4PUOB

Crystal structure of hiv-1 reverse transcriptase in complex with rna/dna and nevirapine
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
425
structure length
412
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/rna/inhibitor
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
total genus 121
structure length 412
sequence length 425
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4puoB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoB03
5KFGA 3H98A 2V4RA 4G1QB 4KBIA 1T03A 1TQLA 2ZE2A 3LP1A 4O44A 4PUOA 4PWDA 2IM3A 4IDKB 4O3SA 1RT4B 1C0TA 1REVB 1JIHA 1IKYA 1C0UA 2WTFA 1RTDB 5KFHA 4ED7A 4RNHA 4RUAA 4EYHB 3E01B 3CJ0A 4NLYA 4TYAA 3V6JA 3RBEA 3DYAA 4F4XA 4O3PA 1FK9A 4NCGA 2R2SA 1LWFA 4O3QA 2WRMA 4IKAA 2W9CB 3KHRA 3FQKA 1TV6B 5HROA 4ECVA 2D41A 1DTQB 4KSEB 2R8HA 3V6HA 5F8JA 2HMIA 3GYNA 4H54A 5F9NA 1GX5A 3QIPA 3DI6B 2XC9A 4DL4A 4TXSA 2W7OA 3OHBA 3LP2B 1JX4A 3DLEA 3M8QB 2C2EA 1RT3A 4RW6B 4KFBB 2UUTA 5KFUA 3RB6A 5KG5A 4MFBA 2D3UA 4Y34A 3MEEA 1LW0A 1RT5B 2AQ4A 1BQNA 1SUQA 3TQ1A 4NLRA 2JEIA 2YNFB 2BANA 4HKQA 4ECWA 1CSJA 4IRCA 2JC0A 3C6UB 3CDUA 4QW8A 1IKXB 1HYSB 3HVAA 4KV8B 3T5HA 1RT6B 2QE5A 1K1SA 3BGRB 2UVWA 3H5XA 3M9NB 5J2NA 1TL1A 4ZHRA 3I5CA 5J2QA 1BQMB 2E9RX 5KT7A 3ISND 2BQ3A 4NLSA 5I3UA 3JYTA 1RTHB 1JLQB 5HLFA 4IR1A 1LWEB 4TY8B 4B3OA 4NRUA 3DRSA 4FBTA 3GQCA 4H4MB 2WOMA 3MEGA 2B43A 4HYKA 4KKOA 5J1EA 1TVRB 1S1UA 3IRXA 2VG7B 3M8PB 2HAIA 5J2MB 5HP1A 4LSNB 5C25B 2RF2A 2FJWA 4QW9A 3DMJB 5C42A 4G1QA 2F8EX 4J9QA 3T5KA 4FBUA 5F8HA 1VRUA 3DM2B 5JXSA 4QWBA 4IG3A 3LP1B 4O44B 4QWCA 3T5LA 1I6JA 1TKXA 2RDJA 4IFVA 2OH2A 1RTDA 3QGGA 3MEDA 3MR5A 3GIJA 2JC1A 2E9TA 1Z4UA 3RAXA 5DLGA 2I5JB 3E01A 4K4SA 2OPPA 2ILYA 4RUCA 4ZVEA 1VRTB 1J5OB 4NLTA 5CYQA 1LWCA 3CJ3A 1RYRA 3DLKB 2QV6A 3BJYA 4JV2A 5KG4A 4O4RA 1EP4A 2D7SA 5KFKA 4MH8A 3H5UA 2IM1A 4ZP9A 1JLBB 4M95A 2FJVA 3OL8A 4IQXA 2O5DA 5K14B 3KLFB 1S6PA 2IMWP 1DLOB 3UPFA 1S6QB 3ITHA 5KFEA 1JLFA 2AWZA 1C0TB 3I5BA 1REVA 3UDLA 2IM2A 4LQ9A 3QLHA 3KLVA 3NBPB 4F50A 4DG1A 3DRRA 1HNIB 3CJ2A 4J9MA 1HQUB 3NGDA 4KFBA 4XPEA 1LWFB 2W9CA 3FFIB 4O4GB 1FKOB 1S1TA 1LW0B 4MK7A 1MU2B 4RZRA 3QYYA 3QIPB 1T05B 4KHRA 1QE1B 4Q8EA 4YQWA 4J9NA 3BREA 4QWDA 3PW2A 4K50A 3C6UA 1UWBA 1W25A 4KE5A 4KO0B 3LP2A 4ED0A 4MK9A 1JLGA 3DLEB 3BSAA 4URGA 4I2QB 3OSNA 3BGRA 4ECYA 5KFZA 1KHVA 2W9AA 4R5PA 3FSIA 5KT6A 5T14A 4Q0BA 3N6MA 1S4FA 4KHMA 4KAIA 4I2PA 1DTTA 1RTHA 3BR9A 3PW7A 4QWAA 2V4QA 4IDKA 2ZD1A 1IKYB 1C0UB 5KFVA 4DEZA 4RW9A 4ID5B 2R2TA 4TLRA 2JEFA 2CKWA 3MF5A 4EBEA 3V6KA 3OLAA 3CIZA 5KT5A 1RA6A 4URQU 1S1UB 3IRXB 3T5JA 2BRLA 1HYSA 2C2RA 3H5YA 3CDWA 5KFYA 1JLAA 3LP0A 2RF2B 1S97A 4RNFA 5HROB 5DGAA 1S9GA 5KFFA 5L1IA 4IG3B 1BQMA 3QO9B 1S1XB 3DI6A 2YNIB 4RW7B 3T1AA 5I3UB 4IH7A 3CDEA 3MTKA 4PUOB 3QZ8A 2VG6A 1JLEB 4J9SA 4Q43A 1HNVA 2RKIB 1RDRA 3PZPA 2FVPA 5L9XA 4ECTA 2OPPB 3PW4A 1ZTTA 3MEGB 4MK8A 2WCXA 2WB4A 4RU9A 4NCGB 1T94A 1HPZB 2VA3A 2IC3B 1S49A 2C28A 2YKMA 1JLBA 1TV6A 1BQNB 1SUQB 2WHOA 4ICLA 5C24B 2XGPA 5L1JA 1DLOA 4EBCA 5KFBA 3Q8PB 3I0SB 3HVTB 3OSPA 4MKBA 1S0MA 2FVQA 1S10A 4J9KA 2R8KA 3KLIB 5EWGA 3DRRB 2FJXA 4F4ZA 2AX1A 3V6DB 3V4IA 2UUWA 3PJXA 4EO8A 1S1TB 4NLDA 3PW5A 1YVFA 4Y2CA 3JYTB 3MEEB 3GIIA 1XR6A 3LAMA 1HQEB 4ECZA 1S6PB 4B3OB 4R0EA 5EUHA 4TQSA 4ED2A 1RT7A 2FLLA 5FDLB 2FLPA 2W9BB 2WOMB 4DL7A 4ZVGA 1D1UA 3NBPA 1IKXA 3OL6A 3H40A 5J2MA 5HP1B 3HVWA 2DPIA 4R5PB 3DOKB 4XO0A 5C5JA 3G6YA 4Q0BB 1JXLA 3DMJA 5C42B 4ZP8A 3TAMB 5KFLA 4ECQA 1FKOA 4WXWA 1DTTB 5J2QB 4RNNA 2UVRA 3BQ0A 4WE1A 3Q8QB 4J9LA 1TKXB 1SH3A 2OPSB 4IFVB 5HLFB 2HWHA 4RW9B 3G6VA 4WXOA 1T05A 4ED8A 5KFAA 5KG0A 3IG1A 3KOAA 1RT1B 1VRTA 5EDWA 1T3NA 3N6NA 1LWCB 1S1WB 3DRPB 3GIKA 4K4VA 4K4UA 1TVRA 3KNAA 3LP0B 3RB3A 2VG7A 3M8PA 1SH2A 3KHGA 3NAIA 4NLPA 1FKPB 3IGVA 4U7CA 5JUMA 2UVVA 5DGBA 4NLXA 3PR5B 5F8LA 4NYZA 2GIQA 2R2UA 4LQ3A 4ZVHA 5K14A 4I2PB 5DG8A 1C1CA 4YR3A 1C1BA 1TKZA 2YKNA 1JLEA 2ZD1B 4RNOA 4IH6A 1GX6A 4ECUA 4F4WA 4KB7A 3TVKA 2W7PA 2OPRB 2ASLA 1EETB 2BE2A 4I7FB 1ZETA 1J5OA 4EYIB 1S9FA 3RAQA 1KLMA 1IKVA 5DQHA 4WFXA 4WZMA 3DLKA 2IC3A 4NLOA 4IFYA 1EP4B 2HNZA 3T19A 5KG3A 5F8MA 5EWEA 5HBMA 1S9GB 4EEYA 2FVSA 3RB0A 5C24A 3H59A 2AGQA 2R8JA 2AX0A 2GIRA 2ASJA 4EBDA 2R8GA 1S1XA 1QE1A 4M94A 3KLFA 4FS1A 3GIMA 3DOLB 1S6QA 3ITHB 5KT3A 2XCPA 4ECRA 3RB4A 4KO0A 4WFZA 2IM0A 2FVRA 4DL6A 2YNHB 5KFJA 3QZ7A 3QLHB 1JLCA 3KK1B 4DL3A 4I2QA 1HMVB 3LALA 1N48A 3LAKA 1N6QB 4JV0A 3KHLA 1TP7A 1N4LA 2HNYA 3KLGB 3HHKA 4ICLB 3JSMB 4RW4B 3V81B 2CJQA 4LSLB 1OS5A 1R0AB 1S0NA 2IBKA 4J9OA 1RT7B 3CO9A 2XWYA 4ID5A 4PQUA 1TL3A 1XR7A 5DQIA 2B5JA 5KG6A 3KLEB 3MR6A 3KHHA 4MKAA 5KFTA 5DG9A 4ZPCA 2VG5A 4IG0B 3HKWA 1NHVA 2ALZA 3V6DA 3EPGA 3PJWA 2R8IA 4NLVA 3PHEA 1N5YB 2HNDB 4WYWA 2W8KA 3VQSA 2YNIA 4RW7A 1U09A 4ZP7A 3C6TA 3BSOA 3PVXA 4IRDA 1RYSA 1HQEA 2VG6B 1HNVB 1LW2A 2RKIA 2XI3A 1QAJA 3I0RA 2OPQA 1S48A 3MECB 5J2PA 2VA2A 1ZTWA 4ED1A 1S1VB 3OHAA 2W9BA 5KT2A 3OL7A 1RTIA 5F8GA 1S9EB 1HPZA 2J6UA 3DOKA 4O3NA 3NAHA 1JLAB 5KFXA 3M9MB 3FQLA 1SH0A 3Q8SB 4YR0A 3FRZA 1MMLA 1RT2A 1C1CB 4PWDB 4IOBA 4R8UB 3QO9A 4NLUA 5KG2A 3IGNA 3KK2B 3IN5A 3H4BA 4NZ0A 1RA7A 3KLIA 1IM4A 3QGIA 4ED6A 1EETA 2BE2B 5KFMA 4K4TA 2WONA 5DG7A 2BQRA 4OL8A 3DRPA 4TYBA 4IFYB 1IKWA 4ZVFA 1SV5B 1FKPA 4RNMA 3H4DA 2HMIB 3SI8A 2YKMB 4EO6A 1JKHB 5KFWA 3EZUA 4GC6A 4IH5A 5D3GB 3DOLA 3LANA 4Q45A 5FDLA 1RT4A 3I0SA 3HVTA 3KK3B 4URSA 2B6AB 3IS9A 3FDSA 2IJFA 1XR5A 1RT3B 4RW6A 3EPIA 3BSCA 3KLHA 1IKVB 3PW0A 3TAMA 3V4IB 3GV8B 3BQ2A 2FLNA 2HNYB 2IJNA 2IAJB 2JEGA 1RT5A 2ASDA 2UVUA 5HBMB 4WE1B 3OLBA 1S0OA 3DLGA 3MR2A 1R0AA 5CYMB 2D3ZA 3IG1B 2B5JB 1RT1A 5KFIA 3G6XA 3QIDA 1S1WA 4ZPAA 2ILZA 5F8NA 2VG5B 4IG0A 1WNEA 3M8QA 3BSNA 4XPCA 4YP3A 1TL1B 4ZHRB 2C2DA 5KFRA 2YNGB 3PR4A 1N6QA 4ZP6A 1T03B 4H4OB 3C6TB 3QGHA 1JLQA 1K1QA 5KT4A 1TKZB 2YKNB 3D5MA 3OL9A 3NL0A 2YNFA 4X2BA 5I42B 2BANB 3CJ5A 2OPSA 3CVKA 2OPQB 4MIAA 4ZPDA 1HARA 3KJVA 5KFDA 4DL2A 2OPRA 2BQUA 2HWIA 2XCAA 4I7FA 4F4YA 4KKOB 1TKTA 4TQRA 5J1EB 5DQGA 2XGQA 1FK9B 4QWEA 1KLMB 4KV8A 3I5AA 1NHUA 1RTJA 4RW8B 4ECXA 2AU0A 4IR9A 1DTQA 1QUVA 5J2NB 4JV1A 3DM2A 4WFYA 3MR3A 1RT2B 2XI2A 4R8UA 5KFQA 1N5YA 4J9RA 4J9PA 5KFNA 3G86A 2ZE2B 1C1BB 2DPJA 4DL5A 3MFIA 2AGPA 2EC0A 2R2RA 1QAIA 3H2LA 2YNHA 3N6LA 3I0RB 3BQ1A 4YR2A 3MECA 5J2PB 1D0EA 2WONB 3M9OB 4K4XA 4ED3A 2BRKA 1N56A 2ATLA 4TN2A 3MFHA 3KMSA 3GV7B 2V0NA 3DYAB 1IKWB 1RTIB 5F9LA 3GILA 4WYLA 5KFPA 4G3IA 2JLEA 4MFBB 2HNZB 5EWFA 3RBDA 1JKHA 3NKYA 4IRKA 1VRUB 3JSMA 3CWJA 5L1LA 4YMEA 5D3GA 4NLQA 4PQUB 1TL3B 4JUZA 3KK2A 5KFSA 4FS2A 3UQSA 3KLEA 4K4WA 1C2PA 3MEDB 3KK3A 4K4YA 4Y2AA 3D28A 4NLWA 4ZPBA 1HNIA 5KG1A 4ECSA 1HQUA 1JLCB 3KK1A 5F8IA 2C22A 2W8LA 1HMVA 3DDKA 3UR0A 2IA6A 2IAJA 1SV5A 3GV5B 1MU2A 3SFUA 2HNDA 2V9WA 1KHWA 3E51A 2AGOA 3KLGA 1LWEA 4TY8A 1LW2B 4RW4A 3V81A 3CJ4A 4LSLA 3ICLA 4MIBA 2J6SA 3DRSB 1JLFB 1S1VA 4H4MA 1JLGB 4NRTA 4O3OA 3Q8RB 5KFOA 2B6AA 3IS9B 4DG1B 5DLFA 4LSNA 2ZKUA 5C25A 1RT6A 3H5SA 2GC8A 2E9ZA 4Q44A 3ISNC 2YNGA 3KLHB 2FVCA 4O3RA 3FFIA 4O4GA 2BR0A 4H4OA 3KMQA 4TY9A 2I1RA 4GC7A 3DLGB 5I42A 4Q8FA 2J6TA 3KJVB 5CYMA 2WK4A 2RDIA 2I5JA 5KG7A 1UWBB 4NLGA 4K4ZA 1TKTB 3SFGA 1NNDA 4WZQA 3NMAA 2JEJA 5CYQB 4QPXA 5KFCA 1RTJB 4RW8A 4ZMMA 5L1KA 1S9EA 4Y3CA 1RAJA 4U6PA
chains in the Genus database with same CATH superfamily
5KFGA 4OYXA 1TL7A 3CDBA 3H98A 3ZFVA 1ZA2B 4G1QB 4WPAA 2V4RA 1NK5A 1ZM9A 3D6MB 3IP0A 4KBIA 5AE1A 3RRGA 2EC2A 4NOHA 4PG7A 4CCHA 2YX1A 1C0TA 4NXMJ 3GR0A 1HI8A 2AEJA 4FZVA 4DHVA 1NPPA 3CJTA 2M8DB 2QMWA 3CD5A 2QC3A 4I6YA 4TYAA 1DHMA 4DQQA 3V6JA 3DYAA 3MAHA 4QYZK 1FK9A 2HK2A 4ANDA 3RU0A 4KPCA 4LFBF 1GMVA 2WRMA 1BD6A 2VU5A 3MM7A 5I3QA 4DLGA 2LA4A 5F8JA 1R27B 3FEXB 7AT1B 1M1GA 4Q7AA 1A6LA 1ZZNA 1WF0A 1X9SA 2R7SA 3PKYA 2GX8A 1GX5A 1P8GA 3QIPA 1UJ6A 4DUZJ 3M8ZA 3RR7A 1NAQA 1C4CA 1UCNA 3D3BJ 3OHBA 1RLCL 3LP2B 1NK7A 1VQ5S 3M6UA 3MPVA 1JX4A 2HHWA 3HO1A 4P7TA 1PCAA 2ACYA 2ZH9A 3Q8VA 2Z58B 4RW6B 1S72S 3ENQA 1VS3A 3HHLA 3RR8A 2UUTA 4B3RF 1N52B 2UUCF 4ZCMA 4QOTA 2RE1A 2F8MA 1LW0A 1SPBP 3GP9A 2ZFHA 4BC7A 4DJBA 2AQ4A 1VQKS 4LFCJ 1CS4A 3AH6A 5CXTA 1SIZA 4ECWA 2RU9A 2CVEA 2GA7A 4CM0A 4FYDA 2OTJS 2D9PA 1XEZA 4A47A 2BJ1A 1VQ8S 4JP8A 1S99A 3TZXA 2E5HA 2Z2LA 1HYSB 1NPRA 4KV8B 3T5HA 2KTQA 2J8SA 2NUUG 3C14A 4KGZB 3H5XA 1K8AT 4ZITA 5J2NA 2H5IB 2JFDA 2Y0BB 2OUGA 1FVQA 2KHCA 1YZ6A 4N77A 3AQOA 3QT6A 3QT8A 1A7GE 2MEWA 4NLSA 3JYTA 2DNNA 2CQDA 1JLQB 5HLFA 2OEMA 3UW1A 4F4AA 1FI4A 2WVBA 2X7IA 4TY8B 3TEGA 4PYAA 3TJAA 3VVTA 1HKAA 2GVDA 2QG9B 4NRUA 3FBBA 4F0HA 4JBCA 4Y6IA 1KP6A 3MGJA 4HYKA 3BYPA 3HSJA 5F3TA 5K8NA 5J1EA 3B82A 3HSGA 5HP1A 4LSNB 5T7LA 4DFMA 4ZN1A 2FJWA 4N41A 5C42A 4A8MP 2RILA 1N32J 2MLZA 1HHSA 4QZVB 5D4OA 5JXSA 3T5LA 3HKZD 4QWCA 1FJGF 2GHVC 1TKXA 3FMBA 1FDDA 2CJBA 1RAHB 1R8CA 1D8ZA 1RTDA 1Y00A 2P9CA 2JFKA 3CCTA 3CB4A 5D77A 3GIJA 1PJ5A 1Z4UA 4K4SA 2IYGA 4DZ6A 5DLGA 2OPPA 3ZTRA 1U1QA 1B0VA 2MMYA 1BUXA 1H72C 1RYRA 4ENOA 3BF4A 3DDNA 4LFAJ 5KG4A 2AF6A 5FLXY 1PYOB 2D7SA 3AOAA 3EYZA 1FX4A 4JI7F 4LF4J 3H5UA 3QATA 5E2QA 4ZP9A 4QIFA 1FERA 1JLBB 5C7PA 3ZNJ1 2DNPA 5L38A 5CD4H 2VOOA 5KOXA 5K14B 1QDUB 4U67Q 3Q2TC 5KFEA 2RRNA 2GQ2A 4P10A 4LQ9A 2KZMA 2NUHA 3QLHA 2VBXA 3RAMA 2G4BA 3P49B 2O3DA 3BV8A 3R5AA 4P72A 4GMKA 4BC9A 3OBIA 2DNZA 3NGDA 4XPEA 3I96A 1LWFB 3NRBA 4PXDA 4ZDNA 1WJ9A 2AV5A 2XSJA 4ZJLA 5A76A 2MB0B 2XTJP 4Q2LA 2P9EA 1JNRB 4KT0C 1CG2A 3CCLS 3TANA 3BREA 4K50A 1UWBA 2L9WA 4KO0B 2EFOA 3PEJA 4F0MA 4B9VA 3BSAA 3I4PA 3IRWP 2GV1A 2BUNA 3DDIA 3WDOA 3OSNA 4DR5F 3BGRA 2DR9A 2CDQA 3FSIA 3CEDA 3ZZ0A 2CJ9A 4Q0BA 1UMJA 1X5OA 1JNZB 3F41A 1IR0A 4DX6A 4PYDA 3RGIA 2AJQA 3BR9A 3LO3A 1H2TZ 3PW7A 2BEFA 4QWAA 2V4QA 2ZNYA 1H0HB 6FDRA 3FUYA 2WBRA 1Y7PA 5HSPA 2ZH3A 2R7TA 1UW9A 2HHXA 2FHOB 1I1GA 2F4VJ 1Y10A 2CUYA 1TL5A 4EBEA 2VQEJ 2JEFA 4KGKA 3CIZA 5KT5A 1RA6A 1EJ7L 4URQU 2RT3A 3HT0A 4N8NA 3T5JA 4OYIA 4ZJQA 4ATNA 3H5YA 2UV8G 3CDWA 4LRBA 3OQ2A 5E3PA 1JLAA 1K0VA 2RF2B 3OJUA 2G2OA 2QMUB 1LK7A 5HROB 3KWMA 1BC6A 1EQ0A 3J7AN 2EKNA 4DF4A 5CCLA 3QO9B 1UWAA 5GAEI 3DI6A 3T1AA 1EHWA 1SKUB 3N28A 3PIOQ 2D3OR 3CDEA 1MN7A 4C3LA 1BMQB 3J81Y 2VG6A 1JLEB 1HBOB 1RDRA 1KQGB 3DFEA 3WZ0A 5L9XA 5HI7A 2DNKA 5FJ4A 1NSQA 2UXDF 2MLYA 2J9CA 2WCXA 4TLQA 4CI0B 3MXHP 3C19A 4RU9A 3A8EA 1T94A 1HPZB 1F3FA 1BXNA 1RHQB 1WOPA 2VA3A 2XMTA 3MPYA 5ETVA 3C46A 4CLSA 1TV6A 1BQNB 2DHSA 1K9MT 2WHOA 3CNQP 1ZPWX 2XGPA 3MUVP 2OHDA 5IT4A 2KM8B 4QPXA 3BGFA 2IDLA 2XS7A 2AJFE 4A8FA 1UTAA 4MTPA 5E3RA 1S0MA 2Z2YB 2FHKA 1S10A 5EWGA 4K59A 2B9XA 3ZZYA 3HT3A 5GAHU 3PXGa 3CJSA 4YEAA 2B9YA 2DCLA 2A2DA 5ETKA 3WX8A 5ITHA 1S1TB 4F26A 4NLDA 4F7VA 2HQDA 1YVFA 4MYUA 4Y2CA 3R2DJ 2MQNA 2Z0GA 3UVJB 1HQEB 4K5SA 4ECZA 2B9WA 4KYZA 2K3KA 5CHCB 5EUHA 5GMEA 3UWTA 1SL1A 5FDLB 4ZVGA 1D1UA 3NBPA 1IKXA 1CJKA 1HIYA 3H0PA 4Y2KA 4A8QA 2AJ2A 2WAQD 4XO0A 5B0FA 3P96A 4USWA 1PYTA 5KFLA 2VDHA 4YB6A 5LSOA 1DTTB 3K2YA 3BQ0A 1AFJA 3QT7A 4LF8J 2HWHA 5HLFB 3CO0P 2HBQB 1RWKB 4OHWA 3KOAA 3IG1A 2POKA 2IIHA 1OQ6A 2IA0A 1F60B 2NXCA 5HVHA 1EX8A 5EDWA 1UW4A 5I3PA 3N6NA 1LWCB 3DRPB 2LXUA 4EU0A 2ZKTA 2HHSA 2FLOA 4DPYA 1SH2A 1F0XA 3AOCA 4I6WA 4NLPA 3IGVA 4U7CA 2DD8S 3W60A 4DSKA 5DGBA 2L9DA 2OSQA 5F8LA 4NYZA 4I56A 5CH7B 1YITS 1U1RA 2Y8WA 4LQ3A 3D6TB 4ZVHA 3HFVA 5CZVA 2DJWA 1TKZA 1TL4A 2ZD1B 4NXNF 2DT9A 3A1YG 1WWHA 2ADCA 2BE7D 4KC5A 2OPRB 2CQCA 2LQ8A 3NWRA 2Q6BA 4CO4A 3BO3A 3C16A 5BYQA 3TA1A 4YR0A 3FNNA 1L3SA 5DQHA 4Z37A 4BCAA 5ETRA 1T9VA 2IC3A 4OYOA 3T19A 5KG3A 2DITA 2HBYB 5EWEA 4JV5J 2C42A 2QLXA 4LIWA 4M5HA 2AX0A 4L72B 2ASJA 1VCTA 2R8GA 1XJWB 4OZLA 5HMWA 1S1XA 2R7QA 1FD2A 2LYVA 2ZHAA 4CM2A 3TYTA 1SJRA 1HNZJ 3R7NB 1SKRA 1SJ3P 3NCRA 2DIUA 1MWZA 2W4PA 3M2VB 5JVHQ 2DHGA 3E8OA 1M5OC 2ZOMA 2RSQA 4PQAA 2VPXB 2KH9A 4D3GA 3BS9A 3QSIA 4QIEA 2XYGB 2Q1LA 2GJ2A 1K47A 3LAKA 4DFJA 2C3MA 1F2HA 2DH7A 3M6XA 1Y3KA 2HNYA 1HWLA 3VF0B 3MM5A 3HHKA 1MWYA 3IBWA 2DR8A 4ICLB 1FRKA 2DR7A 3JSMB 1R0AB 1PJ6A 1F6TA 2C3OA 3EXYA 2GQCA 4CLLA 1KR4A 2AKWB 3GB0A 1TL3A 5DQIA 4DV0J 2B5JA 5KG6A 3NWGA 2LECA 2GHPA 4LFCF 1WC1A 2GZOA 2XMJA 3OXFA 3KHHA 1VQNS 1IR2A 3R8YA 2HGLA 1N0UA 2JDJA 5MLCV 5DG9A 4IG0B 1NHVA 2MTLA 1JK9B 2KXHA 2VASA 2R8IA 5A8WA 2FZCB 1HLWA 2MZTA 3ZZUA 3DLJA 1J2VA 2V2VA 4HI1A 3FCWA 3BSOA 5LOQA 1I5OB 5AXMA 4CO1A 2OMOA 4CT8A 4DR7J 4X84A 1SC4B 1NZ8A 3UO0A 3DNCA 3POTB 1S48A 5AJ3J 1JXVA 5J2PA 1OYEA 2CQ0A 3GMGA 2M88A 1ZTWA 1UVKA 2P8IA 2QLWA 4PG8A 3OHAA 2RQCA 2W9BA 1HR0J 2HWTA 2HS3A 4Z7CA 4BBYA 2NZCA 4O3NA 1JLAB 3RW7A 1UPPA 3I9V9 1P9YA 2XZDB 1F2GA 2PIIA 4CO0A 1SC3B 3FRZA 4LREA 2ADBA 1Q0NA 4N76A 3KJQB 1HNWF 2ZH6A 5H9FK 1KN6A 3QO9A 1W2BR 3LWLA 4NLUA 5KG2A 3VGSA 3TA2A 3H4BA 1I94F 1WUUA 4DV6F 4OZNA 1U1LA 2HZVA 1AUSL 2KT3A 2DRDA 2DNRA 2QYGA 2LDYA 3AJ1A 3L3CA 2EBGA 1HNZF 3D1HA 1YBAA 2DR6A 1RJJA 4ZVFA 2MXYA 1IQZA 3EE3A 4CH0S 2DNLA 4DDFA 3M2RB 3UDCA 2OTLS 4HL9A 2CZ4A 2HMIB 2VFSA 2LU2A 3SI8A 4EO6A 4LFAF 2V34A 4OLPA 3O1LA 2R7VA 2KKHA 2QT7A 4CRJA 3GYGA 2F63A 1YK9A 4KY3A 4X64J 1Q8KA 2YWGA 3NP5A 1EB0A 2JLGA 4JI5J 5C2GA 4JI1J 2PFFB 4QQBA 3C15A 1YLXA 1DRZA 4HHUA 3EVOA 1XR5A 4OYWA 1QVGR 2GMLA 3KLHA 2V8VA 4NI2B 3BQ2A 4AT1B 1KOHA 2IJNA 2JEGA 2UVUA 1DBDA 3M6WA 5HBMB 1WELA 4HHJA 2GJIA 3TRGA 1HD0A 3DLGA 4WTYA 2DO4A 5HJYA 1IN0A 5CYMB 3ET6B 1SXLA 3S1TA 4FYVB 3SZ2A 3QPIA 1RT1A 1U02A 1X4AA 2FZGB 2IRXA 3NNHA 1E6VA 4LF5J 1FKAF 3FZBA 3MUMP 2VG5B 2NLWA 5G0RA 1HL6A 4M5IA 1XMOJ 1WNEA 2UXBF 3GIRA 1S12A 4ZIWA 3F73A 1TL1B 1IBKF 1RWMB 4F0KA 3AB4B 5LSRA 2YWHA 3OUYA 2PI5A 4LJMA 4DR5J 4QIVA 4OJGA 3BEGB 3CMQA 3KDNA 3CT9A 4FVCA 2B8PA 4DN9A 1K1QA 5KT4A 3OR1B 2YKNB 3OL9A 1X4GA 2KYXA 2OPQB 1U1KA 1CJVB 3CCJS 4OZ1A 4KH0B 3CCSS 1FT8A 2XCAA 2W2NP 1WF1A 4KKOB 3VR1A 2XGQA 4F4YA 5DQGA 3ETMA 1FK9B 1U47A 1KLMB 4KV8A 3I5AA 3KXDA 1NK8A 4NZ7A 1UZHA 3L95X 4RW8B 4K2XA 1R6VA 2C2OB 3BH6B 1QLNA 3FCHA 4JV1A 4ER8A 4DLEA 1RT2B 1U2FA 4C0BA 1X0FA 2BX6A 4FYXB 1OPZA 3W9HA 1RAIB 3OTEA 4J9PA 3EVMA 4GKKF 2I38A 1RISA 1OYDA 2DPJA 4DL5A 2LQJA 3G82A 1UKUA 3IM9A 3I0RB 5CYJA 3M9OB 3MECA 4XDDA 4CLFA 3UDVA 1N56A 3BGOP 4K4XA 2BRKA 4NMXA 4OYBA 2DNHA 2HSEB 1M1HA 6FD1A 1FJ7A 2YKQA 3TZYA 2V0NA 3DYAB 1IKWB 1RTIB 3N4WA 1GXUA 3SSQA 3FC9A 3GILA 3VTIA 1YRUA 2MQOA 4JI6F 3DN9A 4AL7A 2EW9A 4MFBB 1HBUB 1NSAA 2CAJA 2HNZB 2KDOA 2W2MP 1L5UA 4OI0A 1NMEB 1WOOA 3NKYA 1CS4B 2HBZB 3CWJA 4F67A 4YMEA 3ENVA 3CUNA 4DR3F 2QYCA 4PQUB 3D6HB 1RADB 1Y11A 5KFSA 2YPYA 4K4WA 2H65B 1C2PA 3KK3A 3NS5A 2V9KA 4Y2AA 4NLWA 5JMNA 2C22A 4P71A 4WFAQ 1VBKA 3RJMB 4DU7A 2DGUA 3GV5B 4DR4J 4C8NA 3J81U 2HHHJ 2AGOA 2ZJPQ 4ZLLA 4LSZB 4TY8A 3HX9A 3OVAA 3QRRA 4LSLA 1Q5YA 3RBXA 5DDRC 1X4DA 4OV1A 5T41A 4CLKA 1CVJA 2QN6B 5LM7E 2D1CA 4PXBA 5A2QU 4LSNA 1YGYA 1YRTA 2IYIA 2A3JA 2ZKUA 3H5SA 1V3SA 5A0YA 3ZTOA 2E9ZA 3VWSA 2WB1D 3FFIA 3BBFA 4O4GA 5B7WA 2UXCJ 2OMLA 3KMQA 3EM1A 2V2QA 4P6QA 4TY9A 3UCGA 2ZM6F 4BS2A 2CPEA 2I6WA 3PRVA 2L3MA 3D0GE 1VQPS 2PSZA 1D3WA 3DOMA 3ZZOA 3L9ZA 2CFXA 2RDIA 1CQNA 2F65A 3MCNA 4C8MA 4UT4A 4K4ZA 5L8RC 2YXLA 1NUEA 4LF8F 1LK5A 2P5VA 1FWPA 4MJKA 1FRLA 2HS4A 4F2RA 1FF2A 3D3CJ 2E1AA 1RTJB 3CCZA 1K44A 3O2IA 3UI3A 4C97A 4C7QA 3M05A 4Y3CA 1N5QA 1XTZA 3N79A 5ETQA 1DARA 4HEA9 2V69A 2AD9A 4OJHA 2NXNA 4DQRA 3HF5A 1G6BA 3M4XA 4MIWA 1T03A 4FNIA 5B09A 1RT4B 4A46A 1JIHA 1SKWA 1C0UA 2WTFA 1N5SA 4ED7A 1NEEA 2GQQA 3DHXA 2AJ1A 5H9FJ 5HVGA 4EYHB 2AEMA 3CJ0A 3TEHB 3P45B 4EZ6A 3R5DA 2DHAA 3TI0A 1WG4A 3EGWB 4FYWB 1UZDA 3FQKA 5SZTA 5HROA 2Q79A 2D41A 3H42A 4KSEB 4TKTA 2R8HA 5FD1A 4RU2A 2HMIA 5LL6d 2VH7A 2FJDB 2NS1B 3H25A 3DI6B 1S5ZA 3NGTA 2UV8A 4M63A 3VAFA 4DL4A 2W4CA 4X62F 4TU8A 1X4CA 2HYIB 3DLEA 5LMUF 4GKJF 4O0IA 4LFBJ 3AJ2A 5K8OA 1U0HB 1RT3A 4Z2XA 4DUTA 2BVZA 4USKA 4UW2A 3GLJA 3RB6A 2ZVIA 4Y65A 3M8RA 4B9TA 3MEEA 4DV0F 1S0VA 1BQNA 1UL3A 1WORA 2HFZA 3MM9B 2G0IA 5ETPA 3TQ1A 3HPOA 3UNYA 4BLGA 4IRCA 1NU4A 2CDRB 2XYHB 1NJYA 2XBPA 2JC0A 4DR7F 3R7SB 4YDXA 4DFKA 2DH9A 1UETA 2RHQB 3VHQA 4ZIVA 2R7XA 1WTBA 4BDPA 4HHHA 1VJWA 1PYSB 4ILLA 4NMLA 1Q4RA 1GXTA 4LRFA 1UJ4A 3HVAA 1H2UX 2VHGA 2F1FA 2GO8A 4ZKAA 1RT6B 5G0RB 3MAQA 1BWEA 4USHA 1V3ZA 2UUAJ 3BGRB 1X8DA 1KNZA 5IS2A 2CQ4A 3I5CA 3OUYB 2RQMA 1I51B 4KQZA 3ZZTA 5KT7A 2BQ3A 2DGOA 4KGMA 1WG5A 1WI6A 1GAOA 1XQIA 5D0EA 2OO4A 4NCBA 4AQYF 4B3OA 2JOQA 2MZRA 3MDFA 3CD0A 2QA2A 2HVZA 4ZPTR 3DRSA 4CIOA 3OW2R 3GQCA 4H4MB 5CAAA 3R5BA 4KKOA 2PD1A 2HFOA 1TVRB 2WBMA 3M8PB 3BBCA 1HNWJ 4OFZA 1KVIA 1T9YA 5C25B 1FO1A 2RIJA 3GFHA 2RF2A 2YPZA 4QW9A 1L3KA 1VDHA 3T5KA 5F8HA 4DV6J 1GMUA 2JVRA 6AT1B 1WKJA 1FESA 3MPUB 2J0QD 2HGNA 3DLHA 5E7OB 3QGGA 3MEDA 1NO8A 3FRYA 2E9TA 2HVHA 2XNQA 3S6EA 3VAKA 3ZZPA 4Q5VA 2ILYA 4RUCA 2AJ4A 2VICA 3T1HJ 2XNRA 1J5OB 4EK2A 1X5PA 3QJJA 1LWCA 3GTYX 3TX8A 2DXFA 3GPAA 1LEOA 3MMCA 1ZM3A 1EP4A 4O4RA 4B3RJ 3M7VA 5SUHA 4MH8A 2DXDA 1HBNA 2IM1A 3JSYA 1EIYB 1WC5A 3EJMA 4BWJA 3SQGB 3KLFB 2IMWP 1DLOB 3UPFA 1S6QB 4XK8C 4IOCQ 1JLFA 2AWZA 1Q16B 1REVA 5L46A 2XMAA 4DR6F 1LWXA 2YKPA 4S0MA 1VC0A 3TUPA 1WACA 2BJ9A 4WP8A 3GG0A 4DG1A 4DUYJ 4F50A 3DRRA 2QL7B 2W2QP 1FNMA 1HQUB 2C1EB 1RUSA 1YJUA 4KFBA 1VGYA 2MHEA 1X31C 2W9CA 2YQ0A 2CJAA 2JHEA 2B7CB 1S1TA 1LW0B 3D4JA 2KRRA 3D66A 4RZRA 1M5VC 3PO4A 3MMBA 2NR0A 1I3OB 1VQ6S 4A8WA 2WSEC 3V5RA 3UVJA 4Q8EA 4HT5A 3Q8UA 4ZLJA 4DSEA 2HHPA 4J9NA 2KFZA 2QZ8A 1OIAA 3BZQA 1UEUA 3AQPA 1RBAA 2KM8C 3MCMA 3LP2A 3ZTPA 1IBKJ 2XS5A 3M2VA 4MK9A 3DRXA 1RP5A 1TZ0A 1GXLA 4I2QB 5AXNA 3C14B 2VPWB 3VZHA 4DQIA 4R5PA 4QU7A 3OTOJ 2IHR1 5B0BA 5A0YB 2DR5A 5B08A 4F25A 2NREA 4JI6J 1DTTA 1RTHA 1CPZA 2ZZTA 2ZITA 3R27A 4IDKA 1FJGJ 3RYLA 3VZIA 1IKYB 4C8YA 4ID5B 3J81j 1NXIA 4PXEA 4TLRA 3MF5A 2YH1A 1RU2A 3RG6A 3IWNC 2ZH4A 3CIMA 3DKDA 2HKEA 3Q22A 1RZMA 2BRLA 1UEKA 3AD8C 3NGSA 3JAMY 2C2RA 1SJ4P 3H20A 1FTCA 2RRBA 3K7RA 3LOUA 1F5BA 2XMKA 2KN4A 4P74A 4DR4F 2JVOA 3CDAA 1KLNA 1L3UA 3S8SA 2DH8A 4KJIA 1FRJA 2H4YB 4WIIA 3CCWA 1VQLS 3FBCA 4P7VA 3QZ8A 1CJUA 3H7HB 2EXUA 2FY1A 2AIRB 2QX0A 2OPPB 2V68A 3AXMA 2HRYA 4DV1J 2AHOB 2NPIA 5G4DA 1FWKA 2DKOB 4OI1A 4FXWA 1S49A 3PCOB 3SSRA 4ED5A 2YKMA 4ZVOB 2Q3PA 3VAJA 1Q86T 1GMWA 4XDCA 2DIVA 2ZM6J 3O3LA 2Q6CA 3G87A 4KR0B 2ZHOA 1U48A 3HHLD 4EBCA 1J5EF 2H51B 2MZSA 3HHNB 3M2UB 5GAGI 2MZJA 3QQCD 2MY8A 3WC0A 2PMHA 3I0SB 5KFBA 1AUDA 3HFZB 2ASYA 4MKBA 5KTQA 2R8KA 1NH7A 5BYSA 3WBZA 2AZ3A 4IO1A 3M1VA 4DOZA 1NDPA 3PYDA 3LW5C 2ZEJA 4F4ZA 3KTQA 2K1RA 1YX2A 1EQMA 2A2CA 1YJNS 2UUWA 3PJXA 2DRBA 3M2RA 1PO6A 2CJKA 3JYTB 3MEEB 1RAFB 4DWIA 1XR6A 2LEAA 1HBMB 2C2MB 4HDHA 3QJPA 1SB6A 2N82B 1OJ4A 2W2OP 4HR2A 4R0EA 4TQSA 3VAHA 4ED2A 2CNOB 2FLLA 1TFYA 2FLPA 2W9BB 2WOMB 1FFGB 4HT7A 3DXBA 2VQEF 4ERDA 2HHVA 3OL6A 2GFFA 5J2MA 1O5JA 1VRQC 3HVWA 4LUBA 1U8WA 4WBFA 3F44A 1JXLA 5C42B 4I64A 3SCKE 1OQ3A 3LWMA 2O1PA 2YBVA 2Q66A 3KUEA 2H48B 1FKOA 4WXWA 3OV7A 4DR2F 1PC4A 2UVRA 3R6GB 2ZOGA 3GWCA 5AT1B 2YX4A 3TVZA 1SH3A 1VQOS 3PKMA 3AOBA 3HD2A 5CABA 4IFVB 3BGLA 4RW9B 4KGVB 4B02A 1T05A 2DGTA 5E5NA 5KFAA 5KG0A 4CLZA 3DU6A 4B9MA 2M4MA 4HTJA 1RHUB 1HW8A 1RWPB 1WD6A 4X65F 3GIKA 4K4VA 4K4UA 4OX8A 3WQPA 1AFIA 1TVRA 1WKLA 3LP0B 5E3QA 2J5AA 4Y2IA 8ATCB 3NAIA 1FKPB 4OHZA 4NLXA 5A6PA 5J1NA 1WTFA 5A8KA 1GFWB 1UPMB 2GGPA 3MM8B 4OMFG 1NSKL 1H7XA 3R5CA 1C1CA 4UQTA 3AJDA 3D1QA 4RNOA 4KGXB 4IH6A 1FFWB 2JX2A 2MQQA 1GX6A 2ZH5A 2QTWA 3BB5A 4ECUA 4USMA 1VQMS 2XG8A 3TVKA 2BKPA 2FJAB 3KG1A 5HQLA 1U1PA 1D8YA 1NJIT 1ZETA 3NNCA 1P9QC 4U8VA 3ENWA 4EYIB 5IM0A 1S9FA 4MKVA 4WZMA 2HRUA 1Y9OA 3CW2C 5F8MA 3MURP 5HBMA 2MJUA 3RB0A 3Q24A 3IR7B 5C24A 3BPDA 1HBNB 5IOLA 4ZVPB 5H9EK 3PYEA 1FE4A 4ZVQB 3MCOA 1QE1A 4M94A 3KLFA 2BM0A 2WW4A 2D69A 3GIMA 2DGQA 5CCMA 4G6VB 2RD5C 4KH1B 4M5MA 4RPFA 1QAYA 4KO0A 4DR1J 3PNIA 2FVRA 1W2IA 3CXCR 1DZ5A 4WKRA 2HK3A 1ZAXA 1NDCA 2ZH7A 4DL3A 4KPYA 3EDQB 3K5PA 2PMZD 4LMZA 4X62J 1TUWA 1W26A 1N48A 3C3LA 4J37A 1Q78A 2CPZA 3IBCB 4JV0A 4YFUA 3KHLA 4DSLA 2Z30B 4ZVRB 4CQ1A 4EGLA 3P6YC 3KLGB 2D9OA 2BXJA 2NPFA 1U1NA 1WDDA 4RW4B 3V81B 2CJQA 3EXCX 1N54B 1U4BA 2IBKA 4J9OA 2IRYA 1NSPA 2XWYA 1WEXA 4PQUA 4P2SA 2DO0A 1XR7A 1MSWD 2UUAF 2A18A 2L41A 2RUGA 3MR7A 2PC6A 3RRKA 3T6JA 4FYYB 4RO0A 1H98A 3HHDA 2ZWPA 4DCJB 4PZVA 2RS8A 3V6DA 2QRRA 1XMBA 3PJWA 2QEXS 2CNNB 2IVYA 4NLVA 3WHIA 2MKHA 3PHEA 1N5YB 2W8KA 3PYGA 2FC8A 2YNIA 4RW7A 1U09A 4ZP7A 3C6TA 1WHXA 1KQKA 1OMSA 3NOGA 1H73A 2WZ1A 3OR1A 3NMRA 2VG6B 1VBZA 2M5YA 1HNVB 1LW2A 2RKIA 2I0XA 2M3DA 2XI3A 2Z2MA 1KSPA 1FTRA 3MECB 3H8YA 2F9JA 1MMDA 3CCMS 4WTOB 4ED1A 1S1VB 2EFPA 1FFSB 2KI2A 1U1OA 1OY8A 3JQMA 3W8PA 4OHYA 1YBTA 2V4JA 3L7PA 2OKQA 5FIIA 3B4DA 3FBEA 2J6UA 3DOKA 2ZDPA 4DU8A 3D1OA 2A1BA 5DO2A 3SXLA 2VF3A 2NQPA 1SH0A 8AT1B 1VOMA 3IR5B 3I6PA 1UAWA 3SCJE 1MMLA 2JNJA 2MZQA 3BR8A 4JI2F 1RT2A 1LNQA 4IOBA 2HQGA 1LQ9A 2NXEA 1S6OA 3O8WA 3CF5Q 2VJVA 4OX7A 3B54A 2J9DE 2WVCA 2BV3A 1XNQJ 4DZDA 1IM4A 3B6BA 1UFKA 1UA1A 2WONA 1Q79A 4OL8A 1LFPA 2W4DA 3HLUA 4OZ2A 2DNGA 5ETMA 4TYBA 4A48A 4FF4A 4IFYB 3D2WA 3KUHA 4Z7YA 4RNMA 3W62A 3H4DA 2E1RA 3MPWA 2EWHA 2OD4A 1CEZA 3KYLA 2GNKA 2W01A 5JVGQ 1B70B 4USVA 1ACMB 1FX2A 2FY8A 1PJ7A 1XN9A 3B4MA 4GC6A 5D3GB 2DVIA 3LANA 5FDLA 1RT4A 1S7HA 3CJ8A 3I0SA 3KK3B 1R3NA 2VFVA 3OXLA 3I56S 3K5MA 3OFEA 1T9TA 4ZOSA 1B4SA 3S7RA 1RGVA 4P2XA 2XMUA 3AB2B 1OSCA 1YJWS 1RWWB 2QGFB 3MMAA 4HH1A 3GV8B 2E66A 4J91A 3QBCA 2HNYB 4NZ6A 3TA0A 5GADU 4WE1B 4C8KA 1S0OA 3K59A 3MR2A 3QSYB 4HACB 1RWUA 4UOHA 4DV2J 1LV5A 4GVLA 2B5JB 3FK4A 1NBEB 2V8DA 3ZNUA 4K8RA 5F0UA 1LXJA 3NNAA 5KFIA 2XWXA 3GJTB 3SSSA 1R0BG 1Y5LB 2O66A 3H2VE 3K8VA 4HLBA 4M5NA 5F8NA 2H3EB 3BSNA 2PA8D 4XPCA 4ZHRB 1QSYA 2XY7A 3PRBA 3TW0A 3PR4A 1NRKA 2M7SA 1V9OA 4FF1A 2ROGA 1T03B 1JJHA 2KB2A 1JLQA 1PGZA 3D5MA 1Y0HA 1VK8A 5HAOA 2YNFA 3CTRA 2BANB 3CJ5A 2L08A 2G1DA 3CVKA 4IQMA 4MIAA 1HARA 2FGCA 1R0CB 4E2FB 3Q89A 5KFDA 3MI7X 2QSWA 2OPRA 1IJEB 3C16B 1X5TA 4V19J 4TQRA 1N8RT 3SDEB 5AXLA 1T95A 3F56A 3R3TA 2AYGA 1XBWA 1NHUA 1RTJA 4OIXA 1LOUA 4ECXA 2AU0A 4IR9A 3HHEA 3IAS9 1QUVA 3CULA 3SCLE 4WFYA 2OJ3A 5I4MA 4LF1A 2X1BA 4ALZA 1NPKA 5KFNA 2VC1A 3MZIA 3G86A 1Y5IB 3PRDA 3SV4A 2VONA 1C1BB 2X1GA 4CLWA 2E1PA 2NXUA 2R9LA 2EC0A 5IT9U 1W7WA 3N6LA 3IWLA 3PM9A 5J2PB 2E7WA 4O3RA 2BW2A 1T9XA 5AE2A 3HHLC 2ATLA 4YY3F 1TMJA 2RH3A 1SQEA 2OP5A 4FDFA 2LDIA 3GV7B 2F8HA 4X4SA 2KU7A 4G3IA 1RKIA 3GYXB 1B0PA 2ERRA 2R7OA 2Z56B 3GJSB 2LEPA 1X4BA 3O5TB 3VAGA 2FZKB 4FF3A 4RBTA 2ZZNA 2K06A 2VKRA 1SJQA 4Y0FA 1HNXF 1ZZFA 1DAXA 1FNOA 1PBAA 1VI7A 3THTA 1TL3B 3CCRS 4U7UD 3NXZA 3EVWA 3Q23A 3JTPA 5F41A 1DURA 4K4YA 4LF9F 3D28A 1FVSA 1J5EJ 3UD5A 1OSDA 4ECSA 4CO3A 4UF4A 1V5VA 1XC9A 3MOJB 1NDLA 3WIUA 2PMWA 3DDKA 2HLTA 2VBYA 2NYIA 3SCIE 1HA1A 2F3JA 3TWZA 3S01A 3HXMA 3TAPA 1VQ4S 4OX9J 3V2UC 2MSSA 3TZWA 4JOUA 3BN4A 1LWEA 1Q8BA 4X4PA 4NCAA 4RW4A 3V81A 3ICLA 3TX0A 4MIBA 2HEKA 5D0GA 4P2MA 3CJKA 4DXLA 5LJ3Y 3IA0A 1JLFB 4X4TA 1S59A 2QIFA 4NXNJ 1FEHA 3G9CA 1F9EB 4L74A 4NRTA 4U7UK 4O3OA 1FDAA 2YWEA 3I87A 3HCXA 5KFOA 1SCJB 3Q8RB 4DG1B 1DY3A 5C25A 2CXEA 1RT6A 2J9EA 1QD1A 4DCOB 3G71S 2QA4G 3KLHB 2VL1A 2HQIA 3PX4A 2BR0A 4F3MA 3K57A 2J7UA 3NS6A 3A13A 1SQGA 2EK6A 2R42A 3ILIA 4Q2MA 2I1RA 5KOWA 1QSLA 3HSZA 5DRKA 2I2YA 2A6MA 2J6TA 1CJVA 5CYMA 1T02A 3ET6A 2WK4A 4W92B 2Y1IA 2YWWA 3GONA 1TTHB 5E41A 5GAHI 4NLGA 1TKTB 1WHYA 1NNDA 4WZQA 4UZBA 1ZBTA 3DHWC 2MLXA 3HDSA 4Y00A 1QM9A 2V4JB 3IFEA 4RW8A 1H2VZ 2HGMA 2PE8A 4ZN3A 1T8EA 2VZ9A 2UXCF 3CJ2A 3D0HE 1RE1B 5K8PA 4C98A 3MOZA 2LCWA 4JI1F 1TQLA 2ZE2A 3LP1A 1M5HA 4PUOA 2BW7A 2IM3A 2DNQA 4IDKB 3PHTA 1WC4A 4V1Ak 3UNGC 4A8XA 5M2PA 1REVB 2A6OA 1IKYA 3PEHA 4RUBA 5KFHA 4U9RA 4RUAA 1VBXA 3A3OB 2VBZA 3E01B 2OI2A 3K5OA 3BN7A 4WP9A 3P8BB 3RZAA 4DBQA 2DNYA 4UOGA 1SJFA 4NCGA 2LP4A 1FRXA 5HANA 2PEHA 4CLYA 9RUBA 2W9CB 3IXQA 3KHRA 1ZM2A 5GAEU 1TV6B 5ETLA 4DR1F 3IAM9 2RAQA 1Z2LA 2YWKA 3P5BP 4H54A 1QTNB 5F9NA 4CLPA 3CCUS 1IQTA 5ETNA 4GO5X 5D4LA 2XC9A 4TXSA 1BE4A 2FHMA 1VLYA 5IC4B 2W7OA 1FXLA 5AJ3F 1E6VB 1H7WA 1SBRA 2DY1A 3OTBA 1RU1A 2J8AA 2HIQA 3M8QB 2C2EA 4EI2A 3K0JA 5A6WA 4B3MF 4KFBB 4ZLNA 2BKNA 2X1FA 3EDRB 5KFUA 3DGVA 3DGPA 4MFBA 1HBUA 4DUZF 1RT5B 1SUQA 2QA1A 4NLRA 3BO4A 4QR0A 1VC6A 2JEIA 4HKQA 3E2EA 1CSJA 4F8RA 5JJBA 5M2RA 3ADAC 1ITPA 3MCSA 2K3IA 3NGKA 3C6UB 2XZTB 5K5MA 1TAUA 2E29A 4HH0A 1IKXB 1CJKB 2J0WA 1B7FA 3OT9A 4KHPF 2QE5A 1SL2A 2K1RB 2N4CA 3OPKA 3CCES 3M9NB 2XY5A 2UVWA 4QU6A 3AHPA 4ZHRA 1JJ2R 2CNLB 4FXDA 2K2PA 1X4HA 2CPFA 3ISND 3CGIA 3I9ZA 3A8KA 4PEOA 4ES3A 5I3UA 1PBUA 4B9LA 1RTHB 1VJQA 4GVBB 2BE9B 3DOMB 3G82B 1CJUB 4H4KA 1SC6A 1EKSA 7FDRA 2FC9A 1P6TA 3QWUA 2QLBB 2F7VA 2ZBRA 4G1PA 5H1SV 2MQ8A 2R7RA 4FBTA 2IFXA 2WOMA 3MEGA 3CMAS 3NGUA 3J7YI 3SV3A 1EAYC 2J9DA 1S1UA 3M8YA 2VG7B 2H4WB 3D68A 2EFQA 5J2MB 4J90A 3TO8A 3VVUA 4JI2J 1UVNA 3ULHA 4K0KF 4I68A 3DMJB 2GVZA 2F8EX 4LR8A 3NOCA 4J9QA 1CQMA 4FBUA 4A8OA 1VRUA 3DM2B 1KWMA 3MAAB 4IG3A 4O44B 2PEBA 2V8GA 4ZPWR 4QWBA 2LA6A 3Q83A 5HMXA 2VUGA 1I6JA 1GMWD 2HIYA 4RWWA 3L7OA 4IFVA 1NB7A 2RRAA 1C4AA 2JC1A 2MKCA 1RWNB 4C3KA 3RAXA 1TFWA 2OD6A 1RXOB 5LMUJ 2NCKL 4NLTA 4GKJJ 5CYQA 4RBVA 4YHHJ 3BJYA 2HVIA 9ATCB 5HQMA 1XMOF 4AXIA 3UN5A 1PKUA 2WW8A 3PACA 1FWLA 2VFUA 5HATA 1HHTP 2R8JA 1E6YA 5ETSA 3DLLQ 3NS7B 3OL8A 4BWMA 3A4TA 3MM6A 1IJFB 2O5DA 5GAGU 1S6PA 3ITHA 3D9BA 4PR6A 3UDLA 3OTCA 1ULRA 3R6LB 2IM2A 2BABA 2BYCA 1U26A 1CULB 2L9NA 4ZCIA 4JYAF 2ZJRQ 1QJHA 1VR6A 1HNIB 4B9UA 4JI7J 1KOOA 3QNWB 1RWVB 2CQ1A 2Y1JA 3FFIB 1NJWA 5U47A 4O4GB 4DV3J 2E5LF 1FKOB 1G2EA 2VB6A 4QR2A 3MM5B 1MU2B 4LR7A 4CYUB 4F2SA 1X9WA 2LLZA 2YTCA 4OX6A 4GKKJ 1T05B 1HWKA 1QE1B 4YQWA 3PW2A 5B0EA 4QCLA 2CQ3A 4AQYJ 1W25A 4PAAA 3CJKB 4B3TJ 4KE5A 5IV4A 2K7JA 3LPEA 4AD6A 4ED0A 2AYEA 1ZYQA 1MROB 1JLGA 3DLEB 3HI9A 3W1YC 4URGA 2KG1A 4DV2F 1SC1B 2BBEA 4ECYA 4QBUA 2B9EA 5KFZA 1Q8IA 3QT5A 5T14A 2ZOFA 1GQEA 1S4FA 2VPZB 2GGPB 3MM8A 1GTHA 4KAIA 4X4OA 2C3YA 3KG0A 3C2PA 2BACA 1NB2A 2HVDA 3Q0AA 2HURA 2LKZA 5D8HB 3OVBA 2RQ4A 4M5JA 1C0UB 1PILA 4DR3J 3A12A 1KDNA 4RW9A 5KFVA 1G1XA 2YY3A 3PFOA 2R2TA 3BH7B 1FCAA 5HQ8A 2CKWA 4A8SA 5BR8F 3OLAA 3JQKA 2MJNA 3NCPA 3IRXB 2CJYB 1HD1A 2KZZA 3K58A 1LKZA 2MKSA 3D54A 5KFYA 3LP0A 3U1MA 1S97A 4RNFA 2XHWA 3L4BC 4J9VA 2HAFA 5L1IA 2DCUB 2XMWA 3PV8A 1U6ZA 1BQMA 4ZCLA 2YNIB 4RW7B 1WSVA 4ZJOA 3K5NA 1H6KX 4PUOB 5GMKa 2G1HA 4J9SA 3D0IE 1HNVA 2RKIB 2MSTA 4OI6A 4FKXA 3RW6A 1VYAA 4OHXA 1PAEX 2LFVA 3PW4A 3G2XA 4C11B 4M5KA 3LA0A 3HJVA 1ZTTA 4WK3A 4NA3A 4J5OA 4QPTA 1NZAA 4N47A 5IM0B 2WB4A 3R1LA 4NCGB 2QO3A 1V5IB 1HNXJ 2VBWA 4HTIA 3W3SA 4UUWA 2E7XA 2P6TA 4HVZA 2HZAA 4L6V3 2GAHC 4OJ1A 3PX6A 5C24B 5L1JA 5FLXU 4YB5A 1FJCA 1DLOA 3GSDA 3HSDA 2CWXA 3VGTA 2ZZMA 1O6XA 5ADZA 1BLUA 2BJ3A 3RB4A 4AL5A 1QUPA 4UOFA 3HVTB 3OSPA 3VQTA 4J9KA 3KLIB 1RABB 3HD1A 5DM6Q 3DRRB 2FJXA 1FRIA 1Q95G 2VV5A 3BGUA 2UU9F 4JI0F 4DSJA 1XNRF 2WVFA 4EMDA 3V6DB 3EZOA 4NI2A 2CVIA 3P4UB 4P9SA 4EO8A 4HI2A 3PW5A 2PN6A 1KRPA 2JJ4D 1Y3JA 3GIIA 1J27A 3LAMA 3O44A 4NEYA 1VQ9S 2NSCA 4OX9F 4B3OB 4EUVA 3CMES 1SVDA 5DDPC 4OI2A 2BOAA 2OLWA 1F9HA 2HZCA 2FHJD 1O51A 1YJVA 1GNKA 3KDOA 2GJFA 3PYFA 1MNEA 3PDNA 2DPIA 1M5SA 2XMVA 4P52A 4R5PB 3DOKB 3TZZA 3SYZA 5C5JA 3A8JA 4DPXA 1UJ5A 1IVZA 3MMAB 4ECQA 1U24A 4RNNA 3M30B 2H1YA 1R7IA 1ZPVA 4WE1A 2DTJA 2RB7A 3U7JA 4J9LA 2B4UA 2JZ5A 2P6SA 1VMBA 4ED8A 3G6VA 1SKSA 4WXOA 3TR5A 4Q8FA 3F0NA 2K7KA 2GVDB 3Q2SC 3SQOP 4NYOA 5IQQA 2B4OA 1VRTA 1N33J 3BO2A 2KO1A 3C66A 1IWAA 1RAAB 2VG7A 4ES1A 3KHGA 1U6FA 4MYTA 5JUMA 2EKYA 2V2KA 3FEYB 1YBUA 3GJQB 3U27A 1NK9A 4LF6J 3TVYA 4TU9A 4I2PB 5DG8A 4YR3A 1Q82T 4DSIA 2I9SA 3AD9C 1N33F 4M1KA 3KFWX 2DEIA 4PG4A 4AFFA 4F4WA 4KB7A 2W7PA 2ASLA 4ZPVR 2V63A 4ZVTB 1EETB 4WU2A 3AT1B 1MLAA 2VPYB 3PTWA 4FPRA 1DFDA 4WFXA 2VFRA 3MPDA 4IFYA 2BKOA 2HNZA 2JRSA 3NLCA 3P5TL 4I69A 1S9GB 3MMBB 4OLOA 2V5HG 1B7YB 2KG0A 1WC3A 2HPUA 4EBDA 3MEKA 2XO6A 4FS1A 5IXUA 1G7CB 1YDLA 3ITHB 2F4FA 5KAKA 5LXRA 2ZH1A 3LTOA 3G8SA 4ECRA 2GAGC 2R4FA 4I0WA 4DL6A 5KFJA 2R7UA 2OGUA 3I82A 3QLHB 1JLCA 3KK1B 3KNGA 4I2QA 3FCVA 5DZ6A 4N56A 1TUGB 3BKUA 1SJ1A 2WVEA 3W5ZA 1KBRA 4WIQA 2NZ4A 4DQSA 1QTMA 2LU1A 3CSKA 3PFEA 4D3HA 3U1NA 1HW9A 1U8SA 4NXMF 3W61A 4NX9A 4LSLB 2ZC3A 1JJCB 3GZ7A 3N9UC 3TJ9A 1RT7B 3CO9A 3W5XA 4ID5A 2MQPA 3M2UA 1NK6A 5IQ6A 3CC4S 4NPOA 3UN2A 4CTAA 3KLEB 3MR6A 2Z2ZA 2VJUA 5IV3A 4F04B 4JI4F 4MKAA 3SMZA 3EGNA 1VHFA 1YJRA 3HKWA 5HVFA 4I4BA 1HR0F 2G13A 3NG8A 2EK1A 4I1TA 3EPGA 2EPIA 2SXLA 1IBCB 2J0SD 1R8PA 3EGZA 2HNDB 4IRDA 1YKWA 3VQSA 1R8BA 1MMNA 3CC2S 1ZOTA 2HFUA 3I55S 3PVXA 1CC7A 1RYSA 1HBMA 2CRLA 2FIUA 2ROPA 4DL0C 2X1AA 1WI8A 1RK8A 4LVOP 1QAJA 4L73A 3JS9A 3G6ES 2FGOA 2RHSB 2VA2A 1QSSA 3EGVA 3BDEA 4EFAC 2V67A 2MY7A 5F8GA 3OL7A 2DGXA 1TAQA 2GMJA 3SIPB 5KFXA 5HMZA 5D0HA 2YX7A 2YQ1A 4R0JA 3M9MB 3FQLA 4ZLPA 3TQEA 4X66F 3W64A 3KG4A 1F1BB 3LGMA 1C1CB 4PWDB 2E5IA 4R8UB 1NKEA 3KK2B 2RNEA 1YJ9S 1RA7A 3HM9A 2PDAA 3OR2B 4X64F 3QGIA 1AA1B 2BE2B 5KFMA 4K4TA 4ED6A 2BQRA 1D9FA 2DEJA 2MYFA 4U96A 2DBBA 1OY6A 5LXYA 4B3SF 1SV5B 3BYRA 2W2PP 1FKPA 2BOPA 4CWBA 3RRHA 3VV2B 4NYPA 4YHHF 4M5DB 1JKHB 5IWAJ 1XERA 4ELTA 1FXRA 1LFWA 1RBLA 3EZUA 4IH5A 2COLA 3DOLA 4USIA 2JSXA 2J76E 1WG1A 2L48A 2AZ1A 4P73A 3HVTA 4WF9Q 4DV3F 3IS9A 3FDSA 1N36F 2LQ5A 4QJVA 1RT3B 3U1LA 4DPOA 4NA1A 3EPIA 2XULA 3W2WA 1IKVB 2B8QA 2JH3A 3PW0A 3TAMA 4JYAJ 4J7CA 2WSCC 3EMTA 4DS5A 2ASDA 2E1MC 1TMMA 2K8GA 2RJZA 4ELUA 4I6AA 2E5LJ 1UFLA 5CQGA 5D4NA 2HS0A 2AT1B 4DV7J 1RWOB 2PGCA 2CA9A 3A3NB 4L3NA 2GHWA 2B4PA 2BJ8A 1RHRB 5M2UA 3JQJA 3QIDA 1S1WA 4M5LA 4ZPAA 4DV1F 2ATCB 5RUBA 3EUNA 3M8QA 2AP6A 4F02A 4IOAQ 2VD3A 1JXEA 2APOA 1YJ7A 1IBLF 1KQFB 2PFDA 2QL9B 2YNGB 2XS2A 1N6QA 4ZP6A 1K73T 1S77D 3GU0A 3DGPB 3VAMA 4ILMA 3C6TB 3M30A 1DQAA 1N0VC 2CJXB 2B7BB 3NL0A 5I42B 2E7VA 2KRBA 2XEXA 4ZPDA 4ZVUB 2IVFB 4BHQA 2CPYA 1UVMA 4JI3J 2X3GA 2MPUA 5E3AA 2FPHX 3LGNA 1PG5B 4DL2A 2BQUA 2E1CA 5GADI 1U6BA 2XB2D 4I7FA 3QJLA 4I67A 1TKTA 1R8AA 1AYEA 3QGPA 3PIPQ 1YG0A 2IRUA 2LEBA 2BDPA 3FGVA 3K17A 4QWEA 1UVJA 4QYZJ 3HVRA 3W63A 1TK0A 2LXIA 2IBOA 4FNHA 2FD2A 1CJTA 5J2NB 1B99A 2ZBCA 3THVA 4J9RA 1AW0A 1N5YA 2CWKA 2DK2A 4CT9A 5AE3A 1M0SA 2HFVA 5GMDA 2ZE2B 3IMQJ 2GS8A 4P2FA 3X3UA 5LT5A 3I32A 4F36A 3N5FA 1QAIA 4LRCA 4N5SA 2YNHA 3J7Z5 1D0EA 1HWIA 2WONB 4ED3A 1REGX 1XMQF 4TN2A 3KMSA 5BXIA 2DNOA 1FRHA 3MMCB 2UP1A 4PRFA 1T9WA 1WKKA 5F9LA 4DFPA 1O0PA 4WYLA 4LBHA 5T7LB 3I4HX 3G4SS 3HULA 1NKBA 4ETZA 2PA3A 1S57A 2XMMA 4LRAA 4WKYA 2KHDA 4DV4F 2EVZA 1VRUB 3FZ2A 4IRKA 2XQCA 3UDEA 5D3GA 4X4QA 3LQVA 2N7CA 1UEVA 2KYZA 2MKJA 4YB1P 2MKIA 3UD4P 1H74A 4ED4A 4FS2A 4L75A 3UQSA 4XIUA 2N3LA 2KFYA 1YJTA 4LBIA 1RACB 4DX8H 4PPZA 4ZPBA 5KG1A 1HQUA 1JLCB 3KK1A 2C3UA 2KXFA 3LF0A 3R7BB 2ZUGA 4X65J 2ZJQQ 1HWUA 2HFNA 4GRSA 4C9DA 2IA6A 3R2CJ 2IAJA 5K20B 3L7UA 5HK4A 2V9WA 3CPWR 1WC0A 1X9MA 3QFWA 2CG4A 1DQ8A 4GVBA 4AE5A 3MM6B 4DI6A 1LW2B 3GG1A 3BKTA 2CQHA 3CJ4A 3FSYA 3T3FA 4DF8A 4A8KA 2MDAA 3C8YA 3QMQA 4RBUA 3T9ZA 1S1VA 3W2VA 2UXDJ 2DYAA 1UVLA 4LF7J 2BJ7A 2B6AA 5DLFA 2ABYA 2XSFA 2GC8A 1FD8A 1KVKA 4PCQA 2HHHF 2FVCA 2XSJB 3VAIA 4H4OA 2V8HA 3HMJG 1IWGA 3GCWP 3KJFB 2EFGA 2FUG9 3KJVB 5E3CA 3P3DA 4F3QA 3BKFA 3OTDA 2LMIA 1UWBB 4PXCA 3M8SA 3SFGA 2VFTA 3MHYA 3SDEA 5CYQB 1H3DA 1MROA 5CD4A 1NK0A 3I31A 5KFCA 3VGUA 4WJBA 4ZP8A 1RAJA 1TUVA 3FBFA 4U6PA 3FVYA 2ZWOA 1U25A 4OZJA 2YVSA 1P1LA 3GFYA 4N7TA 3M6VA 4O44A 4PWDA 1URRA 2MGZB 4O3SA 3O6QA 1SL0A 4DSFA 3TAQA 4LT6A 1TR0A 3PY8A 1RTDB 3N5BA 1Q53A 3M32A 3OFFA 4NEZA 4RNHA 4DS4A 3QRQA 2UUBJ 4C8OA 1UVIA 4NLYA 1WHVA 4C6AA 3RBEA 2W25A 3GE9A 1N5TA 3B78A 5THWA 4O3PA 4F4XA 4LIRA 2R2SA 4WFNQ 1LWFA 4O3QA 3JTNA 4IKAA 1A9NB 1K0TA 3M8WA 4C2MA 5IT9Y 4YUDA 4ECVA 1S76D 4FP9A 1DTQB 3V6HA 1X7VA 1ZAWA 3DLBA 2C2NA 1MWQA 3GYNA 1Y5NB 4Y28C 3J7ZT 3QAEA 3T1YF 5LJ5Y 4X4RA 5K9FA 2B4VA 1VC5A 1LXNA 2RS2A 3M1VB 1CULA 3R9LA 2CZVC 1YQHA 4ZCKA 2OELA 4WFBQ 1WOSA 4PG6A 1S79A 3MMJA 2O67A 3HFKA 2OEKA 4QR1A 5KG5A 2D3UA 1YRXA 4Y34A 1KEKA 4KTQA 4X66J 3GR1A 2H9ZA 3W65A 2YNFB 4YB7A 4OJ3A 2BANA 5EX0A 4X4NA 4ZA1A 1Q81T 2B56A 1N5VA 4UY8T 2FB0A 4K7QA 5BYRA 1U1MA 2HVEA 3EICA 3CDUA 4QW8A 2CPIA 1N34F 3WX4A 1QAXA 2JL9A 5DZ7A 2H54B 1D9AA 4M8LA 1K1SA 2M2BA 3L09A 5EHHA 5HMYA 2ZH8A 1TL1A 4WCEQ 2OEJA 1NK4A 4JV5F 1AXQA 5J2QA 1RI7A 1BQMB 1WDTA 4R25A 3G96A 4NWBA 4QIGA 1WC6A 5D15A 2CQ2A 4DCPB 2MZ1A 2ZBQA 3B8HA 4F3OA 1RKJA 1LWEB 4RR5A 1KFDA 2AEFA 4E98A 3ILJA 3R1HA 1WEYA 1EZZB 5GVQA 3G8TA 1P1TA 4KHPJ 2B43A 2I8EA 4E8UA 3T6BA 4A8YA 1UA0A 3IRXA 2AW0A 2HAIA 1FHTA 4K5RA 2KJWA 5B0AA 4AYBD 4OI4A 5A8RA 4G1QA 5CA5A 2D3O1 1X0PA 1KTQA 4YDDB 3GCXP 3LP1B 1QY7A 1RHMB 2EI5A 2ROEA 4LF4F 4OYAA 2KJVA 4OHVA 2RDJA 2C2ZB 2GO9A 2O01C 1HFEL 4KIAA 3T1YJ 2CNKB 2OH2A 2FDNA 3JSBA 1BQXA 4MMOA 3OJSA 2AMCB 2ZUAA 4UOCA 3JAMU 3MR5A 2FQQB 2I5JB 3E01A 1B3TA 4CZCA 3CD6S 4ZVEA 4DR6J 1VRTB 2CIMA 1ZM4A 3CJ3A 3DXSX 2CPXA 2P2CB 3DLKB 2QV6A 4JV2A 2OSRA 3MM7B 4TVAB 3DC2A 4B3MJ 2ZBIA 5K8MA 1AROP 1RCXB 3FMWA 5KFKA 1NJXA 1U7LA 3DRYA 2R3VA 4M95A 2FJVA 1UFWA 2G9OA 2WVDA 3K5LA 1RAOA 3UFCX 4ETXA 2V50A 2AYBA 3MTJA 3I5BA 3T1HF 1C0TB 1JMTA 4XTTA 1XIQA 2B0GA 4RWXA 2BZ2A 5IWAF 4JI3F 2VOPA 4C0OC 1NDKA 1WSRA 3NBPB 3KLVA 4DV5F 2YQ3A 4RUHA 1VFJA 2FHJA 3D7SB 4CLUA 4J9MA 1N34J 1T7PA 2MHNA 3DU5A 1G3OA 4IO9Q 1R89A 4WWSA 3ZZRA 4DQPA 2DGSA 3HZEA 4MK7A 4DV7F 1AZSB 4OI3A 4JI8J 2W1BA 2IJRA 2Z8QA 3QYYA 2QFJA 3HP6A 2QMXA 1I94J 3QIPB 1VLOA 4KHRA 1IBMF 2CPHA 3ONQA 4N8OA 3VCDA 1RAEB 3PJ9A 3TP2A 3C6UA 4QWDA 2KXNB 2U1AA 4DUYF 3W2VB 4B17A 1L3TA 3J7A1 1IBLJ 3K89A 1RWXB 1ICEB 2LVWA 4PABA 2EBEA 5EN1A 1RBOB 4DN0A 1CC8A 2DHHA 1KHVA 2W9AA 1WEZA 1FE0A 2CQIA 3JSRA 3IWXA 1KTVA 4OZ3A 5ETOA 5KT6A 3N6MA 4KHMA 1OWXA 4OZ5A 3X1LB 4K0KJ 2IPOB 4UZCA 2QLJB 1U2CA 4I2PA 2F40A 4KRWA 1VISA 2LQ9A 4U95A 2ZD1A 2CZ9A 2Y3YA 3THPA 5DM7Q 5L39A 4B3TF 3GSIA 1S7IA 4DEZA 3UE2A 1NKCA 4CLTA 4CNZA 4NASA 4ANCA 4C0HA 1GTEA 3V6KA 2KT5A 1VQ7S 5D4PA 1RHKB 2V94A 1S1UB 3OTOF 2OIHA 5E0OA 1HYSA 5D78A 4C3MA 3U02A 1OO0B 3AD7C 5EGYA 2DY9A 2GW8A 1A0OB 1S9GA 1FDBA 3N0VA 1OPIA 1IXKA 2NSBA 4WU3A 5DDQC 5A8WB 4IG3B 5KFFA 5LMNJ 1URNA 1S1XB 2R7WA 4DX5A 2KVQE 5I3UB 2GMHA 1ROFA 2C2KB 3MTKA 4IH7A 2HHQA 4Q43A 1NH8A 2D74B 3POTA 3PZPA 1ZA1B 2FVPA 1TU0B 2XM3A 4ECTA 1R31A 4LR9A 1D9DA 4F4KA 3HJFA 1X4FA 3MEGB 1HHQA 4FN5A 4IYQA 4MK8A 1BY9A 4OYMA 5BJRA 1X4EA 3AODA 3IR6B 1M5KC 1OY9A 2RDDA 1NJZA 4LRDA 2IC3B 2XZWA 4P75A 3NCQA 3AFGA 2C28A 1XMQJ 3HK2A 1JLBA 1BGXT 1SUQB 1Z2ZA 2EFVA 4JI8F 1T0TV 5DETA 4ICLA 3MAAA 2BM1A 3BPSP 4YOEA 2OFHX 1SQFA 1GT8A 4AL6A 2VQFJ 3Q8PB 2VDIA 1F5AA 3ZZZA 2CQGA 4IQXA 1AB8A 2FVQA 3CCQS 1EARA 1Q8LA 2U2FA 3ETOA 4UQGA 2XLKA 2F5GA 2XYPB 4RLEA 3R5JB 3KUGA 2AX1A 3UD3P 4DPTA 1U49A 1F9FA 3V4IA 1YWXA 2HQCA 2LQBA 3FSXA 5IC6B 4L3KA 2J7WA 2IDEA 3IC1A 4HACA 4M5GA 2BJDA 4XAKA 4CDIA 1JB0C 2NXJA 3R97A 3TUIC 3UR3C 1MW7A 5DDOC 2ZH2A 1S6PB 4DR2J 3RTVA 2DGWA 2G0JA 3TOQA 4LF7F 5HJXA 1RT7A 1IUJA 4OYPA 2KVIA 1RAGB 2H5EA 3ENAA 3GJRB 1SI9A 3W8GA 1TK5A 4JI0J 5BR8J 4DL7A 4IUFA 1F3VA 2IVMA 4QIWD 4IR1A 3H40A 3ZTQA 1HI0P 4FKYA 5HP1B 4PG5A 3CJRA 3G6YA 4Q0BB 3DMJA 2GVZB 1Q7YT 3TAMB 5J1PA 2FJEB 2PT0A 5J2QB 1RHJB 3CJQA 3Q8QB 1MG7A 1TKXB 2OPSB 1KONA 5B0CA 3PX0A 5B0GA 2VKZG 2ZVSA 1R8HA 4O0NA 1RTZA 3UN3A 2QA4S 1PIEA 3NGRA 2XY6A 2DGVA 1RT1B 3D67A 3VALA 1TELA 1UP1A 1PSDA 2Z57B 3ISZA 1T3NA 1S1WB 2E5JA 1AT1B 1FEEA 1FDNA 2VC0A 2Q43A 4CO2A 5A2QY 3MWBA 3RB3A 3KNAA 3M8PA 2ZNZA 1B0TA 3HZGA 4U8YA 2UVVA 1YSJA 1Q7LB 3FKBA 5A8RB 3PR5B 2GIQA 2R2UA 1CLFA 5L9NA 3UR0A 5K14A 1Q1KA 3IBFB 4USJC 1C1BA 2UUBF 2YKNA 2P9GA 1JLEA 1HBOA 4RJVA 1JWWA 2HG4A 3W66A 2VQFF 1KVJA 2BJEA 1JQGA 2JWNA 4C11A 4FXVA 2X51A 3T41A 2IY5B 3NEKA 2BE2A 4I7FB 1DQ9A 3KJNB 2ZBPA 4WK1A 2BA9A 3TNVA 4E0DA 1J5OA 5HO4A 4AXJA 3RAQA 1KLMA 1IKVA 3AY0A 3DLKA 4LF6F 1CBKA 4NLOA 2QFIA 5H9EJ 1EP4B 4B9NA 4LF2A 4O23A 1FA0A 1XK8A 2FVSA 2M52A 1NLKL 3H59A 1DJ0A 4EEYA 2GIRA 2AGQA 4X4VA 4X4UA 4M5DA 3FJ2A 1FRMA 1M1KT 3W9IA 7FD1A 3DOLB 1S6QA 5D0RA 5KT3A 2RVJA 5DS7A 3OVSA 2XCPA 2JLFA 2IM0A 1RB0A 2CPDA 2YNHB 2YWFA 1X5SA 3OFGA 4WFZA 3QZ7A 4LBPA 2ZDOA 4C48A 2IMOA 4ILRA 2ZC4A 2AJ0A 1JJ4A 1Y4ZB 2RMLA 2B51A 3BM7A 3PG9A 3LUYA 4NL5A 1HMVB 3LALA 4LVNP 1M5PC 4UY85 3H2UB 4FVMA 1N6QB 1VK3A 1TP7A 3LH2S 1N4LA 4W4MA 1KD1T 4OV6A 4FF2A 1AZSA 2EG1A 3SEOA 3CE8A 1S0NA 4PWUA 1M90T 1OS5A 1QVFR 2OAUA 4ZVSB 3W7BA 2QLFB 4USTA 4J9UE 3GFXA 1VQSA 3K8WA 4G65A 4CO5A 3OD2A 2M70A 4YN3B 5KFTA 4ITSA 2G0CA 2VG5A 3G8QA 4ZPCA 3RUBL 3ZO7A 2ALZA 1FJEB 2KT2A 2HW3A 1XWLA 2KL8A 3JXOA 3CCVS 1EKRA 4A4JA 4WYWA 4ANEA 5DJBA 4CP5A 4TU7A 2MQMA 1HQEA 2RU3A 5MAOA 4G1IA 5HN0A 4MKYA 3I0RA 2OPQA 4JI4J 2DHXA 1MN9A 1R43A 3OXGA 5KT2A 1SIWB 1FNXH 2G2ZA 2C3PA 4AUKA 2HQ3A 1RTIA 4ELVA 2UXBJ 3EZ5A 1S9EB 1H38A 1HPZA 2Z4PA 2MKKA 4CH7A 3NAHA 1TL7B 1N88A 2V2ZA 5C2CA 4MT1A 3Q8SB 2DISA 2YH0A 3WC2A 4RKUC 2CADA 3Q8YA 3IGNA 3NY0A 3IN5A 3ILLA 4NZ0A 1N32F 2GIFA 3KLIA 4W90B 2HRTA 1EETA 2FTRA 5DG7A 4JI5F 1T3OA 5F0WA 5AXKA 2GCFA 3DRPA 2F9DA 3US5A 1YTYA 4PKDB 1IKWA 1P27B 3IO1A 4W98A 3E3XA 4L76A 1G4CA 3QRPA 2N4DA 1RCOB 3SBMA 1APSA 3EWGA 3VGVA 2YKMB 3QAUA 4NA2A 2XLIA 1V6HA 1VQYA 2CQPA 4MAKA 4Y2MA 5KFWA 4DPUA 4CH1A 1KC8T 2FJBB 4OQJA 4DV5J 2E5GA 1XNQF 2AYMA 1VHIA 4Q45A 2MGZA 1KKHA 2CG8A 5CZXA 2PI4A 4URSA 1NM2A 2A0FB 4H4KC 4HDGA 3T9NA 8RUCA 1X60A 2B6AB 3BBBA 2IJFA 4OZ0A 5E33A 4B08A 4RW6A 3HHLB 3BSCA 1GK8A 4LF5F 2CPJA 2RQKA 1TKDA 3A8IA 3ILOA 3V4IB 1IBMJ 2FLNA 2IAJB 1RT5A 3OLBA 2HHTA 1R0AA 3J7YU 2HHUA 2W7AA 2D3ZA 3ZC4A 4UUXA 2MKYA 3IG1B 1RQ0A 2M9KA 3AA8A 4ZS6A 2HFSA 3ELHA 2X3DA 4CTAB 2ALYB 4FPIA 2QJ3A 2RUSA 1S4EA 1HI1A 3LGHA 2NYHA 4NE9C 3WIVA 3G6XA 5DGAA 3IM8A 2J7KA 3V4MA 2ILZA 4TNOA 4IG0A 1HWJA 2CQBA 1BHNA 3RBZA 4YP3A 1U0HA 1B64A 2C2DA 5KFRA 4C4WA 2PO4A 2HQFA 2LXFA 3BDPA 4H4OB 1IM6A 2WSFC 3QGHA 4EZ9A 1TK8A 1TKZB 1R6YA 2G2YA 4X2BA 1RLDA 2OPSA 2B3TB 3KJVA 2Y1RI 3CD7A 3M32B 2HWIA 5D6GA 3MUTP 5IZHA 1HQ2A 2E44A 1ZAVA 1BWVA 5J1EB 4DMZA 3QFHA 1KFSA 1XNRJ 1IR1A 3LPYA 4RX6A 2UU9J 3TUZC 4CNYA 2W24A 1NHKL 5ETTA 4YY3J 1D09B 2DB1A 2V6AA 2YKAA 1WF2A 2A10A 1DTQA 1U0SA 4YS2A 4B3SJ 3DM2A 3H90A 3MR3A 2XI2A 1RSCA 4R8UA 5A8KB 2N3OA 5KFQA 3PO5A 2HBRB 2E9RX 3QWPA 2EG2A 4PWWA 1YHQS 3MFIA 2VODA 2AGPA 3AA9A 2R2RA 1GEHA 3H2LA 3ZTSA 5LMNF 3MD3A 3BQ1A 4YR2A 4ZK7M 2XO7A 4WP3A 1KQSR 3A3PB 2J0XA 3MFHA 1PAUB 1FXDA 3TARA 1N36J 2EEYA 4UTGA 5B0DA 1T11A 5KFPA 1WHWA 2JLEA 3TJ8A 1ZS6A 3KKFA 3ZXWA 5F3ZA 1YI2S 5EWFA 1E6YB 1VIXA 3RBDA 1KS2A 1JKHA 1V3RA 1ZH5A 3JSMA 2Y1LB 2ZHBA 5L1LA 4NLQA 3JTOA 3N01A 3Q86A 4JUZA 3KK2A 2F4VF 3KLEA 3MEDB 1F5CA 4DX7A 2EFNA 1HNIA 5F8IA 2M0GB 4JB8B 3TUJC 3FEZA 4ES2A 4ID8A 5HL7Q 4RL1A 4C8ZA 1GH8A 3W5YA 2W8LA 1HMVA 4DV4J 3UCZP 3AAWB 1SV5A 2Y0SD 1MU2A 1Q5VA 4USUA 2HNDA 2M8HA 3SFUA 1KHWA 4CYUA 5LSLA 1VIOA 3E51A 2KFNA 2V8PA 3KLGA 2MQLA 3MM9A 2Y8YA 3MD1A 3SQGA 2QL5B 2CYYA 4LF9J 3R5GA 2J6SA 2YKOA 3D6FB 4EWTA 3DRSB 5IT0A 3EX7B 4H4MA 1JLGB 3GFZA 4GO7X 3C15B 1T9UA 1YZ7A 3IS9B 2UZAA 5EX3A 2XHCA 4K2JA 2H5JB 4PPDA 4Q44A 3ISNC 2UUCJ 2YNGA 3W2WB 1U45A 4V19X 3JB9k 2DXEA 1O8BA 2QSFA 1YIJS 1PC5A 2N7YA 5IFMA 2VIHA 3AXKA 4GC7A 2HLUA 3DLGB 5I42A 1NCLA 1S6UA 2DNMA 2OFGX 3DCAA 4DPWA 2ACMA 1L3VA 4B9SA 3J80U 2Y9HA 2XLJA 1ELOA 3OR2A 2I5JA 5KG7A 4QYRA 2DRAA 1U2RA 1VBYA 2FYXA 3OFHA 3W9JA 2BMBA 2JEJA 3NMAA 3UCUP 3CC7S 4OYZA 4C8LA 4ZMMA 5L1KA 1S9EA 3J80Y 1CJTB 1Z1ZA
chains in the Genus database with same CATH topology
5KFGA 3CDBA 3H98A 3ZFVA 2V4RA 4G1QB 1NK5A 1ZM9A 4KBIA 5AE1A 3RRGA 4NOHA 4PG7A 4CCHA 2YX1A 1C0TA 3GR0A 1HI8A 4FZVA 4DHVA 2M8DB 2QMWA 3CD5A 4I6YA 4TYAA 4DQQA 1DHMA 3V6JA 3DYAA 3MAHA 1FK9A 3RU0A 4LFBF 2WRMA 1BD6A 3MM7A 5I3QA 4DLGA 2LA4A 5F8JA 1R27B 3FEXB 1ZZNA 4Q7AA 1A6LA 1X9SA 1WF0A 2R7SA 3PKYA 2GX8A 1GX5A 1P8GA 3QIPA 1UJ6A 3RR7A 1NAQA 1C4CA 3OHBA 3LP2B 1NK7A 1VQ5S 3M6UA 3MPVA 1JX4A 2HHWA 3HO1A 4P7TA 2ZH9A 2ACYA 4RW6B 1S72S 3ENQA 1VS3A 3HHLA 3RR8A 2UUTA 4B3RF 1N52B 2UUCF 4ZCMA 4QOTA 2RE1A 2F8MA 1LW0A 2AQ4A 2ZFHA 4BC7A 4DJBA 1VQKS 3AH6A 5CXTA 1SIZA 4ECWA 2RU9A 2CVEA 2GA7A 4FYDA 2OTJS 2D9PA 1XEZA 4A47A 1VQ8S 1S99A 2E5HA 2Z2LA 1HYSB 4KV8B 3T5HA 2KTQA 2NUUG 3H5XA 1K8AT 5J2NA 2JFDA 1FVQA 2KHCA 4N77A 3AQOA 4NLSA 1A7GE 3JYTA 2DNNA 2CQDA 1JLQB 5HLFA 3UW1A 1U1QA 1HNZF 4TY8B 4IR1A 4NRUA 4JBCA 4Y6IA 3MGJA 4HYKA 5F3TA 5K8NA 5J1EA 3B82A 5HP1A 4LSNB 5T7LA 4DFMA 2FJWA 4N41A 5C42A 4A8MP 2RILA 1HHSA 4QZVB 5D4OA 5JXSA 3T5LA 3HKZD 4QWCA 1FJGF 2GHVC 1TKXA 3FMBA 1FDDA 2CJBA 3CB4A 1R8CA 1D8ZA 1RTDA 1Y00A 2P9CA 2JFKA 3CCTA 5D77A 3GIJA 1Z4UA 4K4SA 2IYGA 5DLGA 2OPPA 1B0VA 2MMYA 1RYRA 3BF4A 3DDNA 5KG4A 2AF6A 5FLXY 2D7SA 3EYZA 4JI7F 3H5UA 5E2QA 4ZP9A 4QIFA 1FERA 1JLBB 5L38A 2DNPA 5CD4H 2VOOA 5KOXA 5K14B 4U67Q 3Q2TC 5KFEA 2RRNA 2GQ2A 4LQ9A 2KZMA 2NUHA 3QLHA 2VBXA 3RAMA 2G4BA 3P49B 2O3DA 3R5AA 4GMKA 4BC9A 3OBIA 2DNZA 3NGDA 4XPEA 3I96A 1LWFB 3NRBA 4PXDA 4ZDNA 2AV5A 2XSJA 2MB0B 4Q2LA 2P9EA 1JNRB 4KT0C 1CG2A 3CCLS 3TANA 3BREA 4K50A 1UWBA 2L9WA 4KO0B 2EFOA 3PEJA 4B9VA 3BSAA 3I4PA 3IRWP 2GV1A 2BUNA 3WDOA 4DR5F 3OSNA 3BGRA 2DR9A 2CDQA 3FSIA 3CEDA 3ZZ0A 2CJ9A 4Q0BA 1UMJA 1X5OA 1JNZB 3F41A 1IR0A 2AJQA 3BR9A 3LO3A 1H2TZ 3PW7A 4QWAA 2V4QA 2ZNYA 1H0HB 6FDRA 2WBRA 1Y7PA 2ZH3A 2R7TA 2HHXA 2FHOB 1I1GA 2JEFA 1TL5A 4EBEA 4KGKA 3CIZA 5KT5A 1RA6A 4URQU 2RT3A 4N8NA 3T5JA 4ATNA