA 3DDIA 2J9DE 3ISNC 3B6BA 3K8WA 2DO0A 2W4PA 1RQ0A 4JI0J 4KPCA 2R2UA 4WBFA 1BE4A 3B4DA 1RWOB 1HW9A 1VQSA 2M52A 3NS6A 3VAHA 4NEZA 1U8SA 3I0RA 5KTQA 3FQKA 2FVSA 1RB0A 3OT9A 3CC2S 4TYAA 3PR5B 3BDPA 2A2DA 3PG9A 3TA1A 1NPPA 1YJVA 3V6KA 4DR2J 2MLYA 2KYZA 4U96A 4HI2A 3EWGA 4IH6A 5B09A 3EZOA 3M8PA 4NRUA 1MU2B 3SEOA 3F41A 3KDOA 1U0SA 3W66A 1KLNA 2CIMA 2Q79A 2E66A 4WU3A 4Q43A 2RKIA 5LSOA 1EP4B 5J2MB 3TJAA 1FERA 3I56S 5H9EJ 4IG3A 8AT1B 5KFTA 1M5SA 3PKMA 3BGFA 3HDSA 4DL3A 1AUDA 2DB1A 4OYBA 1T95A 3BN4A 4QIWD 4F2RA 1B3TA 3S7RA 1X4DA 2HS4A 2ZC4A 4R0JA 1BC6A 1HD0A 1CS4B 1RLDA 3AJ2A 1S0OA 3H2LA 4JI5J 2LDIA 4WYLA 1ZA1B 2HAFA 1B0PA 4MH8A 3BQ2A 1NDLA 2LKZA 4BLGA 1U49A 3C2PA 3W8GA 3ZO7A 1WJ9A 5H1SV 3PW7A 2XI2A 3FFIA 3BQ1A 1F5BA 4F25A 2V4RA 3I0SB 2IRUA 2Z2MA 4RUAA 2BX6A 4FS2A 2W24A 4FKXA 2MZ1A 4FPIA 4H4KC 3KMQA 3POTB 4OQJA 2NUUG 2P2CB 2IJRA 4FDFA 1RLCL 3PW0A 4IKAA 4LFBJ 3HHLB 2E7VA 2IY5B 2MY7A 3KXDA 3BKUA 3E51A 3BO2A 2MQQA 1X31C 4X64F 3TA2A 3BGRB 3GQCA 3TUJC 3R97A 5L9XA 2V67A 3PXGa 3H59A 3H5XA 2KT3A 4NL5A 4KB7A 4CLZA 3M8SA 3NAHA 4X62F 5KFNA 3BYPA 2NUHA 1AROP 2MY8A 4CI0B 1RYRA 3GB0A 4YY3J 1QSYA 2V68A 3FK4A 3SQGA 4QR0A 1Y00A 3ETMA 3LP0B 2HNDB 1LWXA 3BH7B 2C2DA 3OVAA 1L3UA 2W9AA 5G4DA 3Q8RB 4F0HA 4BWMA 1EJ7L 3O5TB 3J81U 3MMBA 4NCGB 2HNZB 3KK2B 2QE5A 2I1RA 1H7WA 3T19A 3O1LA 5IM0A 2F7VA 3MECA 2XZWA 1LV5A 2I8EA 1WEZA 5B0CA 2GQQA 2QA4S 1OSCA 1N6QB 3OR2B 1HMVB 3DLEA 5J2NA 2CZ4A 3Q83A
chains in the Genus database with same CATH topology
2E1MC 5A6WA 2YNHB 2MZJA 4M94A 4FN5A 1QVGR 1QY7A 4NXNF 1VQLS 2WTFA 3MMCA 4E8UA 4F4WA 4J9MA 2DD8S 1ZM2A 3N6LA 4QWDA 2LA4A 2QMWA 4PUOB 2J7KA 3BR8A 3MEKA 2NPFA 2OMLA 3MOJB 3UD4P 5AXKA 4C3MA 2HHPA 4OI1A 1RT3B 5GAEU 3NGKA 3DRSB 3ZC4A 5L1KA 2OPQB 1OS5A 5HROB 4AL5A 2QA4G 4LUBA 1TK8A 3HVTA 3C6UA 3NGDA 1BD6A 2BV3A 2ZNYA 4G3IA 3V81A 2FJBB 4ZKAA 3DI6B 3DLKB 3D1OA 4NMLA 4O0IA 1WI6A 4F02A 1KQGB 5L1LA 3T1HF 4I68A 2PO4A 2ADBA 3PIPQ 3AA8A 1BY9A 2HYIB 1SB6A 1U2FA 4PWDB 1XTZA 4IDKB 3KLHA 3NMRA 2XY7A 2M4MA 3R1HA 1VBYA 1NKCA 1BWEA 4OHYA 3I6PA 3M2VB 1G2EA 1KOOA 3IWXA 2QA1A 1L3TA 3MMAA 4CIOA 3I96A 5F3ZA 5F3TA 5T14A 2VG5A 3MZIA 5DQHA 2N3LA 3OUYA 3TANA 4F4KA 3MD3A 3PX4A 2AD9A 1KTVA 2FJWA 2OLWA 3I32A 2ILYA 2CPXA 2ZKUA 4RBUA 2HVIA 5C5JA 2D1CA 2HFNA 2ROPA 2E1CA 1NJXA 1X4HA 2KXFA 2UP1A 4OIXA 3VR1A 4ZP7A 1SI9A 3QJPA 3P96A 2HG4A 3HKWA 3U7JA 3OXGA 1WF0A 2BYCA 2J5AA 2WHOA 4RW7B 3H5UA 5J1EB 3MUTP 4ELUA 4Q7AA 5JVHQ 2DNGA 3QO9B 4ZPAA 5E7OB 1CEZA 2VUGA 3UCUP 1YIJS 1LK7A 2Q6CA 3J7ZT 4NLGA 1IKXA 3W7BA 5DJBA 3QGIA 1RT7B 2GMJA 5BR8F 4M95A 5THWA 5IT9Y 3IG1A 4QBUA 3K5MA 1RISA 3CGIA 3G6YA 4ED3A 2XB2D 2KZZA 1HD1A 5HO4A 4J37A 2HPUA 4Y6IA 3H2VE 5K8PA 2DR9A 1FNOA 1KQKA 1NK4A 4QCLA 2DPIA 3TAPA 1SUQA 4LIRA 3T6JA 1KVJA 1S1TA 4JI3F 4DL0C 3CVKA 2K3KA 3SSRA 1LW0A 1TK5A 1Y9OA 2E5LF 3FSIA 4EZ9A 4DQQA 2YWHA 4K5SA 1QSLA 4PXDA 4YHHF 2COLA 4KHRA 3UI3A 1QSSA 4DOZA 5DGAA 2FLNA 2VV5A 4LVOP 4X2BA 2DNOA 4LSLB 2VB6A 4LSNB 1L5UA 3MEGA 3K8VA 1P6TA 3NBPB 2VFUA 5KFIA 3OL9A 3MECB 3DOKA 4Y65A 1B64A 2LQ5A 2IYGA 1XNRF 2KM8B 4JI1F 3O44A 4NLXA 4FXVA 5KFJA 2FB0A 2RF2B 2QSWA 3MGJA 4ZPBA 1AW0A 4XPCA 3Q0AA 3DRYA 1DURA 1NB7A 1Q79A 2WSCC 5A8RA 3DOMA 4CO2A 2R7SA 2R7WA 2UV8G 4WXWA 2B7CB 4J9LA 3QAEA 3DRRA 1H38A 3PZPA 4PXBA 1BQXA 1KTQA 2A18A 4TN2A 5DG9A 2E1AA 2AYBA 2X51A 1N88A 2V2KA 2LXUA 2WONA 4RU2A 2RJZA 2W9BB 3RTVA 2B4UA 3VAMA 4F2SA 4IOCQ 3G86A 3US5A 5AE2A 3LP1B 2RS8A 3MMCB 1S76D 2LECA 4ZP8A 4BS2A 3ENVA 3MPWA 1WEXA 4UY8T 3LOUA 5KFPA 1O5JA 3DC2A 5KT5A 1C4AA 5F8IA 4KV8B 2N3OA 5AE3A 3UDCA 2YH0A 4DLGA 3IO1A 1JIHA 2LMIA 1F5CA 3K5PA 4NLTA 2KHDA 4Z37A 1NK0A 1JNZB 1N5TA 1Q8BA 3C6UB 3UQSA 2DT9A 1VQ6S 3DMJB 4Y00A 4JV5F 1IQTA 3ENQA 3EUNA 1M1KT 3CIMA 4QIFA 4RNFA 3CWJA 2DCLA 2O5DA 3OQ2A 5D78A 3PO5A 2RQMA 1D8ZA 5E2QA 3S8SA 1SH0A 3AHPA 3QAUA 2R7OA 3CIZA 4JI0F 3ZZUA 2A3JA 2BRKA 3HMJG 2HMIB 1U48A 4DV5F 1N32F 1M5VC 4UUXA 4AFFA 4MIWA 1QVFR 4OI0A 4CQ1A 2B7BB 2E9RX 2YQ3A 3PVXA 4ED5A 2QA2A 4FF4A 2W7OA 2DNRA 3MMAB 1DZ5A 2HFZA 3T1AA 3D0GE 4NLRA 4ALZA 2ZH2A 1LWFA 1MU2A 3FVYA 1UVKA 3OUYB 4RBTA 1NZAA 3Q2TC 2OPPB 4YUDA 3GE9A 1VLYA 1UFWA 5K8MA 2J76E 4LFAF 4WYWA 2AWZA 4LFCF 1OPIA 4DL4A 2UXDF 3M30B 1JX4A 1HARA 2XHWA 4H4KA 2FIUA 3GV5B 3HZGA 3OR1A 4JV1A 4WFZA 1RT5A 4R25A 2C3YA 4WJBA 5LJ5Y 2DGOA 2JEFA 3LH2S 5KFZA 1M5HA 4DR2F 4B9MA 3OSPA 4KC5A 4DFKA 1YI2S 2XY5A 4A4JA 5CZVA 3W2VB 1EP4A 2ZH6A 4AL6A 3RAQA 4NA3A 4JV2A 2F8HA 4MTPA 5J2MA 3THVA 5KG5A 5A6PA 1HBNB 3ZZPA 3CD6S 3MR5A 3QMQA 1M5KC 3DCAA 4TY8B 3BZQA 1Q8LA 3IXQA 4I2QB 4RNOA 4XIUA 2R4FA 2FUG9 5KG2A 1G6BA 4XO0A 4EO8A 5B0DA 1H2TZ 3CCTA 1HNZF 2ZZNA 1X4EA 2VPZB 3EGWB 1HNVA 3T5LA 1T7PA 2UVUA 4EGLA 2UVRA 5F8NA 4ECZA 2ZBCA 1BLUA 2CPIA 4H4OA 4EUVA 3SI8A 1IM4A 2V8GA 1VRUA 2JLEA 3AAWB 3M2RA 3OJUA 2OFGX 2CQ4A 1X5OA 4FXDA 4LF5F 1EETA 1S1VB 3U1LA 1IKWA 2DNHA 4ZVGA 1RAJA 1VC6A 2UV8A 1MWYA 2YKAA 5GAGI 1JWWA 2JLGA 2HHVA 2IM0A 1XERA 3KG4A 2X3GA 2DK2A 1S9FA 4X4TA 3VZIA 4A47A 4DV4F 1U4BA 4NLPA 2ROEA 4KAIA 4UW2A 3M8QA 2AGOA 1K1QA 4WK3A 3WC0A 2EFPA 1U1KA 5DDQC 3M32A 1PC4A 3HZEA 3CCWA 3RB6A 3IA0A 1Q8IA 3NMAA 3MXHP 1FESA 2DHSA 2RQ4A 1LFWA 3F56A 3JTNA 3GIJA 1TR0A 1LXJA 4N77A 2BJEA 2YKQA 2VL1A 2C22A 1N5QA 1I1GA 4AUKA 1XR6A 3Q24A 3I0SA 2J6SA 1FVQA 4WXOA 2HQIA 4A8OA 2DJWA 4NLDA 4ID5A 4RNMA 1GXTA 3PKYA 1JLEA 4NLQA 4QW8A 3KNGA 4HH0A 4WKRA 2R7QA 1DHMA 1IJFB 4ZPDA 4HKQA 2JFKA 3O8WA 3T5JA 1JLGA 3CC7S 3J7YI 2QV6A 4IFYA 1N34F 2FJDB 2VPYB 2MMYA 3BGUA 3POTA 4PXEA 3KFWX 2BQ3A 1C4CA 2D74B 3RBDA 1HBMB 4OFZA 1R31A 2HGMA 2K3IA 1RT6B 1N56A 1RYSA 4ICLB 4JI5F 4RW4B 1OIAA 3H98A 4YB5A 4C8MA 2OH2A 3P49B 3DRPA 4USJC 1UVMA 1APSA 5DQGA 1VQ4S 3HHLA 1KQSR 4CZCA 3CMES 1YJNS 1SV5A 3GIMA 1R6YA 1SL0A 4K0KF 1Z4UA 2DHXA 3THTA 3SV3A 2XG8A 3DNCA 1DQ9A 5LSRA 3M1VA 3TYTA 2HIQA 2N7CA 5CYMA 2IVMA 4N41A 3BSOA 1PILA 4QZVB 4YFUA 1N33F 4I6AA 5KFYA 2JHEA 2Q3PA 5JXSA 1MWZA 3R27A 1LWFB 4Q2LA 2MKJA 1VQKS 3BGRA 2VZ9A 4Y2CA 2IC3B 1PC5A 4OX6A 2XMKA 4OZ0A 1YJRA 1HI0P 1HQEB 4OJHA 4ITSA 1UL3A 2EBEA 2BR0A 2UUWA 2J6UA 3KLGA 4RW8B 2RE1A 1FKPA 3D28A 3P6YC 1HYSB 5I3UA 4KHPF 5GAHU 3J7A1 1JK9B 2Y1RI 3R1LA 3TA0A 4Y34A 2K2PA 3IR6B 1GH8A 2F9JA 4F67A 4I67A 2E5HA 2XO7A 3T9NA 4AYBD 1T03B 1SXLA 2DGQA 2P9GA 4LFBF 2DITA 2LEPA