4PUOA

Crystal structure of hiv-1 reverse transcriptase in complex with rna/dna and nevirapine
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/rna/inhibitor
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
total genus 145
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4puoA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4puoA05
1T3NA 1C1CB 4NLVA 3HM9A 4LD0A 5HRNA 1FKOA 1IKXA 1KTQA 1OS5A 3BDPA 2DTUA 4KHMA 4Y1CA 4E7HA 2G8UA 2ZD1B 2ASDA 4J2DA 1TK0A 4CFAA 3OY9A 5J1EA 4J9QA 5HBMA 3KLFA 3MECB 1RDDA 3CM5A 3KLEB 4FJXA 5JS1A 3OJSA 3L2QA 4KTWA 4EBEA 1JL1A 3OYFA 5KFUA 1WSGA 4NLXA 3O3FA 3N6NA 3MXMA 4CJLA 4E7KA 3G10A 3I0SA 4CJFA 1RT2A 1SH2A 2ASLA 4FLZA 4K4WA 3VQ8A 4IFYA 2Q3SA 1TK5A 3GV5B 2QXFA 2X78A 4Q44A 1S6PA 1S1XB 3DLKA 2YNHA 4WXWA 1LWFB 2ILYA 4CHNA 1FK9B 2FVSA 1IKWB 3TR8A 2B6AA 1S10A 5I42B 5F8LA 3E01A 4M3TA 1X9SA 4KB1A 2DFHA 3OYAA 2FBXA 1U4BA 1HNVB 4NRUA 4E1MA 2EC0A 3GIMA 2XO7A 4OGEA 4FJGA 3DLGA 4RW9A 3KHRA 4MQ3A 5D3GA 3NFAA 4IG0B 2KTQA 5HLFA 1L3VA 4CF2A 1KRPA 4CEZA 1TV6B 5KFXA 1WAFA 2DFFA 4CK2A 1VSDA 1IM4A 3KK3A 2YHAA 3CYMA 3ZSRA 4ZTFA 4EBDA 1JLBB 3M8QA 4NLUA 3SUOA 3A2FA 4PWDB 3BQ1A 1SH0A 2VA2A 3NF8A 4KKOA 3PW7A 1RT4B 3WNHA 4CGHA 4CJVA 4TY8B 2V0NA 3UDLA 1QSSA 4O3NA 4IFYB 3L3VA 2F8SA 1C1AA 4I2QA 3P83D 5FROA 1SUQB 4TQRA 4CJSA 3PW0A 3V6JA 1HQEB 2AGOA 1NJWA 3SPYA 2I5JA 1TP7A 4WYWA 4EZ9A 1LW0B 4Y34A 1NK6A 2OPQA 3AA3A 3LPTA 3NGDA 4Z4EA 2XCPA 3PX4A 3NH1A 3RMAA 4LSNB 4NLRA 3DLGB 1VSFA 3PVXA 1NOYA 1JIHA 4QOZB 1UWBB 4DTJA 4ED8A 5DQIA 4ICLA 4O3SA 2J6UA 4QW8A 2QV6A 2VG6A 5KFYA 3UR0A 1NK7A 4IKFA 1B9FA 3LP3A 3CVKA 5KG4A 4MK7A 2JC0A 1EETA 4M94A 4NLDA 3PW5A 3KD1E 4KHSA 2D41A 3QGHA 4BWJA 3V9SA 1K6YA 3AVGA 1JKHA 5L1LA 4CJUA 1RT4A 1NKBA 3OL6A 3MR5A 5DG7A 3PO4A 3L3UA 1S0NA 3THVA 4M42A 1RTDB 2R7YA 3CJ5A 5KFKA 4C8MA 2YKMA 4M3UA 1U48A 4XIUA 4FJMA 4M3YA 4RNMA 4PY5A 5KRTA 2YNFA 1JLFA 4FS2A 4DL5A 1I6JA 4Z4IA 4KKOB 3DOLA 3RRGA 1BIZA 3KMSA 5L9XA 1GX5A 2C28A 3PR4A 4ZPDA 2C2RA 4H4OA 1L3UA 1I39A 4QWDA 3K2PA 3KHGA 3CJ4A 4CFCA 4NYFA 3SQ4A 4F4YA 1ZBHA 1BISA 4CERA 1TAQA 4WFXA 4ID5A 3LP1A 3LWMA 3N6LA 4MK9A 1Z4UA 5D3GB 2FVRA 4B9SA 4I2PB 4DTUA 4H4OB 3QGIA 2Y1JA 1KCFA 1WSHA 3MEEB 2FBVA 3KKSA 3LZJA 4FZZA 3M9NB 3V81B 3FQLA 1S5JA 3DLKB 1NNDA 5KG0A 2BQ3A 4ELUA 3ZSXA 3KJVA 1Z25A 1S9EA 1FK9A 2DPJA 4AHRA 1IO2A 1CSJA 4FLUA 1RT2B 1LWEA 4WZQA 2KFZA 3CG7A 4DU3A 4DEZA 2IBKA 5DLFA 4HVJA 2G8VA 3VQ7A 1GX6A 4DTOA 1KVCA 4DL6A 4ZVGA 4H8KA 3SZ2A 1L3TA 1UOCA 2FJWA 3OSPA 3ZT4A 3CQ8A 1BL3A 2DY4A 1DLOB 2YHBA 3G6YA 4NRTA 1JLEB 2D7SA 1O1WA 4KI4A 2XWYA 2JGUA 3SUPA 1DTQB 2I1RA 1T8EA 2HB5A 5J2NA 1WLJA 3NGZA 4FLXA 4CJQA 3L2VA 3IS9A 4CHYA 2W7PA 1LWFA 3ISNC 4QWAA 4ECSA 3V1RA 4E19A 2ASJA 1IKVA 3DOKA 1QUVA 4C8KA 4KHWA 2YNHB 3WNGA 2OZMA 4KE5A 4DL2A 1A5WA 5FRNA 3QIPA 2WTFA 3VQ9A 5E41A 3VQPA 1XHZA 3QIPB 4EO6A 1T03B 3HHKA 1F21A 1XWLA 4MK8A 1BQMB 4M3WA 4O3QA 3BSAA 2BANA 2OPRB 1ZBFA 3QLHB 3V9ZA 3TARA 3KLHA 2E9RX 5KGXA 5C25A 3BSNA 3GIJA 4DS5A 5KFNA 1D8YA 3I0RB 1RTJB 4RUCA 3I0RA 3GIIA 1SH3A 3SCXA 3C6TA 2HNZA 3LAKA 4JRQA 5KFLA 3SI8A 2WOMA 3KLGB 4MFBA 2BE2A 3HJFA 4RW9B 3HPHA 1KVBA 3C95A 3BQ2A 4FYDA 2B5JA 3OL8A 4W5NA 5KG5A 3RB3A 4ECWA 4LH5A 4F3TA 1RTHB 2WONB 4FK0A 2W9AA 4EYIB 3IRXB 4PQUB 4FK4A 4DSFA 1EP4B 3KHHA 4DSIA 3OYNA 3KJVB 4O0JA 3MXJA 5KFDA 3FQKA 1QQCA 3M8PB 4CJWA 4O3OA 4FM2A 1EX4A 4Z0UA 4JV0A 4KTQA 5KRSA 3SI6A 2A1SA 2XCAA 2GV9A 4KHRA 2AX1A 2IM1A 4R8UB 3ULDA 3ZSWA 4Q8EA 3OS0A 4NLYA 4TYAA 5KFGA 2RF2A 2AQ4A 1GOBA 2EHGA 1RT6A 3H4BA 3AA5X 4F2RA 2I5JB 3CJ0A 2W7OA 1S0MA 3O4QA 1LV5A 5I3UA 5EWEA 4ID1A 1ZTTA 5KT4A 5J1EB 2G8HA 5HP1A 2V4QA 1CZ9A 2Z1GA 4TYBA 3ZCMA 3I5AA 4FCYA 4YNQA 3V1OA 3EY1A 3IN5A 1TKXA 1SV5A 3DI6A 4DFKA 3MFIA 1K1QA 1NK9A 4IH7A 1RYSA 4CESA 4FM0A 3B6PA 4ZMMA 2F8EX 1RILA 1JXLA 4OKEA 2X6SA 1X1PA 3DMJB 5J2MA 1S9FA 2W9CB 3WNFA 3KHLA 2XC9A 5T14A 4WFYA 1HPZB 1HMVA 4KB7A 1L5UA 4I2PA 2QKBA 5KFZA 1RT1A 4FBUA 3PUFA 3OLBA 2OH2A 3PR5B 3TAQA 1VSEA 2E6LA 5CYQB 2XGPA 1VSKA 2B6AB 4CEEA 1R0AB 2D0CA 3NBPA 5DG8A 4NLTA 3RR8A 4B3OA 1D5AA 4JS5A 4ED7A 4ZVEA 3HPOA 3DDKA 2B43A 3F73A 1FKPA 1IKYB 1N5YA 4GMJB 3NH0A 5KFFA 4IQXA 1CXUA 1N5YB 3G6XA 5KFWA 1D9DA 3ZSYA 3ISND 3NGIA 4ICLB 2A1RA 1W9HA 3RBEA 4PWDA 3AO5A 4CIEA 2R2UA 4NYNA 4AHCA 2F8TA 3DLBA 4J9RA 3KLVA 1YVUA 2FBYA 1NOZA 4AHTA 1S1WB 1BI4B 4RG8A 4DU4A 4KRFA 1ITGA 2CJQA 4KHNA 1JLEA 5KFIA 4Y2CA 3EPIA 1BI4A 3ZT0A 4C8LA 3QYYA 1HNIB 4K4ZA 4FS1A 4BDYA 1SUQA 4FJJA 1RBUA 1QE1B 4XPEA 4TY9A 1C1CA 3MAQA 4Q43A 1BCOA 3AVFA 3OYBA 1RTIB 2IOCA 4ZHRB 4JRPA 5KG6A 1WSEA 1CZBA 3PHEA 2IC3A 4BE1A 2DPIA 4H54A 1CLQA 3HSTB 5KFOA 2R2SA 3QETA 3DI6B 1J9AA 1WSJA 3D0PA 4WYLA 2RN2A 1UA0A 3U3YA 4CHPA 3H5SA 4CJ4A 1VSLA 4B9VA 4M95A 5KT5A 1RNHA 1VRUB 3TWHA 1ZBUA 4KBIA 3DRPB 1JLCA 4RU9A 4XPCA 1B92A 2W8KA 3OSNA 3HKWA 1S4FA 4F3OA 4L8RB 2OPQB 1S1WA 4QAGA 4EP4A 4FJLA 2WB4A 3G0ZA 2YKNA 5KI6A 2UVRA 4JUZA 4K4XA 3U6FA 4Z4GA 4CEOA 3M8PA 4FJ7A 3AVJA 5HROB 1HQEA 3SV4A 4DTSA 4MKAA 5EDWA 4PUOB 3OYHA 3H5XA 2Z1JA 4HKQA 3DLHA 3MR2A 4CJEA 1Y97A 1HQUA 3T3FA 2EX3A 4CHZA 4DG1B 2XRIA 3K57A 4YMEA 3MFHA 1JLBA 2KQ2A 4B9UA 2P51A 4ELVA 4AH9A 1UA1A 3HPGA 4F50A 1XR7A 4FZYA 3LPUA 1RA7A 3BSCA 2P5OA 4IRDA 3SQ2A 5I3UB 3AVKA 1S9GA 5F9LA 3AO4A 4DFJA 3MTKA 3ZSQA 4CHQA 5F9NA 4HTUA 4DQRA 1RT6B 4BDZA 2OPPA 4C8OA 3RRHA 1TL3B 1ZTWA 1N56A 3KMQA 4I9QA 5HBMB 1RT1B 3VQAA 4Y1DA 3LP2B 4MH8A 1VSHA 3AVMA 2IAJB 4MKBA 4QPXA 1BQNA 4JLHA 4IG3B 4F4WA 3DRPA 4AILC 3GV7B 3FFIB 1RAJA 4QWBA 3KTQA 2E4LA 4O4RA 2IA6A 2RKIB 4CEFA 1WSFA 2KZMA 3VA0A 2HHSA 1SKWA 1SV5B 4Z4HA 3L8BA 2W9BA 3AA2A 4IH6A 2AJQA 1BGXT 2OZSA 2GBZA 4BDPA 1REVA 3OYEA 3M8SA 5EU7A 4FVMA 3Q8SB 4OPKA 3KIOA 4DTXA 4IRKA 1D9FA 4CIGA 1NJYA 4DFPA 4CF0A 3HVTB 3H59A 4KTZA 4DQQA 1RDCA 3VQSA 3ZSOA 4KHQA 3KLHB 1TL1A 4TN2A 2NUBA 2XY7A 4NLGA 4DF8A 3ZSZA 4IR9A 2IM3A 2ATLA 3AVIA 5FRMA 3SNNA 2YKMB 4GC7A 3SUNA 4BE2A 1XC9A 4M3RA 5SWMA 2WK4A 1HPZA 3SUQA 2HNYA 4FBTA 1X9WA 5K14A 1U09A 4F4ZA 1N4LA 4CGIA 1C0TB 2HHVA 4GW6A 4LSLB 3V6HA 3HYFA 1IKXB 2HMIA 4IDKB 4XO0A 3OLAA 3SV3A 1HYSA 4CEQA 4KV8B 3DM2B 4PA1A 1LAVA 3WNEA 3RB0A 3AO3A 2GIRA 3QEPA 2FLNA 3DOKB 3V6DB 3VQCA 1QSLA 3PJXA 3CJ3A 2WONA 4DQIA 2WCXA 4MFBB 1WAJA 4Z4FA 4J9OA 1T7PA 5C24A 1NK4A 3CFRA 3HP9A 2B5JB 2WHOA 5DQGA 1RT5A 3CM6A 2JC1A 4Q5VA 4IFVA 5F8HA 4O3RA 4OJRA 5KFTA 1ZBIA 4FJNA 4FZXC 3UQSA 1ASUA 2R8IA 4NCGB 2OPPB 4ZP9A 1JXBA 4FJHA 3TABA 2KFNA 4CIFA 5CYQA 1S1VA 4N76A 3TAGA 5DLGA 1BQMA 2JLEA 1QAIA 2Z1IA 1B9DA 1NK5A 1C0MA 2CKWA 1HQUB 4HYKA 5DGBA 2IMWP 1KFDA 4ECTA 3UPFA 4IDKA 4J9KA 4TQSA 3DMJA 4KO0A 1U45A 5KFEA 3OYMA 1QE1A 4CJPA 1ZBLA 1KFSA 4RZRA 3IS9B 3H5YA 1HJRA 4CF1A 4W5RA 3FFIA 3DLRA 3U3GA 3AVCA 3MXIA 3M9OB 2YKNB 4FLTA 2Z1HA 2FC0A 4ECQA 4FJ9A 4CGGA 1TL3A 4HUGA 3OYKA 3KKRA 5DK5A 1J5OA 4CK1A 4R0EA 3QGGA 4HCBA 3BGRA 1TKZA 3SPZA 2R8JA 5KFBA 2PY5A 4M3ZA 2IJFA 4X2BA 1TL1B 4NLSA 4ZVHA 4KI6A 3LP0B 4WE1B 1LAWA 3VQEA 4K50A 5C25B 3F9KA 1BHLA 1JLCB 2RF2B 2QKKA 1HRHA 3S3OA 3JYTB 2LSNA 1VRUA 4ZTJA 4EEYA 4B9LA 1TKTA 4W5TA 3D28A 4O4GA 3H98A 5EWFA 4O4GB 3TVKA 3V4IB 2FVQA 4DSEA 2HW3A 1KLNA 4CECA 4DQSA 4DMNA 3V81A 3QZ8A 4CF8A 3HVRA 2RKIA 4KV8A 4YR0A 2FVPA 3M8QB 4ELTA 1S9EB 4CJTA 5T7BA 4DTNA 1KHVA 4EZ6A 5HROA 2HHXA 3AVAA 4ECYA 3KK3B 2XI2A 1RT3A 2G8FA 2HVHA 1FXXA 1RBSA 3K5MA 1S49A 5F8NA 1UAXA 2HAIA 3PX6A 4B8CA 4QWCA 1HMVB 1ZYQA 4UQGA 2J6SA 5HRPA 1LW2B 3CWJA 2UVWA 4HCCA 5JUMA 3GIKA 1ASVA 1C2PA 4Q0BA 3QNNA 2G8KA 3QNOA 1S9GB 5L1IA 1G15A 2AU0A 4CGJA 1S1TA 3VQBA 1YVFA 3NL0A 1KVAA 2V4RA 3H2LA 1I3AA 4IKAA 4J2BA 1MMLA 2C2DA 4CEBA 4Q8FA 3ZSVA 2C22A 4DF4A 2FLPA 5KGWA 4ZHRA 1MU2B 3JSMA 3OYDA 4O0IA 1N48A 5JXSA 3TAFA 3ICLA 5DQHA 5F8GA 3PO5A 4FLVA 3B6OA 3O3GA 3G86A 4IR1A 1EXQA 5FDLB 5C42B 1GOAA 4YP3A 3LP1B 2D0BA 3QO9B 1QTMA 4ED2A 3OYLA 2YNIB 1NKCA 3ITHA 1D0EA 1HNVA 3KLIB 5KT3A 3DLEA 4FJIA 3KD5E 1CXQA 1JX4A 1NJXA 2R8HA 3KLIA 1JLAB 4E7IA 3OYJA 3SYZA 1RBVA 1S6QB 1JLQA 1DTTA 2FJXA 4E0DA 2QE5A 5KFPA 3CDEA 5KFAA 4K8ZA 4O44B 3ZT1A 2V9WA 1A5VA 4KHUA 3QIOA 3ITHB 3HVWA 4JV2A 4KO0B 4CJKA 2KW4A 2VG5A 3OVNA 5CYMB 4O5BA 2RDIA 3V4IA 4ECXA 2ZKUA 1NHUA 4OPJA 4RNHA 1S1TB 3LANA 2Y1IA 1NKEA 2UVVA 1HNIA 4CFDA 3LALA 4R5PA 5EWGA 4CJ3A 4K8XA 4RW4A 4K4VA 3HT3A 3CFPA 3ASMA 3RAXA 3AO1A 3KNAA 5EUHA 3KLFB 4DTPA 4DSLA 2OPSB 3H40A 2XY5A 1GOCA 1XR6A 3DLEB 1S48A 1T05B 2VG7A 4KREA 4ED6A 1LW0A 3TQ1A 4J9NA 4AHSA 3OJUA 3HO1A 1SL0A 5KG3A 4DSKA 2D3UA 5KFJA 3PZPA 4CK3A 4DL3A 1KLMA 2W9CA 4J2EA 4G1QA 3BSOA 3P1GA 3SQ0A 4Y2AA 1S1VB 4AHUA 1LWCA 2XHBA 2D0AA 1RTHA 3L2UA 4LQ9A 3VQ5A 4FM1A 4ZP8A 2P5GA 3DRSB 3NAIA 5KFHA 4F2SA 4KPYA 2HNYB 3NF6A 3EZUA 1TK8A 5KT2A 4FJ8A 2AX0A 4I7FB 3QEVA 1SKSA 4IG0A 1KHWA 3FRZA 4QW9A 2YNGB 3MEDB 1BCMA 4RW8B 4OKJA 4HHTA 1JLAA 2IM0A 3N6MA 4ZP7A 3FDSA 1RBRA 2ITGA 1T94A 3AVNA 3BGRB 1IKWA 4DS4A 1HYSB 3OL7A 3CO9A 5F8JA 3KK1A 1HARA 2G8IA 2BRLA 4RW7B 4MIAA 3KOAA 1EP4A 3DM2A 1XR5A 5SZTA 2D5RA 4I2QB 2HHUA 1J53A 4LH4A 3QZ7A 2IS3A 1VSJA 2GC8A 3VQ6A 3RAQA 3V1QA 1RT7B 4CFBA 4BACA 3C6TB 2IAJA 3RR7A 1KSPA 3QEXA 3MR3A 3DRRB 2BE2B 1NHVA 4WFZA 4Z4CA 4W5QA 4ED1A 4URSA 1TVRB 4ECVA 1NJZA 1J54A 4NLWA 4YFUA 1SKRA 2ZD1A 4RW4B 3RWUA 1TKZB 3TAMB 2IGIA 3VQQA 2WRMA 3NKYA 3QLHA 1RT7A 3UIQA 3QINA 4KFBB 5KT6A 2W9BB 5KTQA 4N56A 5KFCA 2C2EA 3OL9A 4DFMA 3CIZA 4ZP6A 4N41A 3DRRA 3IG1B 5KG1A 1QS4A 3TAPA 1C0UB 3QEIA 4K4YA 1ZETA 2BANB 2OPRA 3E01B 1RTIA 2P1JA 5I42A 2IM2A 4K4TA 3L2RA 1C6VA 2PZSA 1LWCB 4B08A 1KLMB 4E1NA 1EETB 5HRRA 4RW6B 4RW6A 1IH7A 2HHWA 2R8KA 4M45A 1SL1A 4URQU 1S6PB 4IG3A 1TKXB 4N5SA 2HNZB 3LDSA 1RA6A 3RTVA 3RB4A 2G8WA 3TI0A 4GC6A 4DSJA 1VK0A 1TKTB 4N47A 1C0TA 3C6UB 3PW4A 4DLGA 2VG7B 4RW8A 2GUIA 5KFRA 4OKKA 4NLPA 2PYLA 3RBDA 4HUFA 4ED0A 1IG9A 3PW2A 3NDKA 5FDLA 5C42A 2UVUA 1HYVA 4DG1A 4TLRA 4GVMA 3OYCA 1L3SA 4RNFA 3SFGA 4K4SA 4BE0A 2HHQA 4EP5A 1REVB 2HVIA 4NZ0A 4NYZA 1FKPB 2AGQA 5CZ1A 2FBTA 3BJYA 2E9ZA 4E89A 3Q8QB 4DL4A 2O4GA 5L1KA 2BQUA 3AV9A 4FLWA 2OYQA 1LWEB 1Q8IA 1FKOB 2W8LA 2E6MA 2ILZA 4CCHA 4AHVA 1VSIA 3RMBA 4NLQA 5HRSA 3PX0A 4CJ5A 3IAYA 3NH2A 3QERA 4ECUA 1JLGB 3H08A 2XY8A 4B9MA 1WNSA 5J2PB 4OLAA 4M3XA 3LP2A 5HLFB 5C5JA 4CJRA 5DGAA 4MIBA 3BREA 2X6NA 2YNGA 3MEDA 4QWEA 1RYRA 2JEIA 4KB0A 1RT3B 1D1UA 3QESA 4H4MB 2GIQA 4LSNA 3TAEA 4G3IA 3EPGA 3P5JA 2OPSA 3PV8A 1WNEA 1TQLA 2FLLA 3NAEA 2KZZA 3OS2A 4RNOA 3ZT2A 2ATQA 4OL8A 3SJJA 3KK2B 2XI3A 5F8IA 4KAZA 3S3MA 2ETJA 3C94A 2XY6A 3DRSA 3SFUA 4J2AA 4NCAA 1S1XA 3V9WA 1TAUA 2RPIA 1C1BB 1RCHA 1RDRA 1YTAA 3D5MA 4CF9A 5HP1B 5KT7A 2HNDA 4EO8A 3JSMB 3NF7A 2VG6B 3IGVA 3NAHA 2R2RA 2AGPA 2OA8A 1IKVB 3OS1A 4ID5B 4WE1A 1XI1A 1JLQB 1TV6A 4EYHB 1U04A 3O3HA 3LZIA 1XHXA 4J9LA 3G6VA 4I9LA 3V9XA 3M9MB 3NF9A 4RUAA 1S6QA 4F8RA 4B8AB 5KFMA 4E7LA 1JLFB 5DMRA 3T5KA 1VRTB 2B4JA 3K58A 4E7JA 1SL2A 1YTUA 2YNIA 4OGCA 4CEAA 2R2TA 3RMCA 3AVBA 2O4IA 1MU2A 4IH5A 2VWJA 4JV1A 4FJKA 1RTDA 4B3OB 1JL2A 4ZVFA 5J2QB 1W25A 2QK9A 3NBPB 5CYMA 2O5DA 5KFSA 4B9NA 4IOBA 3HXMA 3JYTA 1EKEA 3V9UA 2PYJA 3PJWA 4Q0BB 2VA3A 3OYIA 3NE6A 1LW2A 1Q9XA 3AVHA 4CGFA 5KG2A 2JEGA 3LWLA 4ECRA 3NMAA 4K4UA 3Q8RB 2BRKA 4ZPAA 1BQNB 4DTRA 5J2PA 1UWBA 5KFVA 1RT5B 1DTTB 3KLEA 2BR0A 4CEDA 2JEFA 1YT3A 2IJNA 3I5CA 2RDJA 1QHTA 5L1JA 2UUTA 1T03A 4C8NA 1ASWA 4DTMA 4F4XA 2ZQBA 4QCLA 4ZPBA 4FW1A 3TANA 3DOLB 3BR9A 4CGDA 5JS2A 5J2MB 4R5PB 4YR2A 2HWIA 3VQDA 1VSMA 1TKDA 3T1AA 3NCIA 4TY8A 3T5HA 3SQ1A 2FVCA 3I0SB 5J2NB 4DL7A 3ZT3A 3AO2A 2IC3B 4J9MA 2UUWA 3CJ2A 1W0HA 1K1SA 1C0UA 4FLYA 1RBTA 3IG1A 2YV0X 4F4KA 2W42A 1U47A 2J6TA 4O3PA 3L2WA 4HUEA 3K5NA 4CHOA 4PUOA 1R0AA 1U49A 4M41A 4O44A 2E9TA 3MECA 3GYNA 1S1UA 1S97A 3T5JA 4U6PA 4FW2A 2F96A 2FJVA 4H4MA 1RDAA 3OHBA 1Q9YA 3E51A 3ALYA 3CFOA 4YR3A 4LQ3A 4OVLA 2BQRA 4Y3CA 3HVAA 3MF5A 3I5BA 3HK2A 3IRXA 4PQUA 4KAIA 1BIUA 1JLGA 4G1QB 4ECZA 4LY7A 5KG7A 2ZE2B 4J9SA 2AWZA 2HNDB 4O55A 1QSYA 2ALZA 3D45A 4BWMA 3RMDA 4DQPA 2ZE2A 2HMIB 2JEJA 4OLBA 4RW7A 3BQ0A 1WN7A 1Z26A 3KLGA 1T05A 4CE9A 3TAMA 4DWIA 4LSLA 4ED3A 4NCGA 3KK2A 4U7CA 3QEWA 4TSXA 1DTQA 3V6KA 4KFBA 2DFEA 3MEGB 1JXEA 4IFVB 3NHGA 4E3SA 3HL8A 3LP0A 3RB6A 1NK8A 4NCBA 2D3ZA 3EZ5A 4KSEB 1VRTA 3MR6A 2BGGA 1TVRA 4I7FA 3HP6A 3QIDA 2R8GA 3I8DA 1HYZA 3FSIA 3MEGA 1JKHB 3V6DA 5C24B 5CY4A 4R8UA 4FJ5A 2HWHA 5DG9A 3Q8PB 4FK2A 4NLOA 3H5UA 1X9MA 4B9TA 5KFQA 3AVLA 4DLEA 3GQCA 4JS4A 3K5LA 1WSIA 3KK1B 3GV8B 4IRCA 5F8MA 2VWKA 4Q45A 4W5OA 1N6QA 3K5OA 3IGNA 1C1BA 3DYAA 1IKYA 4IBNA 2WOMB 2HHTA 3PY8A 3LAMA 4ZPCA 4FXDA 1RDBA 3CDWA 4WZMA 1NK0A 3CDUA 3S9HA 5K14B 1RTJA 3QO9A 4WXOA 4EBCA 1DLOA 3S3NA 3T5LA 4RNNA 3O4NA 3OYGA 3C6UA 4DU1A 1S1UB 3AA4A 3DYAB 3NGYA 3T19A 1N6QB 3H4DA 3EYZA 3K59A 1QAJA 1A5XA 1J5OB 4YQWA 2YNFB 3VN5A 2IDOA 3HVTA 1S0OA 3GILA 4KHYA 3OHAA 3VA3A 5J2QA 4URGA 4J9PA 5CZ2A 3MEEA 1TGOA 2BDPA 2X74A 3VQ4A 2VG5B 4TXSA 3M8RA 2XGQA
chains in the Genus database with same CATH superfamily
4QBUA 1T3NA 1F5AA 2P9LA 1FVQA 3LL3A 5IWAK 4NLVA 5IQQA 3TUJC 2ZH7A 4LD0A 5HRNA 1KTQA 4CO0A 4KPCA 1MMNA 3IAM9 1T9YA 3BBFA 3CC4N 4KHMA 3OBWA 4Y1CA 4DPXA 3L9ZA 5F0UA 1CJTB 1TK0A 3RRKA 4J9QA 5HBMA 4DR6K 3UD5A 5AQYA 1S4EA 4B3TF 2QSFA 3SDEA 4OX9F 1GXTA 4EBEA 4QIVA 3UDCA 1RP5A 3BPDA 1H74A 3O3FA 1ZM4A 2VGMA 2HLUA 3OQ2A 2FJEB 3TX0A 3GL1A 2Q6CA 1RT2A 3Q7CA 2ASLA 4FLZA 2M52A 4IFYA 2I9SA 4BC4A 1S1XB 2YNHA 3HFKA 4BC5A 2BACA 2D0PA 1RAOA 3X3UA 5KQ8A 2HBKA 3SBTA 5LXYA 2CQCA 4BRDA 2B6AA 1NGJA 1U25A 3UNGC 1RU2A 1X9SA 1V4TA 4M3TA 3D2FB 2FBXA 3RJMB 3EDQB 2XO7A 4OGEA 3DLGA 4UQTA 3ULEB 1F3FA 3NMUA 4CLFA 5DO2A 4UF4A 5A8WA 4CF2A 3I96A 3C6AA 3SAHA 2HS4A 3CDBA 1JNZB 1CBKA 3ZSRA 2ZOFA 3ENVA 2E88A 5KQDA 2HAFA 3J80O 1VR6A 4IZ9A 4DR7F 1G3OA 3NNAA 1O6XA 1SH0A 4OIXA 5D78A 2J5AA 3EVMA 1U2RA 2J7UA 2BTFA 1TELA 3EKUA 3RG6A 3OR1B 3BGUA 2FB0A 4K5SA 3BF1A 5FROA 4LRFA 1DZ5A 3VTHA 2XZWA 3V6JA 4JI6F 1K8AT 4RJVA 3SPYA 1Q79A 4WP8A 1TP7A 4WYWA 4ZOSA 1SAZA 2V50A 4JI7J 4CM2A 2GMLA 2DEJA 2M9KA 5D4OA 2D3OR 4WFNQ 1VSFA 1FXRA 3AOAA 4BR4A 2FSNA 4DTJA 2Z0GA 4ICLA 2PE8A 4LF5K 2ZH4A 2ADCA 1NK7A 3CVKA 2VDIA 5KG4A 4ERDA 2JC0A 3KD1E 2N7YA 4AFFA 1KVJA 3VOVA 1KVKA 3AVGA 5L1LA 3MWTA 1RT4A 1NKBA 2OTLS 5DG7A 4J90A 3R6GB 5KFKA 4FJMA 4M3YA 2JZ5A 4RNMA 5KRTA 1I6JA 3NXZA 2X1FA 9ATCB 2NUHA 3T41A 5L9XA 1GX5A 2O8CA 4ZPDA 5HN0A 3CCQS 4H4OA 3ILJA 1I39A 4QWDA 2YWFA 3K2PA 4NYFA 4F4YA 1ZBHA 2EXUA 1TAQA 4O23A 1N33J 2E5HA 4IOAQ 3SMPA 3QT6A 2MGZA 4MK9A 1QAYA 1VYAA 4WKRA 3QGIA 2Y1JA 4BRMA 1WSHA 3IXQA 4QR1A 1RWUA 1RXOB 4U7UD 3MWBA 1S5JA 3ET6B 4ELUA 3MCAB 1YG0A 3THYA 4H5VA 1S9EA 1OYDA 2DPJA 4AHRA 5JICA 4U67L 1RT2B 2ERRA 4WZQA 3F0NA 5GVQA 2QRRA 5DLFA 3BEGB 3THWB 4LRBA 4DR5K 3VQ7A 3A5NC 4F0MA 4DTOA 1KVCA 2QXLA 4DL6A 3QT8A 2XYGB 4YDXA 4WBFA 4BRKA 4DV7J 3CMES 2UV8G 2HHHK 2FJWA 5C2DA 2QWMA 3W9JA 1HHQA 4DX6A 2DY4A 1DLOB 4PABA 1JLEB 2E29A 3FZ2A 2HFVA 4X4OA 3MMVA 1XBWA 4YY3J 3WEEB 1N5TA 2I1RA 2RD5C 4FPRA 5J2NA 1BDGA 1FTCA 4LIWA 3MWPA 5A8RB 1UVLA 4YORA 3IS9A 1ICEB 4QIGA 1YUWA 3ZTQA 1T9VA 3MHYA 2OTJS 3ISNC 4QWAA 3V1RA 4J9UE 4KHWA 1IKVA 3DOKA 1QUVA 4C8KA 3NS7B 4FNHA 2OZMA 4KE5A 4DL2A 1S99A 5FIIA 3IKMA 2DH8A 2WTFA 3MD1A 1FVSA 1XHZA 1DBDA 3J7YI 3CJAA 2D0OA 3H25A 3FE1A 5H1SQ 2FSKA 4M3WA 4LBPA 4JI5F 3HULA 1ZBFA 3QLHB 1BXNA 2NUUG 2J0WA 4OO1J 4C1NK 3JAMY 3BSNA 3PIOQ 3V2UC 3CI5A 4W98A 2EBGA 1ZXOA 3F2KA 5KFNA 2E2PA 5C0YA 3I0RB 2J7KA 4JKFA 3C6TA 5KFLA 3SI8A 2L08A 1RK8A 2GVDA 1KWMA 2R7OA 1QUPA 2BOPA 2EC2A 4FYDA 2B5JA 4U8YA 2DGSA 4W5NA 2Y1LB 2ZUAA 2FD2A 4M5IA 2ZZMA 1RTHB 3ZZPA 3MCSA 1PGZA 2IJRA 1EP4B 5EX5A 4O0JA 3VF2A 2EPIA 1OPIA 2YQ1A 3FQKA 4M5LA 5KFDA 4ES1A 3M8PB 4O3OA 1EX4A 4DN9A 3BS9A 4OZ1A 2YXLA 1D4XA 1DJ0A 3ZFVA 4QPTA 1ZZNA 4NLYA 2E1RA 3CCJS 4AL5A 4TYAA 4A47A 2ZBPA 2DITA 1GOBA 3H4BA 4OX7A 1LOUA 3O4QA 1WJ9A 4F7VA 1RAAB 4PAAA 3ZEUA 2QWLA 1DURA 3CTRA 3CHWA 1TFWA 3I5AA 4AM7A 2HKEA 4C98A 2ZNZA 2MEWA 4CH0S 3IN5A 1LQ9A 3DI6A 4HACA 3D6HB 5K8MA 5BJRA 4CESA 4ZMMA 4RWXA 4K2JA 3V5RA 4CZLA 4OKEA 2X6SA 2X51A 2MPUA 1PCAA 2MTLA 3DMJB 3R8EA 4EK2A 4Z94A 2X7IA 2Q66A 2O1PA 5GAGI 2KVQE 2VIHA 4BQZA 4I2PA 2QKBA 2OH2A 1TUYA 3VERA 1FT8A 3TX8A 4TU7A 1WC1A 1WSVA 3LW5C 4GKJF 2E6LA 3PKYA 1UVMA 2DGTA 4BC2A 2CJYB 1U8SA 5DG8A 5E3QA 2RUSA 4B3OA 4GRSA 2CZVC 2CH6A 1D5AA 3NWGA 3DDKA 3THWA 3MN9A 1XUPO 1VQKS 4DUZK 3P31A 2MB0B 4IQXA 2WBMA 2V2VA 1RJJA 2HVEA 3HKZD 1OH7A 1N5YB 5HI7A 3BGFA 5KFWA 1D9DA 1J27A 1VQ6S 5AQMA 3Q2TC 4ZVOB 4U95A 1VBYA 3ISND 1NGDA 4A5BA 1W9HA 3RBEA 1YITN 3OFFA 4PWDA 3AO5A 2R2UA 2QLJB 3IM8A 4NYNA 1OWXA 3U7JA 2CNLB 1Q81O 1NUEA 4X66K 3IA0A 3KLVA 1YVUA 2FBYA 1NOZA 4XEIA 4JI1J 4BRLA 2WFBA 3NS5A 3FK4A 4KRFA 4OJHA 4RUHA 5IT9Y 3I9ZA 1BI4A 1Y5LB 1G1XA 2GGPB 4X66J 4BVOA 2O66A 3M6VA 1CJVB 4BDYA 4PRFA 4FJJA 2ZWOA 4DUTA 5AE1A 4NZ7A 3MAQA 4C1NI 1QQNA 2VGNA 3AVFA 2W2MP 4PWUA 2IHR1 2P9IB 3P3DA 4BE1A 3OBYA 3RUBL 5IT9U 1CLQA 2FC9A 1FWKA 5BR8F 2HBMA 2HBLA 4Q2MA 4TU9A 4IQMA 3O9QA 3CJCA 4EMDA 1DRZA 3M2VA 1RNHA 3UVJA 1HNZK 1UVIA 4HTIA 4AQYK 3AA9A 3HKWA 4L8RB 4QOTA 3LH2S 2YH0A 4JP8A 1B3TA 1YZ6A 4A62A 3QB0A 4GO5X 1H2VZ 1ZBSA 3QICA 4AYBD 3GCXP 2KO1A 4JUZA 4MMOA 4XDCA 2LMIA 1WHXA 2P9LB 1HBMB 2G0CA 4FJ7A 1FDAA 3HZGA 3SV4A 4DTSA 1VQSA 3VEWA 2GV1A 5BREA 3AJ1A 4PUOB 3OYHA 3CC4S 2UUAK 4HKQA 3L6QA 1KAXA 2GIFA 2EX3A 2I7NA 2QTDA 4AH9A 4M63A 4FZYA 3CCEN 5K20B 4M5KA 5I3UB 3AO4A 2P9NB 3MTKA 4OZNA 3ZSQA 1Q82O 4HTUA 1ZTWA 2KHCA 2ZJQQ 3KMQA 4I9QA 3QT7A 5AJ3K 1BUXA 5MAOA 5HK4A 1VSHA 1YBAA 2EG1A 3DXBA 1UW9A 2IAJB 1BQNA 1HBNB 4JLHA 2K1RB 4AILC 4WIIA 3GV7B 3HHLD 3FFIB 3KTQA 4O4RA 3D6FB 1GNKA 3BUZB 4H0YB 3TZYA 2J4RA 2XMUA 3RGIA 2QFIA 1SV5B 2W9BA 3AA2A 4IH6A 4FZVA 3QFPA 1BGXT 1U1LA 4LFCJ 2KHOA 2B4PA 3MEKA 2Q1NA 1HJOA 2R9LA 2EG2A 5FLXO 4FVMA 4IRKA 1XMQK 1B0TA 2Q0UA 1WKJA 4DFPA 4V1Ak 1X7VA 2RUGA 4CF0A 3HVTB 3ENAA 3VQSA 4KHQA 2NUBA 2VODA 4DF8A 4IR9A 2Q0RA 2YKMB 3A5LC 1NGFA 5CAAA 2UXBK 3SQGB 3QJJA 1VHXA 3PYEA 2AP1A 1SC3B 3IDHA 4GW6A 4FWQA 3HYFA 3V6HA 4C3MA 1DY3A 4JI2K 4XO0A 3OLAA 3SV3A 4DR6J 2PDAA 4CEQA 4F9OA 4F0KA 3DHWC 5AZJA 5M1KA 3A8KA 3OTCA 4NA3A 2FLNA 1E6YB 4GVEA 2V69A 3PM9A 3KWGA 3ZNUA 1YZ7A 1N32J 1SC6A 1QSLA 3CJ3A 4DQIA 5RUBA 4Z4FA 4A8KA 5I3PA 4F26A 5J1NA 3CFRA 2B5JB 3T1YF 4IOCQ 3MUTP 5DQGA 4Q5VA 2JC1A 2FHKA 2O3DA 5F8HA 4OJRA 1RQ0A 3UVJB 2ZJRQ 4FZXC 3OVAA 4C7QA 4NCGB 1F6TA 2FGCA 3TABA 3JSRA 3O6WA 2E1YA 4H0OA 5DLGA 1N8RO 3T1HK 4M5DB 3BGLA 1BQMA 1QAIA 1PG5B 4DHYA 2IMOA 1C0MA 2IMWP 1B0VA 1HUXA 5FPDA 4OZ0A 4ECTA 3UPFA 5LJ3Y 3GJQB 2MXYA 5ITHA 3BPSP 1U45A 2NQPA 2D74B 2CAJA 3OYMA 1P27B 2ZBIA 1ZBLA 3CPWR 3T9ZA 3H5YA 4CRJA 1IV0A 1V5VA 3U3GA 1YHQN 2GJ2A 4ZN3A 3PFEA 4ENOA 3JQKA 2PMWA 1VCTA 1TL3A 3GE1A 2NRZA 3I31A 4R0EA 3SSRA 3CCLS 2WW4A 3EVWA 2GUPA 3BGRA 5GAGP 2V2KA 1PC5A 2C2OB 1HNWK 3U02A 3VAHA 4M3ZA 2IJFA 4NLSA 4B3RK 1CLFA 1LAWA 2FTRA 2O8DB 2RF2B 2JL9A 3EE3A 3WIVA 1UL3A 4YDUC 1Y9OA 2XMTA 1TKTA 3FRYA 2YX4A 4OX8A 3A3OB 2OKQA 5E3PA 1P8GA 5EWFA 5FPNA 3ZYYX 2P9PA 3QBXA 4YB6A 5B0CA 1I94J 3ET6A 4FWRA 2GX8A 3HHLC 3HVRA 2RKIA 2NXJA 4KV8A 3EJMA 2FVPA 2B9XA 1KHVA 2HHXA 2Z4PA 2G2YA 2XI2A 4DR2F 5BPNA 1HKCA 1MWMA 4BVPA 1JXVA 2Q2RA 4X62K 2HVHA 1RBSA 3K5MA 3W2VA 3K5PA 3O9UA 2ADBA 2HAIA 1HMVB 1ZYQA 1RFQA 1LW2B 1VDHA 1H98A 3CMAN 3GIKA 3MXHP 1C2PA 3QNNA 2G8KA 4G6VB 1G15A 3PYGA 1RWNB 2NSCA 2V4RA 4CLWA 2Y3YA 3O5TB 4CO4A 4J2BA 3GG0A 3Q23A 3SMSA 2C22A 4NYPA 4I69A 1UEKA 2B7BB 4ZHRA 3JSMA 3OYDA 2W01A 1YSJA 3CCES 5JXSA 3C8YA 3B6BA 2A3JA 1XMOJ 4FLVA 2GO8A 2LU2A 3G86A 3DHXA 2COLA 5BYSA 1GOAA 1BY9A 2MGZB 4ED2A 3RU0A 2BUPA 1Y64A 1NKCA 3ZC4A 3ITHA 1D0EA 1VISA 2HEKA 3PXGa 2JDJA 2N82B 5CYJA 3AOBA 4DV4J 1UMJA 3S41A 4USJC 2R8HA 3KLIA 3W8PA 1Y00A 3OYJA 2FYXA 4JD2A 4L76A 4OZ5A 5EVZA 2FJXA 1REGX 5BRDA 3KG1A 4E0DA 5KFPA 2VOPA 3NCQA 4DV3F 3ZT1A 1URRA 3QIOA 3HVWA 2Z2ZA 4KH6A 3E2EA 4CJKA 2KW4A 1RHJB 3AAWB 4ECXA 4DCPB 3SAFA 3G9CA 1EWRA 4OPJA 2ZVSA 2FHJD 2Y1IA 1Y0HA 4ZLLA 1X4EA 4CFDA 3TA0A 4CJ3A 3LO3A 4RW4A 3HT3A 4K4VA 5ETQA 2EEYA 4DX7A 2E1ZA 3RAXA 3KNAA 2Z56B 5GAHP 1S76D 3KLFB 2Y9HA 4DTPA 2OPSB 3H40A 4WK3A 3VVTA 1WF2A 3R27A 4ED6A 3TQ1A 1QJHA 4ZA1A 3OJUA 1FW6A 2D3UA 1N34F 4Z37A 3N4WA 1KXPA 4IEIA 2H5EA 4J2EA 4ZVUB 3BSOA 4H5TA 1V3ZA 3SQ0A 2ACYA 1S1VB 2Z58B 2XHBA 2KI2A 5LL6d 3CO0P 3AY0A 2K8GA 3VQ5A 2N4CA 3VEYA 3NNHA 1WTBA 3MCMA 5D4LA 4ZP8A 2P5GA 2HNYB 3NF6A 1TK8A 1N32K 1X31C 5M1NA 4K43A 1ZPWX 2AF6A 2OSQA 3BZKA 4K41A 4R25A 2DNKA 5A8KA 1X8DA 3K7RA 3J81j 1JLAA 1RBRA 3FJ2A 3QPIA 1URNA 3AVNA 4WF9Q 5BRFA 1RE1B 3RYLA 2RU9A 4MLHA 2ZWHA 2NYIA 3K9KA 2Q6BA 2Q97A 3DM2A 4DUZJ 3HHDA 2ZBRA 3QFHA 1RBAA 2IS3A 1BWEA 1FRJA 3M6XA 2KT3A 2WC9A 4CFBA 5CABA 1KSPA 4GV6A 4HTJA 2GW8A 3G6EN 2ZJRL 2NRTA 4O5FA 1SKRA 1YJ7A 4DXLA 3TAMB 4C0BA 2QC3A 3FEZA 1RT7A 4CTAA 3VALA 5AQTA 4ED4A 3QINA 2WB1D 4N56A 2QWRA 5KFCA 1UVKA 3NOGA 2C2EA 1HR0K 2BA9A 3O9RA 3DRRA 2NLXA 1LXJA 3ZTSA 4DR3J 3TAPA 4ATNA 4ES2A 3F44A 1VQLN 2OHDA 2P1JA 2IM2A 4K4TA 4OYZA 4B08A 1KLMB 1EETB 3MPYA 3WDOA 5HRRA 4X65F 1GLEG 2WZ1A 3CXCM 3A3NB 3I56N 1YAGA 2PFUA 4URQU 1YIJN 1WEXA 2HNZB 4LF4J 4KIAA 3TI0A 2M8HA 1CJKB 4C3LA 2VQEK 3PW4A 2F3JA 4CQ1A 2HK2A 5AQJA 2GHVC 2PYLA 3S01A 4ED0A 4FYYB 3PW2A 4OX6A 3BP8A 2HHPA 2CWKA 4JK8A 2XLKA 1REVB 2F8HA 1FRMA 2FUG9 1XQSC 5CZ1A 3BJYA 4PR6A 2VUGA 1UPPA 5L1KA 8AT1B 3AV9A 3QMQA 5AQIA 1Q8IA 1FKOB 4CCHA 3B8HA 2YX1A 4KQZA 3D0HE 2R7UA 2QWQA 1VSIA 3RMBA 4NLQA 2IVOA 5FLXU 4AQYJ 1KS2A 2ZC3A 4DOZA 2GFFA 4ECUA 2APOA 3OHRA 3R5JB 4HH1A 3M2RA 3H08A 1PJ6A 3O3LA 2X3GA 2XY8A 3QRRA 3LP2A 5C5JA 5DGAA 1NCLA 2ZH9A 1VQOS 4M5DA 4PPZA 2NRWA 1PKUA 4K7QA 4FYVB 4NEYA 4YOTA 1RYRA 2JEIA 2B8PA 3ENHA 4HEA9 4H4MB 2GIQA 4LSNA 1LNQA 3EPGA 2M2BA 4OJ3A 2KZZA 4ISFA 3OS2A 4NYOA 4LT6A 1TR0A 1KN6A 3ZT2A 2BH1A 1YQHA 2XI3A 3CCTA 4KAZA 2GJFA 3S3MA 3J7AP 4FVCA 1HKAA 1Z2ZA 3E9LA 4WFBQ 4JAXA 1PYSB 3DXSX 1WDDA 3T9NA 5AR0A 2RPIA 3O08A 2BE9B 1C1BB 2BW2A 1NRKA 5H9EK 3SMZA 5HP1B 3HCXA 2FHJA 3JSMB 3NF7A 4B3SJ 4MKYA 4F4AA 1GFWB 2UU9F 1IKVB 3ZXWA 2WVCA 4X4NA 5T7LB 1JLQB 2BJ1A 4EYHB 1SVDA 3T6BA 2YWKA 3D6MB 3M9MB 1BU6O 4RUAA 1S6QA 1T95A 3N4PA 2E7XA 2MQ8A 4E7JA 5DDQC 4JEPA 2FIUA 1TUUA 3FMBA 1JNRB 6FD1A 3CCQN 1JCFA 1MU2A 5C7PA 1UJ5A 2RDDA 5H9FK 2CVEA 4ZVFA 1IBCB 5J2QB 2XNQA 1Q8BA 1W25A 2GVDB 2KM8B 4FNIA 1HNXF 3T1YK 3NBPB 5CYMA 2W40A 4B9NA 2ZNYA 4UZBA 5IM0B 3JYTA 4OV6A 1TL5A 4ZDNA 2MQPA 2X3DA 2PYJA 3PJWA 4Q0BB 2VA3A 1IQZA 3NE6A 2OD6A 1WELA 4ECRA 4USVA 4U7UK 2A3ZA 1BQNB 4DTRA 2D3O1 4GVLA 1RT5B 1DTTB 4ZJLA 2QM1A 2BR0A 4CEDA 2JEFA 1YGYA 3H20A 5ETOA 5KPZA 2RDJA 1QHTA 1U6ZA 2DHXA 4ZPBA 3DOLB 1QHAA 2RNEA 1IWAA 4R5PB 4YR2A 2DHSA 1M5KC 3C14A 1XJWB 1TKDA 3NLCA 4P74A 4M8LA 3SQ1A 3QBWA 4JB8B 4B1WB 1YJUA 1RKJA 2V4JB 4YHHF 5J2NB 2M5YA 3ZT3A 2O8FA 3I56S 2IC3B 2MKHA 5GAGU 1XTZA 1K1SA 5TKWA 3R2CJ 4FLYA 1RBTA 2YV0X 2GCFA 3R3LA 2IRYA 1F2GA 4O3PA 3K5NA 1VQLS 2Z2MA 1R0AA 5AQVA 4O44A 2E9TA 3VETA 3CCJN 2ASPA 3T5JA 4U6PA 4FW2A 2WSCC 1YJRA 4H4MA 3OHBA 1RU1A 2CYYA 3E51A 3LF0A 3GWCA 4ED5A 4OVLA 4NWBA 2BQRA 1P90A 3VR1A 3UR3C 1EKSA 3KDNA 1BIUA 1VBZA 4E98A 4G1QB 1RB0A 4LY7A 5KG7A 2GO9A 1R8BA 4J9SA 1ATRA 3CCRN 2RQKA 4X4UA 4BWMA 3M8WA 2D1KA 4OI1A 4IOAL 2JEJA 1TUGB 4RW7A 3BQ0A 1WN7A 1Z26A 4B3SF 6FDRA 3FSXA 4JI2J 2MLXA 1N33F 2Z2LA 4DWIA 5DETA 5DRKA 4KR0B 4ED3A 4NCGA 2DHGA 3KK2A 4PKIA 4LR8A 3NY0A 3ENOA 3DGPA 3FMWA 3WBZA 1WUAA 4FF1A 4WKYA 2V67A 1NK8A 2D3ZA 2JRSA 4KSEB 4ZVSB 1IQTA 3IBWA 3ETMA 3MR6A 1GLJO 2BGGA 1TVRA 1F3VA 2RQMA 4ID8A 4ZVRB 2XMVA 2R8GA 5D6GA 5C12A 3CCSN 1WTFA 1HYZA 1WBBA 4L72B 2CQ2A 2FGOA 5CY4A 1SJ4P 1VQ7N 3BF4A 3I6PA 2A42A 2GZOA 4FK2A 2YKQA 3H5UA 3MMCB 5KFQA 4QS9A 1GLAG 4I6MA 2UYTA 3MD3A 3VGMA 1HWLA 2XULA 1WSIA 3KK1B 3GV8B 1HWUA 4IRCA 2JOQA 1AZSB 2DY1A 2MHNA 3C15B 2GQ2A 2VQFK 3IGNA 2OJ3A 3ILIA 5ETSA 1RTJA 1UCNA 1W7WA 2MKSA 3C6HA 4CW7B 4BHQA 2WTUA 3Q83A 3DYAB 2ATCB 3NGYA 3CT9A 3H4DA 1OQ3A 2CPEA 3K59A 1DHMA 2YNFB 1JB0C 5DZ6A 1S0OA 3C7NA 4HH0A 3MCPA 1H38A 1YX2A 1ILYA 2V5HG 1BWFO 4KHYA 2DKOB 4J9PA 5CZ2A 4OHZA 2L3MA 4KH5A 2X74A 3Q0AA 1F60B 3TZXA 3SSQA 2MLZA 2KT2A 2V7YA 3HM9A 1IKXA 3GE9A 1O13A 1VQON 5LM7E 3BDPA 2L48A 4ILHA 4DV1K 2DTUA 1K8AO 2VJUA 2A6AA 2G8UA 2ZD1B 4J2DA 3IM9A 1B99A 3B4MA 3IR5B 1Q8KA 2DVIA 1RDDA 1KQSM 3BY5A 1QDUB 9RUBA 2RILA 4A8MP 4FJXA 5JS1A 3OJSA 1M0SA 3L2QA 4KTWA 3BF3A 5EX0A 2LP4A 4YN3B 3OYFA 5KFUA 3N6NA 4CJLA 4E7KA 2OIHA 1WC6A 4CJFA 4K4WA 1UKUA 2XHWA 4Z2XA 1Q7YO 2OEKA 2IYGA 3M2UA 1VAZA 3TR8A 4B1UB 1JK9B 4L75A 2OANA 5F8LA 3E01A 2VFRA 4KB1A 3OYAA 5F1XA 1U4BA 4P9SA 3I4HX 3W5XA 1KD1O 5DDRC 3Q2SC 2HIYA 4NXNK 4IG0B 2KTQA 1L3VA 1KRPA 4Y0FA 3AODA 4CEZA 1TV6B 1WAFA 2DFFA 1N88A 1IBMK 2B9YA 3CQXA 2DNHA 1DQ8A 4EBDA 3SUOA 4H5RA 3LM9A 4PWDB 3BQ1A 5A0YB 3PW7A 3WNHA 4S0MA 2V0NA 1LXNA 3UDLA 1KC8O 3IWLA 4GVBB 4IFYB 3L3VA 1SBRA 1UEUA 2F8SA 3LDLA 4J9VA 3KUGA 2MY7A 3HI9A 4YB5A 4A8QA 4ZPWR 3QFWA 3HZEA 2HG4A 3DOMA 2G1DA 4Y34A 2OPQA 4HDGA 2M8DB 3AA3A 1N33K 3GMGA 3R2DJ 4Z4EA 4OYBA 2CJAA 2RJZA 1LK7A 4A2AA 3RMAA 2NRRA 4M7XA 4OV1A 3MM6A 3PVXA 1GQEA 3NGSA 4X4SA 1NOYA 3W8GA 2L41A 3E3XA 1WUUA 4OHYA 4W92B 4ED8A 3WC0A 3WXMB 2J6UA 4QW8A 4UUXA 3UR0A 2IFXA 3CB4A 3UWTA 3LP3A 3PW5A 1N5SA 2KXHA 5T41A 4BRCA 4BWJA 5EXWA 3MR5A 1E4FT 4LJMA 4P72A 3PO4A 2FSJA 1RZMA 4M42A 3QAEA 2R7YA 1HBUA 2G4BA 2DR6A 2DEIA 1U48A 1UPMB 1K9MT 3C2PA 3DRXA 1JLFA 4FS2A 4Z4IA 3DOLA 1SIWB 2NRHA 3ZX2A 2ZH6A 1XIQA 2C2RA 1L3UA 2A0FB 3VAFA 2AD9A 3CJ4A 2W4DA 2DGVA 4C0HA 3TNVA 3PIOL 4DCOB 4CERA 2LKZA 2KH9A 3OVSA 3LP1A 1NBEB 5D3GB 2HS3A 4B9SA 4I2PB 5F3TA 4H4OB 1KCFA 5G4DA 2OI2A 3MEEB 1KP6A 1AYEA 1U26A 2D69A 4L73A 1NNDA 3GSIA 5KG0A 2BQ3A 2DH9A 4OJ1A 1Z25A 4I6AA 2VQEF 4TVAB 1FK9A 4GKJK 2DYAA 4ILJA 2DB1A 2J8SA 2HFZA 3IR7B 4DR5F 3LPYA 2D1CA 3MN6A 4ZIWA 4ZVGA 1R8AA 4RWWA 2P6TA 1S0VA 1EX8A 3ZT4A 2N7CA 3A8JA 3IFRA 1I94F 1MWZA 2NPIA 4ETXA 1CC7A 2QIFA 3CMQA 3D1HA 3VMFB 3TUZC 1LWXA 3UKUB 4EU0A 2DO4A 3C16A 3MK6A 2EFQA 1ZPVA 3H3OB 4E19A 3GLJA 4USKA 3OW2R 3VQPA 1OIAA 2CG8A 1XWLA 1F21A 3IWXA 3W1YC 1BQMB 4XDDA 4ZPVR 2BANA 3DKDA 3JS6A 3V9ZA 3KLHA 4A61A 5KGXA 3SJHA 2NNWA 4DS5A 2X1AA 4LBHA 3I0RA 4BR7A 3ENBA 3SCXA 2HNZA 4V19J 2MZTA 3A12A 4KH4A 5I3QA 2P9EA 1X60A 1DQ9A 1FNOA 3OL8A 2MZJA 4DCHA 1WI6A 3RB3A 3AFGA 4Z7CA 4LH5A 1TL7A 2WONB 4FK0A 3IRXB 4PQUB 3WXIA 5H9FJ 5B8HA 2QA2A 4RLEA 2CZ9A 2UZAA 4JNEA 2AW0A 4FM2A 3H1VX 1YI2N 4ETZA 4JV0A 2CNOB 2FY8A 5CCLA 3DLJA 5LL6Z 3TPQA 2XCAA 3AA8A 2IM1A 2V34A 2ZITA 3W7BA 3ULDA 5EX3A 2WVEA 2CQIA 5M1FA 1Y5NB 1RT6A 2EHGA 3AA5X 4JI1F 3CJ0A 1S0MA 1LV5A 3AXMA 4JI7K 1TL4A 4ID1A 4DR7K 5KT4A 5HP1A 1RLCL 4DPTA 2EVZA 4F04B 3UCGA 4A59A 3D1OA 4RUBA 4YNQA 4B3MJ 3V1OA 2GA7A 4ZLNA 4QS8A 3VQTA 3ETOA 1B7FA 1SV5A 2WW8A 5JJBA 1K1QA 3MFIA 2R7WA 3AXKA 3BO3A 4X64J 1RYSA 2LCWA 1RILA 2W6LA 1KOOA 1OO0B 4B3MK 1JJ4A 2PO4A 1KC8T 2AJ2A 4Y00A 2AT1B 2YPYA 1CC8A 4RR5A 1MWYA 5LXRA 3H46O 1NMDA 4CM0A 4WFYA 1WBDA 4PPDA 2ROEA 4KB7A 1L5UA 4FBUA 3PUFA 3OLBA 3PR5B 4DV5J 1QQOA 1UFKA 5LT5A 3NGRA 4CZCA 4YOWA 3TR5A 4X64F 2XGPA 1VSKA 3PDNA 2B6AB 2D0CA 2HFNA 1EB0A 4EFAC 3M2UB 1BD6A 1DT9A 3KK7A 2G1HA 4NLTA 2UXBJ 3DU6A 1X3MA 1F9EB 1OMSA 3F73A 1IKYB 2MKIA 2D4WA 2QO3A 3MN5A 2BJ3A 2IBOA 5KFFA 4ZJQA 1CXUA 2RIJA 2GWKA 3G6XA 1NSQA 4PL7A 4ICLB 3KHYA 3GTYX 4GKKF 4FDFA 3KWMA 3AY9A 3IUCA 2YTCA 4FF2A 2F8TA 1CJVA 1UETA 5M2PA 4RG8A 3WUHA 2U2FA 4DU4A 2DXFA 2CJQA 4KHNA 4Y2CA 1WEYA 3ZT0A 3G8TA 3VWSA 4DPYA 3QYYA 1HNIB 4K4ZA 4D3HA 4K59A 4JI0J 4ISGA 1QE1B 4XPEA 3R5GA 2HBRB 3CF5L 3OYBA 3EGZA 2HQFA 4X4VA 4ZHRB 5L9NA 4C8YA 4JRPA 1WSEA 4H54A 3HSTB 5C2GA 4OHVA 2R2SA 2PMHA 3W9IA 4YB7A 3NCRA 1PO6A 4XH1A 3QETA 1LK5A 1FDBA 4DV7F 2OGUA 3N9UC 1WSJA 3C7NB 4WYLA 4DMZA 3D0PA 4CLKA 4LVNP 1UA0A 4B9VA 5KT5A 1Y11A 5IXUA 1VRUB 2QWNA 4NLBA 1JLCA 5EHHA 3BGOP 4YDDB 2W8KA 3OSNA 1S4FA 4PG8A 4X65J 4BRGA 3C46A 4F02A 1VHIA 1T9TA 2YKNA 1BWVA 1T3VA 4RWTA 2UVRA 4FWPA 4BR2A 4AF1A 3U6FA 3JXUA 2IRUA 4Z4GA 4P2SA 2UXDK 3K8VA 3AVJA 5HROB 1HQEA 2VWBA 1HNWF 1RWXB 3P8BB 4G9ZA 5GINA 3DLHA 1NEEA 3MR2A 3T3FA 4CHZA 4DQ8A 5C2CA 1Z6RA 2XRIA 4ZVTB 4YMEA 1JLBA 1Z1ZA 4B9UA 4UT4A 4ELVA 1U6BA 1UVNA 4Y2MA 3EMTA 4F50A 4OYIA 3LPUA 3BSCA 2QWPA 4IRDA 3JAMO 2H9ZA 2UP1A 3AVKA 1FF2A 1HI0P 4FPIA 3IMQJ 3FEYB 2XM3A 2GX9A 3PEJA 5F9NA 4DQRA 4NA2A 1RT6B 4J8FA 4BDZA 4C8OA 3RRHA 1JJCB 1VS3A 3B78A 5HBMB 3W5YA 2BMBA 1RACB 1XMQJ 4JYAJ 2W6KA 1X4GA 3MM9B 1WG4A 3DRPA 3F56A 2P5VA 1RAJA 2D9OA 4QWBA 1XMOK 1VQKN 2E4LA 2IA6A 5TKYA 2VBXA 1NSPA 3J7ZT 1WSFA 2P9KB 3VA0A 2HHSA 4YOEA 4Z4HA 2DNLA 2VQEJ 3P4IA 2DR5A 2XSFA 1WEZA 2G2OA 4X84A 3I55S 2ZHAA 4JI4K 4OPKA 4WK1A 4DTXA 5ADZA 1RAIB 2YJEA 2YH1A 4LF8K 5A2QU 3R7BB 2M3DA 1BE4A 2GAHC 1GLFO 5BPLA 3UI3A 3KLHB 1TL1A 5GAEI 4NLGA 1EAYC 2IM3A 1APSA 3SNNA 1W26A 5AQZA 3DGVA 5SWMA 3E9PA 1HPZA 3H8YA 5K14A 3I4PA 5LMUJ 1N4LA 4ZCMA 5E2QA 5LJ5Y 1M1KT 3J81U 4KV8B 4I56A 4PA1A 3RB0A 4RBVA 3AO3A 3QEPA 1VQ9N 3DOKB 5FPMA 5DJBA 3V6DB 3CULA 1NB2A 4P2FA 3D3BJ 4BRHA 3BZCA 4FVUA 2WCXA 4WYBA 2QL7B 3O5BA 1WAJA 2PFFB 1HHSA 4HT7A 2DR8A 4DB3A 4J9OA 3GPAA 3K0JA 3WEEA 1T7PA 1NK4A 3PRDA 1WI8A 2GTDA 2VPZB 2RU3A 2WHOA 1NLKL 1RT5A 3CM6A 3UKRB 4IFVA 1UVJA 4FOIA 3EZWA 3UQSA 2CPHA 4ZP9A 4LF7K 2IRXA 2KFNA 3SEOA 4N76A 4KRWA 4DV1J 1XNQF 2RS8A 3PEHA 4DV3J 1GAOA 4JI8F 1NK5A 3JS9A 1IXKA 3IAS9 3PHTA 3OW2M 3CPWM 2D9PA 2VCPA 3T1YJ 2M4MA 4J9KA 1FDDA 5D77A 5KFEA 2QI2A 4CLPA 2DR9A 3IS9B 4CF1A 4W5RA 2YKNB 2Z1HA 2JHEA 5D0RA 3OA9A 3M6WA 4HUGA 3I55N 2QA4G 4EAHD 3OTEA 4DV4K 3RBZA 4TKTA 2K2PA 4X2BA 1Q86T 1TL1B 4LF8J 1HW9A 3GYGA 1RWMB 3VQEA 2RS2A 1L3KA 4OYAA 1JLCB 4YB1P 3POTB 1VRUA 4ZTJA 3T6JA 4DU8A 3U9DA 3H98A 2PN6A 1VQ8S 4O4GB 1JMTA 3FZLA 3V4IB 1YI2S 3ADAC 3R9LA 2QLXA 1PIEA 4DQSA 4DMNA 2BVZA 1NAQA 1H7XA 2B51A 2CJ9A 4CF8A 2ZH2A 2IY5B 1I1GA 3N4QA 1S9EB 4CJTA 5AQWA 1KAZA 4EZ6A 5HROA 3W61A 4WTYA 4ECYA 4OI6A 2G8FA 1XQIA 5ELZA 4V19X 4CZMA 5F8NA 1UAXA 4IUFA 1PC4A 2W2PP 2KLAA 4QWCA 4UQGA 3P38A 2J6SA 5HRPA 3CWJA 2UVWA 1X4DA 1ASVA 4JI2F 4NO7A 2E5IA 3CW2C 5E7OB 1S6OA 2NPFA 1S1TA 2DXDA 3VQBA 3NL0A 1KQGB 3H2LA 2UXBF 1N34J 1F2HA 3OXLA 3VEXA 4DF4A 3Q8UA 1M5SA 1SQKA 1N48A 3ICLA 4M5HA 5HQLA 5F8GA 2N3LA 1ATSA 4CO3A 4KGXB 5FDLB 1D09B 1XMQF 3OYLA 2FXUA 2W24A 3D2FA 4USUA 2G9OA 5A8WB 2LEBA 1VK8A 3GJTB 3BM7A 2MKCA 2AZ1A 2KRBA 2GJIA 1JLAB 2FZKB 3VAMA 1RABB 3CJ1A 1RBVA 1RHKB 1CS4A 2PAVA 4WFAL 3CJKB 5KFAA 4K8ZA 2ZM6K 4O44B 2V9WA 1A5VA 3CC2N 3M2RB 1T44A 4J5OA 5K9FA 3OVNA 4USIA 1UEVA 1XNRF 3EVOA 2RDIA 3KVGA 5AFUA 2XNRA 1NHUA 4RNHA 1S1TB 3PTWA 3S6EA 2HZVA 3G25A 3UO0A 2F7TA 2XSJB 1ZAXA 1G4CA 2BBEA 1VFJA 1CG2A 3ASMA 5GADI 3J7AN 4LR7A 4NXMK 1YIJS 3K2YA 1T6CA 1ZA2B 2DISA 3UD3P 4P71A 2NZTA 1LW0A 3L0QA 3ISZA 1T9XA 3JSYA 4UOFA 5AQRA 5KFJA 1RWOB 4K2XA 2E1CA 4UY8O 2V2QA 2KYXA 2CPYA 4G1QA 2KG1A 2HSTA 3HHLB 1OVYA 3P1GA 4AQYF 4EGLA 1SJQA 3L2UA 3Q24A 3TA1A 1MWKA 2MYFA 4A8XA 1ROFA 1U02A 4F2SA 3EZUA 1XNQJ 1B64A 2QYCA 1Q4RA 2HBYB 1ZS6A 2AX0A 1LKZA 1NM2A 3QEVA 3NG8A 1KHWA 1OPZA 2PI5A 4BLGA 5BR8K 2F63A 3OTOF 4LFBJ 3MM8A 4QW9A 2YNGB 1BCMA 5GIPA 4EUVA 2V52B 2IM0A 3FDSA 1ESVA 4JOUA 4JI4J 4WIQA 1IKWA 2NR0A 1HYSB 3RVCA 3M7VA 5D0EA 3J7Z5 1VQNN 5F8JA 3KK1A 2PMZD 1HARA 2G8IA 4MIAA 3TWZA 2DNQA 2OFGX 5HJXA 1X5SA 4KYZA 1EP4A 2NZCA 5K8NA 2HHUA 5CA5A 4C6AA 4LH4A 2HRYA 3FZBA 2DHHA 2PEHA 4LMZA 2MHEA 1UFLA 1GXLA 3RAQA 2PSZA 4JI3J 4BACA 4FSVA 2C3UA 3SIPB 5B0DA 1NHVA 4W5QA 4ED1A 1NDKA 1TVRB 1NGAA 4ER8A 4NLWA 4QIFA 3AT1B 1QQMA 3UKRA 1P1TA 3BDEA 4RW4B 1FEHA 1V3RA 1HA1A 4BC7A 3NKYA 3D2EA 3QLHA 3UIQA 4KGVB 3N5BA 3BEXA 3R6LB 4ZP6A 2KJWA 5KG1A 1HWJA 4LF1A 2G0JA 1HD1A 4K4YA 3QEIA 4F67A 3FCHA 2BANB 1ZC6A 3ID8A 5I42A 3L2RA 4U7BA 3IWNC 2OMLA 1C6VA 2GHPA 5U47A 4RW6B 3EZOA 2VFVA 1GMVA 1GTEA 2HHWA 4J37A 3UKUA 1S6PB 4IG3A 2CNKB 4N5SA 1FRHA 2BW7A 1Z2LA 2OCEA 1RI7A 4L3KA 3IFEA 1TKTB 1C4AA 1C0TA 3C6UB 3DXMA 4DLGA 4RW8A 1R27B 2B3TB 5GMEA 2KXFA 1MSWD 3RBDA 1IG9A 2E1PA 1OJ4A 4JV5K 3NDKA 5C42A 2UVUA 3HD1A 2E5LJ 1OSCA 4TLRA 2A6OA 2NRXA 4RNFA 5CXTA 4EP5A 1SIZA 4NZ0A 1UZHA 2QJ3A 3L95X 3AGKA 1ZH5A 3CJRA 2E9ZA 2BKNA 4XK8C 1ZOTA 3W3DA 2GWJA 1HW8A 4NI2B 4IXCA 1M5VC 5THWA 3PX0A 4WFAQ 4I6WA 2GAGC 2HGNA 3IAYA 1LFPA 3HRGA 1JLGB 3MMJA 2VONA 4U9RA 2E5LF 3VEZA 1WNSA 2R3VA 5J2PB 3H1QA 5HLFB 3CCLN 1BG3A 3ID6A 1NH7A 4R79A 1WKLA 1VJWA 2M88A 2YNGA 3MMBA 1R59O 4KB0A 1W97L 5AZIB 2J0XA 3BBBA 4G3IA 2XYPB 4QIWD 3O8WA 1NGBA 4KT0C 2VASA 3PG9A 1FEEA 2CGLA 2ATQA 4OL8A 3UN2A 4V19S 1FRIA 4DR5J 4C23A 2JWLA 5A2QO 3SFUA 4TU8A 2YI1A 2XZTB 3TW0A 3QFUA 2F65A 3HHLA 4IOCL 1RDRA 2F40A 5A0YA 5F0XA 5KT7A 2HNDA 3TA2A 3CMAS 4NB4A 3IGVA 2IYIA 3RSEB 2R2RA 2RT3A 5LSLA 3GP9A 4YY3F 2OA8A 3HSDA 3OS1A 4JKDA 1XI1A 4LF5J 1TV6A 2AV5A 4GO7X 1QZ6A 3G6VA 4I9LA 3CCMN 5D4PA 2DRBA 3JTPA 4ANEA 3OR2B 3MM8B 5KFMA 5T7LA 5HAOA 3W64A 4UW2A 3K58A 2IVYA 3SK3A 3FGVA 3WX8A 2YNIA 2UUCF 5ETTA 4OGCA 1VQNS 2R2TA 3RMCA 2O4IA 4DUYK 4JV1A 4DPOA 1E6VB 4FJKA 4PCQA 2GQQA 1DFDA 4X64K 3W62A 3IC1A 2QK9A 2I6WA 1I51B 2O5DA 5BN9A 4LF6K 4IOBA 1KQSR 3EDRB 1NGIA 3V9UA 2MKYA 3WT0A 1CJUB 2YQ3A 2JLGA 3EGWB 2VYPA 3OYIA 1KBRA 4IO9L 1Q9XA 2YWEA 5KG2A 3LDNA 4AT1B 2BRKA 2C2ZB 4JN4A 3M30A 2ZBQA 4WCEQ 3LGHA 4CZIA 5ETVA 3U1NA 2VBWA 3H7HB 3U8XA 3K0SA 3DN9A 2F1FA 5L1JA 4HHHA 1T03A 3M2VB 1N54B 3VGKA 1YRXA 3TANA 5JS2A 5J2MB 1BOTO 4IO8A 3PLAA 3KXDA 5LMNF 1GXUA 4JI7F 1ITPA 1GT8A 4BGAA 1HI1A 2FVCA 4JI1K 4DL7A 4E2FB 3VPZA 4J9MA 2MQOA 2UUWA 3I87A 4JKBA 2R42A 5M1PA 4F4KA 1U47A 3V4MA 4BGBA 4X4PA 4HUEA 4PUOA 4M41A 3GYNA 2WSEC 1S97A 5E3RA 2F96A 2FJVA 1RHUB 3FVYA 1RDAA 1RLDA 4NX9A 3JXOA 3ALYA 3CFOA 4YHHJ 4YR3A 2AA4A 4BCAA 3IBCB 2ZM6J 3HVAA 3FCWA 4OFZA 2YX6A 3TVYA 2Q3PA 1H1VA 2ZE2B 1VRQC 2HNDB 2ALZA 3D45A 1NJIT 2ZE2A 2AJFE 4CI0B 2HMIB 4OLBA 2DRAA 5E26A 3KLGA 1DAXA 2J9CA 5KPTA 4K8RA 4B1YB 3MMAB 3TAMA 4WQ5A 4DV0F 3QEWA 1DTQA 3V6KA 2E5LK 2XS2A 1SZ2A 4LRAA 1VC0A 1FXDA 1HWIA 3HL8A 3RB6A 3MUMP 4NCBA 2CH5A 2ZZTA 2KVIA 1BA1A 3CF5Q 3QSYB 3HP6A 2HIQA 3DAWA 4WCEL 3OTOJ 4B17A 1SXLA 4AXIA 4GKKJ 2V51B 3E8OA 5JVGL 1R8HA 4JI3K 5B0AA 2EWHA 2QLFB 5HQMA 2ZUGA 4USWA 5ETKA 2HWHA 5DG9A 3Q8PB 4NLOA 1VQ4N 3HSCA 3EXCX 1T0TV 2JLFA 2HQ3A 3GQCA 3CERA 1I94K 2Z30B 4OYMA 3US5A 1S72N 3H6EA 4DUYJ 2GQCA 5LY3A 2WBRA 5CR4A 4Q45A 2CJBA 2BJDA 3K5OA 4IBNA 3LAMA 2ZGZA 3U9ZA 4ZPCA 2AP6A 1NK0A 4WZMA 1IWGA 3ELHA 1X4BA 2HWTA 3T5LA 3O4NA 3C6UA 4DU1A 2K3IA 1N6QB 5AZIA 1Y4ZB 2DNMA 1A5XA 4YQWA 3P5TL 4CZJA 3GILA 3VA3A 4PG7A 1VQ7S 4URGA 4OX9K 4WFNL 3MEEA 1TGOA 1J5EK 4MKVA 4RL1A 1VHFA 4DR6F 2CJXB 3BH6B 1OH5A 3CCSS 4IDHA 2XGQA 4HWIA 4I6MB 3VGLA 1IN0A 2B9EA 3E1YA 2H65B 3DWLA 1H3DA 3PJ9A 4YUDA 1OS5A 4CLLA 1SPBP 3N79A 3OUYB 5FLXY 1WD6A 1XNRK 2N3OA 2A40A 3GFZA 2PBDA 1FRKA 5KAKA 3BO4A 2CPIA 3OY9A 3KLFA 3MECB 2P9SB 2NRVA 5AQLA 3CM5A 1FFWB 1UZDA 1G7CB 2ZM6F 2W2NP 1KKHA 5LMUK 1JL1A 5B0GA 1WSGA 4NLXA 3MXMA 3VGVA 3G10A 4JK7A 3GR1A 2PA3A 3VQ8A 2Q3SA 1TK5A 2ZH1A 5FJ4A 2XG8A 2EFPA 1TUWA 3HI0A 2QXFA 2FJAB 4Q44A 1S6PA 1A7GE 5DM6L 3DLKA 4DV2K 2V9KA 4WXWA 4YOXA 3UNYA 2ILYA 3MPDA 1IKWB 2WAQD 4MT1A 1O5JA 1EWQA 5I42B 3O6QA 2UXCJ 2DFHA 2OUGA 4HL9A 3HBTA 2EC0A 3GIMA 2EBEA 3KHRA 3I32A 3BB5A 4MQ3A 3EM1A 5D3GA 3NFAA 3A4TA 3OR2A 1VQ6N 1X4CA 1VSDA 1IM4A 2P2CB 1VK3A 3CYMA 4ZTFA 3ZZ0A 3TEGA 4NLUA 1YLXA 4ZJOA 3A2FA 1YRTA 3NF8A 2VA2A 1K73O 4KKOA 4E8UA 4CGHA 4CDIA 3NVKA 4CJVA 1QSSA 4O3NA 2ZKTA 3D7EO 2WBNA 1YJ9S 2HVZA 4ZVQB 4NXNF 4E1JA 2VJVA 1KEKA 4I2QA 2BJ7A 1MW7A 1SUQB 5A2QY 4TQRA 4CJSA 2HQDA 2BJ8A 3ENWA 2AGOA 5AQXA 1NJWA 4LF9F 4CNZA 4EZ9A 1LW0B 2RRNA 1NK6A 1Y7PA 4HI2A 3LPTA 3CNQP 3PX4A 3A13A 4U67Q 4LSNB 1OY6A 4CH7A 4PG4A 1A9NB 3EUNA 2QMUB 2PT0A 1E6YA 4QYZK 4A8YA 4WQ4C 1ZM3A 5KFYA 4IKFA 1J2VA 1B9FA 1N36F 4M94A 4NLDA 4NEZA 4KHSA 1WACA 1WORA 1R89A 2D41A 3QGHA 3ZZRA 5GMKa 5B0FA 4MLEA 4CJUA 5CE3A 4ISEA 1S0NA 2ZDOA 4LF9K 3CJ5A 4GVBA 4KGZB 4DV1F 4XIUA 4DL5A 4KKOB 2V8DA 1BIZA 2HFUA 4JI8J 3GFHA 3PR4A 1B4SA 4QQBA 1T9UA 5BYRA 3VESA 1NWKA 4CZEA 2YKPA 1FJEB 1X5TA 3CCUS 2BEFA 1JJ2M 4JYAF 4ID5A 4AL6A 1IBLJ 3TSUA 2VF3A 3LWMA 3EN9A 4JHDB 1Z4UA 1XNQK 5ETPA 7FDRA 4DTUA 4LF7F 2PD1A 3FBFA 1WB9A 3CGIA 3KKSA 4FZZA 2FF6A 3L7PA 3HDSA 3R7NB 1EJ7L 3V81B 2J7WA 3FQLA 1X4HA 2L9DA 3DLKB 2P6SA 4HLBA 3ZSXA 4YEAA 1PYTA 1Q18A 1IO2A 1CSJA 1FWLA 2RHKA 4FLUA 1LWEA 3DFEA 5CZXA 2DY9A 4DU3A 2IBKA 3CJBA 3EE8A 5AQQA 1U0SA 3D2EB 1IJJA 4HVZA 2H4YB 4H8KA 2X1GA 3OV7A 3SCKE 1L3TA 3K17A 1OYEA 3JQMA 2BZ2A 3CQ8A 1U1MA 4KY3A 1BL3A 3WXJA 4CWBA 1AXQA 2JJ4D 2KM8C 1O1WA 5BYQA 1BO5O 2HF4A 5LMUF 2DR7A 2HB5A 1WLJA 5GADP 4CJQA 3L2VA 4CHYA 1JWWA 1LEOA 3O8MA 2W7PA 3FUYA 2ASJA 1BHNA 4HHUA 4IOXA 3WNGA 5FRNA 3QIPA 3MMCA 4EO6A 1CULB 4NXNJ 1HI8A 3N28A 2OMOA 1RWPB 4WFBL 4O3QA 3BSAA 5AQFA 3CMEN 5IWAJ 5C25A 3BYRA 3M5RA 3WHIA 3GIJA 3QDKA 5AFUH 1K8KB 1CQNA 1RTJB 4YOYA 2ZZNA 3GIIA 2C3MA 1V4SA 3LAKA 5I4MA 3FZMA 3KLGB 2BABA 3GIRA 4JI0F 4MFBA 3ULEA 1KVBA 3BQ2A 3MTJA 4ECWA 3WQPA 4CIOA 4BQLA 3SCIE 3NOCA 2W9AA 5IOLA 4FK4A 4DSFA 3H90A 3RW7A 3OYNA 4RTFD 3MXJA 1HPMA 4GV3A 4A5AA 1QQCA 2K1RA 2KFYA 3KJQB 4Z0UA 5JLFA 2LFVA 4OHWA 2NSBA 3GCWP 4DCJB 2BXJA 2A1SA 4FWLA 2F9JA 1S3XA 2XMJA 1E4GT 2VBYA 1M5HA 1RGVA 3OS0A 5M1QA 5KFGA 2AQ4A 2NREA 3NS6A 4F2RA 5DM7L 2CA9A 2OO4A 2W7OA 2H5JB 4CLZA 1WC0A 1IBLF 5I3UA 2VICA 5EWEA 5AQGA 5KOXA 3VAJA 1AUDA 4TYBA 1PYOB 5D4NA 4FCYA 4OYWA 3P6YC 1TKXA 4NE9C 3G71S 1EQYA 3BYPA 2DNRA 4BROA 2QYGA 6AT1B 4ZITA 4FM0A 2ZHOA 1R8PA 3VF6A 3VVUA 1JXLA 4JI5J 2VU5A 4DV0K 3G96A 5J2MA 1S9FA 2YVSA 3DDNA 3KHLA 1HL6A 4J91A 2CWXA 1MG7A 1VI7A 1HPZB 4QYZJ 4GMKA 1VQ8N 5KFZA 1RT1A 4PHTX 1RDUA 3J7YU 4CLSA 1HNXK 5CYQB 3N01A 3AD8C 4CEEA 3T69A 3NBPA 2E2NA 3RR8A 2J9DE 3R5AA 3BBCA 4DDFA 3R5DA 1CJUA 4JS5A 4ED7A 4ZVEA 4HTLA 1HX1A 2VOOA 1FKPA 5GADU 2I0XA 1N5YA 4GMJB 3M8YA 3O44A 1FJCA 4LIRA 5LSRA 1SJFA 2XB2D 2A1RA 2VD3A 4GKKK 3D1QA 3HTVA 3R8YA 4CIEA 4AHCA 5A8RA 3HM8A 3DLBA 4ES3A 4J9RA 4FL9A 4CLYA 4AHTA 1BI4B 1ITGA 2OEJA 2ZVIA 3OT9A 1JLEA 3EPIA 4LREA 2CPFA 4IO9Q 3A8YA 5M2UA 2AIRB 2DD8S 3G87A 1SUQA 1IBKK 3CD5A 1RBUA 5IV4A 1C1CA 4DR1K 3WX4A 4Q43A 1U1NA 4OYOA 1NGGA 3M05A 4C3KA 2IOCA 3PIPL 1VQPN 2P9PB 3AQOA 5KG6A 1M1HA 3PHEA 2IC3A 3L4QA 3T7ZA 3FC9A 2V4JA 3I82A 4HHJA 3UE2A 2Y1RI 4WTOB 4X62J 2QA4N 1OY8A 1QVFR 3U3YA 4CHPA 1RWWB 3H5SA 1VSLA 2C2KB 4M63C 4QZVB 1FFGB 3FZHA 1BLUA 4HT5A 5DZ7A 4KBIA 1X5PA 4DV6K 2NCKL 1B92A 3B54A 4DV7K 2OPQB 1Q0NA 2XMMA 1S1WA 4EP4A 2UUBJ 3G0ZA 2EWSA 5KI6A 4BRPA 2VZ9A 1PBAA 2NXEA 3EEQA 4JK9A 5C15A 1Q95G 4K4XA 1NHKL 2KXNB 4U96A 4DU7A 5LJWA 4USHA 5EDWA 1YBUA 4CJEA 1Y97A 1G6BA 3K57A 3MFHA 3DJCA 1NJIO 1U6FA 2CVIA 1MMDA 1RA7A 2P5OA 3EL2A 3SQ2A 5HVGA 4ALZA 3CPEA 5ETLA 2RB7A 2QW9A 4DFJA 3QRPA 3TTFA 4EI2A 1N52B 1TL3B 3ZZUA 1N56A 1TYQB 1S7HA 3R1HA 1RT1B 3VQAA 4FP9A 4Y1DA 4MH8A 3AVMA 1RHMB 3GU0A 4MKBA 5HL7L 4ZK7M 4IG3B 1MNEA 4F4WA 4LFBK 2M7SA 2H3EB 3ATVA 4WP3A 2RKIB 4CEFA 4OZJA 1VBXA 3CJTA 3TEHB 5AQSA 4OYXA 3ZZTA 1D8ZA 2AJQA 4F0HA 4BDPA 4QYRA 5JVHL 4DI6A 3M8SA 5EU7A 3Q8SB 5E0OA 4DL0C 3G2XA 2RSQA 4B3RJ 4ZKAA 1R8CA 1VQ4S 4KTZA 1AA1B 3HHEA 2JVRA 2FC8A 1QD1A 4B3MF 4TN2A 7FD1A 4QS7A 3KG4A 1FERA 3ZSZA 2ATLA 3AVIA 5GAEU 1MN7A 2ZC4A 4GC7A 1HHTP 3A0IX 1N5QA 5AQOA 4M3RA 4BE2A 2MQNA 2WK4A 3KFWX 1X9WA 1C0GA 1U09A 3CD7A 1C0TB 1JJ2R 2VFUA 2HHVA 2CDQA 4LSLB 4IDKB 1YK9A 3H2VE 4QR0A 1HYSA 2ZH3A 3DM2B 2MY8A 3SBMA 2GELA 5AQKA 3BN4A 3OFGA 2GIRA 2DH7A 1YDLA 5IZHA 3OTBA 5AZJB 3FBCA 3PJXA 2F4VF 3TYTA 4MFBB 2N4DA 4IWVA 2HRUA 5C24A 2BYCA 2IVFB 2V8VA 1RHQB 4TNOA 4O3RA 2KHDA 1D9AA 4ITSA 5KFTA 4I4BA 3H45C 1Y5IB 2XMAA 2UUBF 3H42A 1CJTA 1JXBA 4FJHA 4CIFA 5CYQA 5DDPC 1S1VA 2L9WA 3TAGA 3NGTA 2MQMA 3PCOB 4C4WA 4FKXA 2JLEA 4DN0A 1FJGF 4XH5A 2CKWA 1H72C 4HYKA 2HGLA 2E5GA 1JCGA 2Y0BB 1Q81T 3UCZP 3GDQA 1QVGR 1SQEA 5GAHI 4LFCF 1F9HA 4KO0A 3CUNA 3HJVA 4DR4K 1KFSA 1RAGB 2CJKA 4CJPA 4RZRA 4C48A 4P10A 3KNGA 1HJRA 5AXKA 3FFIA 3DLRA 3MXIA 3AVCA 3M9OB 5CD4H 4FLTA 2KL8A 1FCAA 1Y10A 8RUCA 3R3TA 4ECQA 5E33A 1KQKA 4CGGA 1R43A 1YJVA 5IC6B 3KJNB 5DK5A 1J5OA 4J7CA 5BRHA 3QGGA 1VJQA 4HCBA 5JLHA 3SPZA 2ZOMA 1VLOA 2R8JA 2JX2A 2BJ9A 5KFBA 2AJ0A 5M1OA 1NPRA 2LYVA 4KI6A 1KTVA 3MPVA 2HSEB 4ZVHA 2ITMA 4WE1B 5C25B 3F9KA 3BN7A 2B56A 3NGKA 1FI4A 1HRHA 2O67A 2LSNA 4EEYA 5D8HB 2EFGA 5FPEA 3BKUA 4CJ7A 3TVKA 2BM0A 2HW3A 4KGMA 1KLNA 2EFVA 5L46A 1HBMA 4C9DA 4AD6A 5T7BA 2E7WA 3S7RA 2BUNA 3HZ6A 3AVAA 4RO0A 5B08A 3UD4P 3OXFA 4QIEA 1RT3A 1P9QC 3B4DA 4C11A 2CQDA 5A8KB 1IG8A 4CZFA 4Y65A 1TFYA 4L6V3 1HKGA 3PX6A 4B8CA 1KNZA 4JHDA 4NMXA 4AXJA 2CQ0A 1K0TA 4HCCA 2QZ8A 1YWXA 2Q43A 1HNZJ 1FE0A 2VL1A 1HKBA 3QNOA 1IBMF 1S9GB 5L1IA 3FBBA 1U1RA 2POKA 2AU0A 4YDUA 2U1AA 1KVAA 2ZWPA 4BR9A 5JVHQ 3CIPA 1I3AA 3KZBA 1MROB 3CCMS 1MMLA 1EARA 4CEBA 3ZSVA 4BG9A 3TTDA 2FLPA 1T9WA 2ASOA 1U0HB 5KGWA 4RBUA 3PO5A 3AAPA 3B6OA 3O3GA 4P6QA 4HR2A 3K89A 4MTPA 1UW4A 2V8HA 3C14B 3MM5A 3T1HJ 3E9OA 3FCVA 5HL7Q 2HQCA 2D0BA 3O1WA 2YNIB 4OPAA 2CRLA 5ETRA 4ZCIA 3KLIB 4P7VA 4CT9A 4O0NA 2ZGYA 4E7IA 4KH0B 3SYZA 3M30B 3JTNA 1NU4A 1S57A 3CDEA 2CQHA 3MPUB 2GEMA 2HBZB 4JV2A 3D7SB 4KO0B 2W2QP 4B3RF 4OHXA 2VG5A 1X0FA 5CYMB 2C42A 4FWOA 4PXEA 3H2UB 4ILLA 3V4IA 1H6KX 2MSTA 3EGNA