4PWDA

Crystal structure of hiv-1 reverse transcriptase in complex with bulge-rna/dna and nevirapine
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/rna/inhibitor
molecule keywords HIV-1 Reverse Transcriptase, P66 subunit
total genus 137
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4pwdA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pwdA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pwdA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pwdA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4pwdA05
5KFGA 3H98A 2V4RA 4G1QB 3L2UA 1NK5A 4KBIA 3RRGA 4CJ3A 4CCHA 1C0TA 3ASMA 4DQQA 4TYAA 3V6JA 3AVIA 3DYAA 1FK9A 2WRMA 4CHOA 4DLGA 1Q9YA 5F8JA 1X9SA 1Y97A 1GX5A 3ZSOA 1J53A 3QIPA 4CJWA 1WN7A 3RR7A 3OHBA 5CZ2A 3LP2B 1NK7A 4Y1DA 1JX4A 2HHWA 3HO1A 4RW6B 4ZTFA 1CZ9A 3RR8A 2UUTA 3NGYA 1LW0A 2AQ4A 4ECWA 4FYDA 1HYSB 4KV8B 3T5HA 2KTQA 4BE2A 3H5XA 5J2NA 4NLSA 3JYTA 1JLQB 5HLFA 4IR1A 4TY8B 2IS3A 4QOZB 4NRUA 3V9ZA 4HYKA 5J1EA 5HP1A 4LSNB 4DFMA 2FJWA 4N41A 5C42A 4CIEA 5JXSA 3QEIA 3T5LA 1CLQA 4QWCA 1TKXA 4CJSA 4CEFA 1RTDA 3GIJA 1Z4UA 3ZCMA 4K4SA 5DLGA 2OPPA 3VQ8A 1RYRA 2DFHA 5KG4A 3A2FA 2D7SA 3EYZA 3H5UA 4ZP9A 1JLBB 5K14B 3WNHA 5KFEA 3HL8A 2D5RA 4LQ9A 2KZMA 3QLHA 2G8UA 3NGDA 1ASUA 4XPEA 1LWFB 3AVMA 4FLVA 3TAEA 3AA5X 2QXFA 1YT3A 3TANA 2Z1JA 3BREA 4CJQA 4K50A 1UWBA 2D0CA 4KO0B 4B9VA 3BSAA 4CGJA 3OSNA 3BGRA 3FSIA 1NOZA 3OVNA 4CFCA 4Q0BA 2AJQA 2OZMA 3BR9A 3PW7A 4QWAA 2V4QA 4CECA 3RWUA 2HHXA 2JEFA 4EBEA 4O0JA 3U6FA 3CIZA 5KT5A 1RA6A 4URQU 3T5JA 4AHRA 3H5YA 3CDWA 1JLAA 2RF2B 3OJUA 4FJXA 5HROB 4DF4A 4B8AB 3QO9B 3DI6A 3T1AA 4FJJA 3CDEA 4Z4HA 2VG6A 1JLEB 1RDRA 5L9XA 1GOAA 2WCXA 4KB0A 4RU9A 2VA3A 4KB1A 1T94A 1HPZB 1TV6A 1BQNB 2WHOA 2XGPA 3CM5A 1S0MA 1S10A 5EWGA 3HT3A 4AHUA 1S1TB 4NLDA 1YVFA 4Y2CA 1HRHA 4ECZA 1HQEB 5EUHA 3DLRA 1A5WA 1SL1A 5FDLB 2Z1GA 3MXIA 1WLJA 2LSNA 4ZVGA 1D1UA 3NBPA 1IKXA 4B8CA 4XO0A 3NF8A 5KFLA 1DTTB 3BQ0A 2HWHA 5HLFB 3KOAA 3IG1A 4KHNA 1W0HA 5EDWA 4CK3A 3N6NA 1LWCB 3DRPB 3RMAA 1SH2A 4NLPA 3IGVA 4U7CA 4DSKA 5DGBA 1RDAA 5F8LA 4NYZA 4LQ3A 4ZVHA 2BGGA 3QIOA 1TKZA 2X78A 2ZD1B 3CYMA 2OPRB 5SWMA 2DFFA 3V9XA 4E19A 1L3SA 5DQHA 2IC3A 3SCXA 3T19A 5KG3A 5EWEA 3CFPA 2AX0A 2ASJA 2R8GA 1ZBLA 1S1XA 1SKRA 1BIUA 3U3YA 3AVGA 1VSMA 3LAKA 4DFJA 4JLHA 2HNYA 3HHKA 4EP5A 4ICLB 3JSMB 1LAWA 1R0AB 1RBTA 1TL3A 5DQIA 4CJPA 2B5JA 5KG6A 3KHHA 4CF0A 5DG9A 4IG0B 1NHVA 4JS4A 2R8IA 2XHBA 4FM1A 3BSOA 3S3MA 3ZSYA 1S48A 2O4GA 3OYEA 5J2PA 1ZTWA 3OHAA 2W9BA 4O3NA 1JLAB 3FRZA 4N76A 3QO9A 3LWLA 4NLUA 5KG2A 3H4BA 2FBTA 2FBYA 4FZYA 4AHTA 1RILA 3ZSZA 4ZVFA 4CHPA 2HMIB 3SI8A 4EO6A 3SQ2A 3L3VA 1JXBA 3TWHA 3SQ4A 3VQDA 4FW2A 4FJHA 3ZT2A 4JRPA 4OLBA 3UIQA 1XR5A 3KLHA 3BQ2A 2IJNA 2JEGA 2UVUA 5HBMB 3LPTA 3DLGA 3QEWA 5CYMB 3SZ2A 4CF2A 1RT1A 2VWKA 4CJEA 3L2RA 2KW4A 2VG5B 1WNEA 1WSEA 3KD1E 3L8BA 3F73A 1TL1B 1K1QA 5KT4A 2YKNB 3OL9A 3SUOA 2OPQB 3AVFA 2XCAA 4F4YA 4KKOB 2XGQA 5DQGA 1WAJA 1FK9B 1U47A 1ZBUA 1KLMB 4KV8A 3I5AA 1NK8A 1Q9XA 4RW8B 4FK4A 1XHZA 4JV1A 4DLEA 1RT2B 4J9PA 1JL1A 2DPJA 4DL5A 3U3GA 4CEDA 3I0RB 3M9OB 3MECA 1N56A 4I9LA 4K4XA 2BRKA 3D0PA 4CGFA 2V0NA 3DYAB 1IKWB 1RTIB 4M3ZA 3GILA 2G8HA 4FJLA 4MFBB 1XI1A 2HNZB 2A1RA 1L5UA 1BIZA 3NKYA 3V1RA 3CWJA 4YMEA 4PQUB 1VSKA 5KFSA 1BISA 1HYZA 3SPYA 4K4WA 1C2PA 3KK3A 4Y2AA 4NLWA 4FLZA 2C22A 4CFDA 3GV5B 3QNOA 4CJKA 4C8NA 2AGOA 4TY8A 4LSLA 4J2BA 4CK2A 4LSNA 2ZKUA 3H5SA 2E9ZA 3FFIA 4O4GA 3KMQA 3OYNA 4TY9A 3VQCA 3SI6A 2RDIA 4C8MA 4K4ZA 3H08A 4K8ZA 1VSIA 4F2RA 1RTJB 4Y3CA 4DQRA 1T03A 4FLYA 1RT4B 1SKWA 1JIHA 1C0UA 2WTFA 4I9QA 4ED7A 4EYHB 3CJ0A 4EP4A 4EZ6A 4HCCA 3TI0A 3FQKA 5SZTA 5HROA 2D41A 2R8HA 4KSEB 2HMIA 4JS5A 3DI6B 3ZSXA 4DL4A 4FJIA 1RCHA 4OJRA 3DLEA 4O0IA 4KI6A 1RT3A 4CEAA 3RB6A 3M8RA 4B9TA 4J2DA 3MEEA 1BQNA 3TQ1A 3HPOA 4IRCA 1NJYA 2JC0A 4DFKA 2E4LA 5HRNA 4BDPA 1Z25A 3HVAA 1RT6B 3VQ9A 3MAQA 3BGRB 3I5CA 5KT7A 2BQ3A 1RBSA 2GBZA 4LH5A 4NCBA 4B3OA 3DRSA 3GQCA 4H4MB 4KKOA 1TVRB 3VQ7A 3VN5A 3M8PB 2E6MA 5C25B 2RF2A 4QW9A 3T5KA 5F8HA 3DLHA 3QGGA 3MEDA 2HVHA 2E9TA 4Q5VA 2ILYA 4RUCA 1J5OB 1LWCA 4O4RA 1EP4A 4FW1A 3NGIA 1VSLA 3ZT3A 4MH8A 2IM1A 2PY5A 4BWJA 3KLFB 2IMWP 2FBXA 1DLOB 3UPFA 1S6QB 1JLFA 2AWZA 1REVA 4FZZA 4F50A 4DG1A 3DRRA 3CJ2A 1HQUB 4KFBA 4CFAA 2W9CA 3PO4A 1S1TA 1LW0B 4RZRA 3AO5A 4Y1CA 4PY5A 4Q8EA 4DSEA 2KFZA 4J9NA 3V9WA 4CESA 3LP2A 4MK9A 1KVCA 4I2QB 2EX3A 4DQIA 4R5PA 3OS1A 1BI4A 5DK5A 1DTTA 1RTHA 4IDKA 1GOBA 1IKYB 4DU1A 4ID5B 1KVAA 4TLRA 3MF5A 2BRLA 2C2RA 1GOCA 1KLNA 1L3UA 3QZ8A 4OKKA 2OPPB 3V1OA 1S49A 2YKMA 1ZBIA 1U48A 4EBCA 3S9HA 4B9LA 5KFBA 3I0SB 1B9DA 4MKBA 2R8KA 5KTQA 3NH0A 4O5BA 4F4ZA 3KTQA 1B9FA 3KKSA 2UUWA 3PJXA 3JYTB 3MEEB 3V9UA 4DWIA 1XR6A 2A1SA 4R0EA 4TQSA 4ED2A 2FLLA 2FLPA 2W9BB 2WOMB 2OA8A 2HHVA 3OL6A 1EX4A 5J2MA 3HVWA 1QQCA 1RBRA 4CGGA 1JXLA 5C42B 3LWMA 1VK0A 1FKOA 4WXWA 2UVRA 1SH3A 4AH9A 4IFVB 4RW9B 4CJTA 1T05A 5KFAA 5KG0A 4B9MA 4CHQA 3VQ5A 3L2QA 3GIKA 4K4VA 1J54A 4K4UA 1TVRA 3LP0B 3NAIA 1FKPB 4NLXA 4O55A 3TABA 1C1CA 1VSDA 4CF9A 4RNOA 4IH6A 1GX6A 4ECUA 1C6VA 3NF6A 3TVKA 1D8YA 1ZETA 1EKEA 4EYIB 1S9FA 4WZMA 3AVAA 1RDDA 5F8MA 4CHNA 5HBMA 3RB0A 5C24A 3AO2A 1QE1A 4M94A 3KLFA 3GIMA 2G8WA 2F8SA 4KO0A 2FVRA 5CZ1A 2NUBA 4DL3A 4KPYA 1N48A 1VSEA 4JV0A 3KHLA 4YFUA 4DSLA 3KLGB 4RW4B 3V81B 2CJQA 2IBKA 1U4BA 4J9OA 2XWYA 4PQUA 1XR7A 3NGZA 5EU7A 2P1JA 3V6DA 3PJWA 4BDYA 4NLVA 3PHEA 1N5YB 2W8KA 2IDOA 2YNIA 4RW7A 1U09A 4ZP7A 3C6TA 4Z0UA 2VG6B 1HNVB 1LW2A 2RKIA 2XI3A 4FJNA 4KI4A 1KSPA 3MECB 3P5JA 4YNQA 4ED1A 1S1VB 2DFEA 2J6UA 3DOKA 1SH0A 4DTOA 4YR0A 1MMLA 1RT2A 4IOBA 4AHVA 4GVMA 2FBVA 4NYFA 3WNEA 1IM4A 1UA1A 2WONA 3AVKA 4OL8A 4TYBA 4HUFA 4IFYB 4RNMA 3H4DA 4GC6A 5D3GB 3LANA 1B92A 5FDLA 1RT4A 4JRQA 3I0SA 3ZT4A 3KK3B 4KAZA 3K5MA 4FLUA 4FJ8A 3QINA 4Z4GA 4QAGA 4Z4EA 3GV8B 4IKFA 2HNYB 4WE1B 4E7HA 4C8KA 1S0OA 3O3FA 3MR2A 3K59A 3NDKA 1LV5A 3LDSA 2B5JB 1Z26A 5KFIA 2E6LA 2G8IA 5F8NA 3BSNA 4XPCA 3I8DA 4ZHRB 1QSYA 2XY7A 3PR4A 1T03B 2D0AA 1JLQA 3D5MA 2YNFA 2BANB 3CJ5A 3CVKA 1J9AA 3AA2A 4MIAA 4E7KA 4M41A 1HARA 5KFDA 2JGUA 2OPRA 4TQRA 4W5RA 1NHUA 1RTJA 4IR9A 4ECXA 2AU0A 1QUVA 1W9HA 4WFYA 5KFNA 3SV4A 3G86A 4CF1A 1C1BB 2EC0A 1NOYA 3N6LA 4O3RA 5J2PB 2ATLA 3GV7B 4G3IA 2O4IA 4W5OA 4OPKA 3OYGA 1TL3B 4K4YA 3D28A 4ECSA 1XC9A 2VWJA 3UR0A 3DDKA 3ZT0A 3HXMA 3TAPA 3OYKA 4FJ7A 1LWEA 4NCAA 4RW4A 3V81A 3ICLA 4J2AA 4MIBA 2HHSA 1JLFB 3KD5E 3NF7A 4NRTA 1RNHA 3RMDA 4O3OA 3Q8RB 5KFOA 4KHSA 4DG1B 5C25A 1RT6A 3KLHB 3NAEA 4M45A 2BR0A 1QS4A 3PX4A 3K57A 3LZIA 2I1RA 4KTWA 1QSLA 2J6TA 5CYMA 2WK4A 2Y1IA 5E41A 4NLGA 1TKTB 4WZQA 1NNDA 4QPXA 4RW8A 1T8EA 1TQLA 2ZE2A 3LP1A 2IM3A 4PUOA 2F8TA 4IDKB 1I3AA 3C95A 2F96A 1REVB 1IKYA 5KFHA 4RUAA 4M3UA 4CE9A 3E01B 3K5OA 4CJRA 2QKBA 4NCGA 3KHRA 2W9CB 3NE6A 1TV6B 4M3XA 4H54A 5F9NA 2XC9A 3AVCA 4TXSA 3G10A 2W7OA 4PA1A 4W5QA 5KRSA 3M8QB 2C2EA 4KFBB 5DMRA 1IO2A 5KFUA 4MFBA 1RT5B 1SUQA 4NLRA 2JEIA 4HKQA 1CSJA 4F8RA 4FM2A 3C6UB 2DTUA 4DTXA 2QK9A 1TAUA 1IKXB 2QE5A 4OKEA 1SL2A 2UVWA 5KRTA 3M9NB 2XY5A 2X6SA 4ZHRA 4FXDA 4BE1A 2E9RX 3QEXA 3ISND 5I3UA 1RTHB 4FBTA 4DTSA 2WOMA 3MEGA 3SV3A 1D9DA 1S1UA 2VG7B 2D0BA 2ZQBA 1RDCA 5J2MB 3B6PA 3DMJB 2F8EX 4J9QA 4FBUA 1VRUA 3DM2B 4QWBA 4IG3A 4O44B 3K58A 1I6JA 4IFVA 4L8RB 2JC1A 3RAXA 5HRSA 3ZT1A 4NLTA 5CYQA 4GMJB 3BJYA 2HVIA 5JS2A 3OL8A 4BWMA 4OVLA 2O5DA 2PYLA 1S6PA 4FJ9A 3ITHA 3UDLA 3QEPA 2IM2A 4CEEA 4CERA 1HNIB 1TGOA 4B9UA 3K2PA 3WNFA 2Y1JA 3FFIB 1NJWA 4O4GB 1FKOB 4BDZA 1MU2B 4F2SA 1X9WA 4FZXC 3LZJA 1T05B 1QE1B 4YQWA 1WSHA 3PW2A 4QCLA 1W25A 4KE5A 2W42A 4ED0A 2PZSA 4HVJA 3HSTB 1ZYQA 1JLGA 3DLEB 4URGA 4ECYA 2EHGA 4CEQA 5KFZA 3OYBA 5T14A 1Q8IA 1RBUA 1S4FA 4KAIA 4HUGA 4M3YA 4MQ3A 1C0UB 5KFVA 4CFBA 4RW9A 2R2TA 4ZTJA 2CKWA 3OLAA 4FJGA 3IRXB 3QEVA 2KZZA 5KFYA 4LD0A 1S97A 3LP0A 4RNFA 5L1IA 3PV8A 1BQMA 2ATQA 2YNIB 4RW7B 4NYNA 3K5NA 4PUOB 4J9SA 1HNVA 2RKIB 3OS2A 2G8FA 4AHSA 3VQAA 3PW4A 1ZTTA 4N47A 3VQBA 2WB4A 4NCGB 3CM6A 4FLTA 3PX6A 5C24B 5L1JA 1BCOA 1DLOA 3OYAA 4OGEA 3HVTB 3OSPA 4J9KA 3KLIB 1LAVA 3PUFA 3DRRB 2FJXA 4DSJA 3V6DB 4EO8A 3PW5A 4CHYA 1KRPA 3AVLA 3GIIA 3LAMA 4B3OB 2KQ2A 1BHLA 3L2VA 3MXJA 2DPIA 3LPUA 4R5PB 3DOKB 3SYZA 3TAGA 5C5JA 1BI4B 4ECQA 4RNNA 4WE1A 4J9LA 4ED8A 3QERA 3G6VA 1SKSA 4WXOA 1VRTA 1X1PA 2HB5A 2VG7A 3KHGA 5JUMA 1NK9A 3F9KA 4I2PB 5DG8A 4YR3A 4DSIA 1RDBA 4F4WA 4KB7A 2W7PA 2ASLA 1EETB 4DTJA 3HPHA 4CF8A 4WFXA 3OS0A 2P5OA 4IFYA 2HNZA 2PYJA 1S9GB 4EBDA 4FJKA 4KTZA 4FS1A 1I39A 3ITHB 4ECRA 3RB4A 3V9SA 4DL6A 5KFJA 3OYFA 1U04A 1WSGA 2XRIA 3QLHB 1JLCA 3KK1B 1VSJA 4I2QA 4AHCA 4E89A 4N56A 3CQ8A 3B6OA 4DQSA 1QTMA 1KCFA 4LSLB 4Z4CA 1NK6A 1RT7B 3CO9A 2G8VA 4ID5A 3KLEB 2P5GA 3MR6A 4MKAA 3HKWA 3EPGA 2HNDB 4IRDA 3VQSA 3VQ6A 3PVXA 1RYSA 2IGIA 1QAJA 2VA2A 1QSSA 3OL7A 5F8GA 1TAQA 5KFXA 1UA0A 3M9MB 3FQLA 3VQQA 5T7BA 4M3WA 4R8UB 1C1CB 4PWDB 4FCYA 1NKEA 3KK2B 1RA7A 3HM9A 3P83D 4ED6A 3QGIA 2BE2B 5KFMA 4K4TA 2BQRA 1BL3A 1D9FA 1SV5B 1FKPA 3OYIA 3RRHA 4FK0A 1JKHB 4ELTA 3EZUA 2OZSA 4IH5A 3DOLA 4FM0A 4KHQA 2YHBA 3AO3A 3HVTA 2OYQA 2IOCA 3IS9A 3FDSA 2B4JA 4CIGA 1RT3B 3EPIA 1IKVB 3PW0A 3TAMA 3AVJA 2RPIA 4DS5A 2ASDA 4J2EA 4DTPA 4ELUA 4HCBA 3CG7A 4W5TA 4OPJA 2QKKA 3QIDA 1S1WA 4ZPAA 1A5VA 3M8QA 1JXEA 2YNGB 1N6QA 4ZP6A 3HPGA 2ETJA 4CJ5A 3C6TB 3O4QA 3NL0A 5I42B 4ZPDA 3CFRA 4DL2A 2BQUA 4I7FA 1TKTA 1C1AA 2BDPA 4QWEA 4Z4FA 3HVRA 1TK0A 5J2NB 3THVA 4J9RA 1N5YA 2ZE2B 3AA3A 4E1NA 1QAIA 3ZSWA 4N5SA 2YNHA 1D0EA 3TR8A 2WONB 4ED3A 4CGDA 4TN2A 3KMSA 4DTUA 4F3TA 5F9LA 4DFPA 4WYLA 5KI6A 1NKBA 3OY9A 4IRKA 1VRUB 5D3GA 4CK1A 3SJJA 4FS2A 3UQSA 4XIUA 4K8XA 1WSFA 4ZPBA 5KG1A 1HQUA 1JLCB 3KK1A 5CY4A 2IA6A 3AV9A 2IAJA 1EXQA 2V9WA 1XHXA 1X9MA 3QNNA 1LW2B 3CJ4A 4DF8A 3T3FA 3O4NA 1S1VA 3NF9A 4OLAA 2B6AA 5DLFA 2GC8A 2FVCA 1WSIA 4OGCA 4H4OA 1ASWA 3C94A 3V1QA 4E1MA 3KJVB 3AA4A 1UWBB 3M8SA 3SFGA 4Z4IA 5CYQB 1NK0A 5KFCA 4M3RA 4ZP8A 1RAJA 4U6PA 4RG8A 4O44A 4PWDA 3QESA 4O3SA 1SL0A 4DSFA 3TAQA 3PY8A 1RTDB 4DS4A 4RNHA 1O1WA 4C8OA 4E7JA 4NLYA 3RBEA 4CJFA 4F4XA 4O3PA 2R2SA 2RN2A 1LWFA 4O3QA 4IKAA 4H8KA 4ECVA 3V6HA 1DTQB 3DLBA 1ITGA 3GYNA 2GV9A 1YTAA 3L2WA 1WAFA 5KG5A 2D3UA 4Y34A 4CEOA 4KTQA 3SUNA 1F21A 2YNFB 2BANA 1G15A 3CDUA 4QW8A 3ZSVA 3SUQA 3SPZA 1K1SA 1ZBFA 3VQEA 1TL1A 2Z1HA 1NK4A 5J2QA 1BQMB 4F3OA 4CJVA 1LWEB 1KFDA 3SQ1A 5FRMA 3LP3A 2B43A 3ULDA 3IRXA 2HAIA 1RBVA 4G1QA 1KTQA 3LP1B 3NFAA 2RDJA 2OH2A 3MR5A 3OJSA 2I5JB 3E01A 4BACA 4ZVEA 1VRTB 3CJ3A 3DLKB 2QV6A 4JV2A 5KFKA 3AO4A 3NHGA 1NJXA 4M95A 2FJVA 2Z1IA 3K5LA 1BCMA 4CJ4A 4CJLA 1YVUA 3I5BA 1K6YA 1C0TB 5JS1A 2ITGA 4KHUA 4DMNA 3KLVA 3NBPB 3OYLA 4J9MA 1T7PA 4DQPA 4MK7A 3IAYA 3QYYA 3SQ0A 3MXMA 3HP6A 3QIPB 4KHRA 1IH7A 4CJUA 4QWDA 1L3TA 3C6UA 4GW6A 2X74A 3AO1A 1KHVA 2W9AA 5KT6A 3N6MA 4KHMA 4FLWA 4I2PA 2ZD1A 1NKCA 4DEZA 3VA0A 3QETA 3V6KA 1S1UB 3EY1A 1HYSA 4TSXA 5DGAA 1S9GA 4LY7A 4CEZA 5KFFA 3OYMA 1WNSA 4IG3B 1S1XB 4IH7A 5I3UB 3MTKA 4E7LA 3SUPA 2HHQA 4Q43A 3PZPA 2FVPA 4F4KA 4ECTA 3HJFA 4HHTA 3NCIA 3MEGB 1VSFA 4MK8A 4ID1A 1NJZA 2IC3B 3OYJA 2C28A 3HK2A 1JLBA 1BGXT 1SUQB 4BE0A 4ICLA 4CGHA 1WSJA 3Q8PB 1YTUA 4IQXA 2FVQA 4UQGA 4DTRA 2AX1A 1U49A 3V4IA 1KVBA 4CIFA 3G0ZA 4FJ5A 1S6PB 1VSHA 3RTVA 1RT7A 1UAXA 2YV0X 4HUEA 1TK5A 4DL7A 3H40A 5HP1B 4E7IA 3G6YA 4Q0BB 3HYFA 3DMJA 3ZSRA 3TAMB 5J2QB 3Q8QB 1TKXB 1ASVA 2OPSB 3PX0A 2XY6A 3O3HA 1RT1B 1T3NA 3TAFA 1S1WB 3KNAA 3RB3A 3M8PA 3P1GA 2UVVA 3PR5B 2GIQA 2R2UA 5K14A 1C1BA 2YKNA 1JLEA 1D5AA 5HRPA 1HJRA 3S3OA 1CZBA 4HTUA 2GUIA 2BE2A 4I7FB 4E0DA 5FRNA 5KGXA 1J5OA 3RAQA 1KLMA 1IKVA 3DLKA 4NLOA 4B9NA 1EP4B 4KRFA 2R8JA 4EEYA 2FVSA 2AGQA 3H59A 2GIRA 1CXUA 3DOLB 1S6QA 5KT3A 2XCPA 4WFZA 2IM0A 2YNHB 3QZ7A 1HMVB 3LALA 4FVMA 4FLXA 1N6QB 1TP7A 1N4LA 1S0NA 1OS5A 5KFTA 4KREA 4ZPCA 2VG5A 2ALZA 3VA3A 2HW3A 3KIOA 1XWLA 3S3NA 4WYWA 3AVBA 4CEBA 1HQEA 4KHYA 3I0RA 2OPQA 3ZSQA 4IBNA 5KT2A 4ELVA 2P51A 1RTIA 3EZ5A 1S9EB 1HPZA 4LH4A 3NAHA 3Q8SB 3OYCA 3IGNA 3IN5A 4NZ0A 3KLIA 1EETA 5DG7A 3DRPA 1IKWA 2FC0A 2YKMB 1QHTA 5KFWA 4Q45A 3NH1A 4CHZA 4M42A 4URSA 2B6AB 4B08A 2IJFA 4RW6A 3RMBA 3BSCA 3CFOA 1CXQA 1TKDA 3VQ4A 3V4IB 2FLNA 4CGIA 2IAJB 1RT5A 3OLBA 2HHTA 1R0AA 2HHUA 4DTMA 2D3ZA 3IG1B 3G6XA 2ILZA 4IG0A 4YP3A 3L3UA 3SNNA 2C2DA 2XY8A 5KFRA 1S5JA 3BDPA 4W5NA 4H4OB 4EZ9A 3QGHA 4KHWA 1TK8A 4FK2A 1TKZB 4M3TA 4X2BA 2OPSA 1JL2A 3KJVA 3OYHA 5FROA 2HWIA 5J1EB 1KFSA 3VQPA 1FXXA 1DTQA 3HP9A 1UOCA 3DM2A 3MR3A 2XI2A 4R8UA 5KFQA 3PO5A 2G8KA 2Q3SA 3MFIA 2AGPA 2R2RA 3H2LA 3BQ1A 4YR2A 2XO7A 3MFHA 3TARA 5KFPA 4DU4A 2JLEA 3OYDA 1HYVA 3AVNA 5EWFA 3RBDA 3AVHA 1JKHA 3JSMA 5L1LA 2YHAA 4NLQA 5HRRA 4JUZA 3KK2A 3KLEA 3MEDB 5KGWA 1HNIA 5F8IA 3NH2A 2W8LA 1HMVA 4AILC 1C0MA 1SV5A 1MU2A 3SFUA 2HNDA 1KHWA 3E51A 2KFNA 3KLGA 2R7YA 3O3GA 2DY4A 2J6SA 4DU3A 3D45A 3DRSB 3WNGA 4H4MA 1JLGB 3ALYA 3KKRA 4FJMA 3IS9B 3RMCA 4Q44A 3ISNC 2YNGA 1U45A 4GC7A 1IG9A 3DLGB 5I42A 4Q8FA 1L3VA 4B9SA 4DTNA 2X6NA 4E3SA 4OKJA 2I5JA 5KG7A 1A5XA 3NMAA 2JEJA 1ZBHA 4C8LA 4ZMMA 5L1KA 1S9EA
chains in the Genus database with same CATH superfamily
5KFGA 3CDBA 2QWPA 1ZA2B 4G1QB 1NK5A 3IP0A 3TSPA 1YUWA 1BO5O 4NOHA 1C0TA 4FO0A 3GR0A 3CJTA 2M8DB 4I6YA 4TYAA 1JCEA 3DYAA 2HK2A 4KPCA 1T6CA 3MM7A 2VU5A 5I3QA 3BF1A 5AZJA 2LA4A 5F8JA 7AT1B 1ZZNA 2R7SA 3RR7A 1NAQA 1UCNA 1TUUA 3M6UA 3HO1A 1PCAA 1S72S 1VS3A 1E4FT 2F8MA 1LW0A 4B1ZA 4DJBA 1VQKS 4CJ7A 2CVEA 1VQ8S 1W7AA 2Z2LA 3H5XA 4JI5K 5J2NA 2KHCA 4N77A 1YZ6A 3AQOA 1A7GE 2DNNA 2CQDA 1JLQB 1U1QA 1HNZF 2IS3A 3TEGA 3TJAA 4QOZB 2GVDA 4Y6IA 5J1EA 1BWFO 2FJWA 1HHSA 3QEIA 3T5LA 1FDDA 2CJBA 1RAHB 3GIJA 1Z4UA 4K4SA 4DZ6A 3ZTRA 1BUXA 4ENOA 3BF4A 3DDNA 3A2FA 5FLXY 3EYZA 4JI7F 1FERA 1JLBB 3J8AA 4GKKK 2FXUA 2RRNA 4P72A 2UYTA 3AVMA 4ZDNA 2AV5A 4ZJLA 4FLVA 4AM6A 3TAEA 2XTJP 2QXFA 3NVKA 3CCLS 3WXLA 4B3RK 3VEVA 2Z1JA 4K50A 3PEJA 4B9VA 4BR0A 1Q18A 3I4PA 3OSNA 2CDQA 3ZZ0A 4CFCA 1JNZB 1IR0A 4DX6A 2AJQA 3LO3A 4CBXA 4DR1K 6FDRA 1UW9A 1TL5A 5GINA 3U6FA 4KGKA 4RWTA 3H5YA 4LRBA 3OQ2A 1JLAA 2G2OA 2FF6A 4DF4A 4B8AB 3PIOQ 3N28A 5C12A 1JLEB 5L9XA 5HI7A 5FJ4A 1NSQA 2UXDF 2NRZA 2MLYA 4TLQA 3MXHP 1T94A 5ETVA 2DHSA 1K9MT 2XGPA 3MUVP 2IDLA 2XS7A 1UTAA 1S10A 5EWGA 3ZZYA 3PXGa 4BRPA 3LM9A 3WX8A 3R2DJ 2B9WA 3CCMN 2Z1GA 1WLJA 3H0PA 4A8QA 1OH6A 5KFLA 5LSOA 4YB6A 1DTTB 1AFJA 3QT7A 4LF8J 2HWHA 4KHNA 2POKA 5HVHA 4CZMA 1EX8A 5EDWA 5I3PA 3DRPB 4O8UA 4DPYA 1SH2A 2L9DA 2OSQA 1RDAA 1YITS 5CH7B 4LQ3A 3D6TB 4ZVHA 3QIOA 4YOWA 1TKZA 1TL4A 4A5AA 2CQCA 3NWRA 2Q6BA 3V9XA 5BYQA 4E19A 1T9VA 4L72B 2ASJA 5HMWA 1ZBLA 1FD2A 3TYTA 1SJRA 1HNZJ 1SJ3P 2W4PA 5JVHQ 3RSEB 4PQAA 3AVGA 2A6AA 2DH7A 3JSMB 1RBTA 4BRKA 3GB0A 2AKWB 4CJPA 5KG6A 1WC1A 1VQNS 2MTLA 1JK9B 2KXHA 2R8IA 2E88A 1HLWA 2IVNA 3ZZUA 1GLFO 3S3MA 5LOQA 1I5OB 4BGBA 1SC4B 1NZ8A 3DNCA 1S48A 3OYEA 1ZTWA 1UVKA 2P8IA 4PG8A 2RQCA 2W9BA 4BBYA 2NZCA 4O3NA 2PIIA 4LREA 4N76A 1KN6A 4NLUA 2FBTA 1WUUA 2DRDA 2LDYA 2EBGA 3D1HA 1YBAA 1RILA 3EE3A 3C7NB 3M2RB 2HMIB 1JCGA 3SI8A 4FWSA 3GYGA 3VQDA 1WBDA 4QQBA 4JRPA 3UIQA 1DRZA 2ZGZA 4C23A 4NI2B 3BQ2A 5BPLA 4AT1B 2IJNA 3M6WA 1HD0A 5HJYA 5CYMB 1SXLA 4CF2A 1U02A 2FZGB 3NNHA 4KH4A 3L2RA 3FZBA 3H6EA 4M5IA 1XMOJ 1WNEA 1WSEA 3L8BA 4DR5J 3BEGB 3CT9A 2YKNB 4PL7A 1CJVB 3CCJS 3VR1A 1U47A 1KLMB 4KV8A 3I5AA 1NK8A 4NZ7A 1UZHA 3L95X 4RW8B 4K2XA 1QLNA 2BX6A 4FYXB 3W9HA 1JL1A 3EVMA 2QEXN 2LQJA 3IM9A 3I0RB 4XDDA 1N56A 3UDVA 3BGOP 3D0PA 4DCHA 3SSQA 4MFBB 2W2MP 3NKYA 4F67A 3CUNA 4ILHA 3VPZA 3D6HB 1BISA 4K4WA 1C2PA 3KK3A 4YOXA 3RJMB 4DU7A 3GV5B 3QNOA 4LF5K 2HHHJ 2AGOA 4ZLLA 1P8ZA 3W0LA 2P9LA 3RBXA 5DDRC 1TYQB 1X4DA 1CVJA 5LM7E 4WQ5A 4FPAA 3OTOK 4LSNA 2ZKUA 3H5SA 1HPMA 2WB1D 3EM1A 2V2QA 4P6QA 2ZM6F 2I6WA 5EXWA 3PRVA 2L3MA 3D0GE 1IBKK 5FPEA 3DOMA 2RDIA 4C8MA 4K4ZA 4EFHA 3H08A 2P5VA 4XEIA 3D3CJ 1RTJB 3CCZA 4C7QA 4Y3CA 1N5QA 1XTZA 4HEA9 2AD9A 4OJHA 2NXNA 1G6BA 4FNIA 4WFNL 1RT4B 1JIHA 2WTFA 4I9QA 4ED7A 5AQFA 4EZ6A 2DHAA 5AQYA 5SZTA 2Q79A 2D41A 3TU5A 2FJDB 3H25A 2UV8A 4DL4A 1X4CA 4FJIA 4OJRA 3DLEA 4GKJF 4KI6A 4CEAA 3VTHA 4DUTA 4UW2A 3RB6A 1BQNA 1WORA 2HFZA 2Q1NA 4IRCA 2JC0A 2E4LA 1UETA 1J6ZA 5FPMA 4HHHA 4NMLA 4LRFA 2RE2A 1BWEA 1KNZA 5KT7A 2E8AA 1WG5A 4LH5A 4NCBA 4H4MB 1FW6A 3OA9A 1T9YA 1FO1A 2YPZA 5AFUA 1VDHA 1S72N 2JVRA 2QWMA 1WKJA 3DLHA 3ZZPA 4RUCA 4O4RA 4FW1A 4B3RJ 3THYB 2DXDA 1WC5A 3EJMA 4BWJA 2IMWP 4NXMK 4XK8C 5MLCQ 4BRAA 1Q16B 2XMAA 1LWXA 1N34K 1WACA 2BJ9A 4WP8A 2H3GX 2QL7B 1VGYA 4FSVA 2YQ0A 1M5VC 1S1TA 3D4JA 5CR4A 4PY5A 2HHPA 3BZQA 1UEUA 2KM8C 1TYQA 3M2VA 3DRXA 4BRGA 1TZ0A 5AXNA 3VZHA 4R5PA 3OS1A 5B08A 2NREA 1CPZA 2ZZTA 3VZIA 4C8YA 3J81j 3MF5A 3RG6A 2ZH4A 3JAMY 1SJ4P 1F5BA 2XMKA 3CDAA 1KLNA 4KJIA 1FRJA 2H4YB 4WIIA 1VQLS 3QZ8A 2P9SB 2EXUA 4OKKA 2HRYA 5G4DA 2DKOB 3SSRA 4ED5A 4ZVOB 2Q3PA 3VAJA 1ZBIA 4CZLA 2ZM6J 3M2UB 5GAGI 1AUDA 3WC0A 2PMHA 1B9DA 5BYSA 1M90O 2AZ3A 1EQMA 2A2CA 3F5TA 1PO6A 2CJKA 4ILGB 4DWIA 2LEAA 1HBMB 2C2MB 1SB6A 1OJ4A 2FLPA 1VRQC 1QQCA 1RBRA 1U8WA 4I64A 1PC4A 3AOBA 5CABA 4IFVB 4CJTA 5KFAA 4B9MA 1GLBG 1RWPB 4CHQA 3VQ5A 4K4VA 5GAGP 4K4UA 4OX8A 3WQPA 1AFIA 4NLXA 5A6PA 3TABA 2GGPA 1H7XA 4UQTA 4RNOA 2MQQA 4ECUA 2XG8A 4U8VA 1RDDA 3KHYA 5F8MA 4CHNA 2MJUA 3IR7B 3PYEA 4ZVQB 3AO2A 2WW4A 2G8WA 4DR1J 4G6VB 4M5MA 2YHWA 2F8SA 4KO0A 2FVRA 5CZ1A 1NDCA 3DXMA 4JK7A 3EDQB 3K5PA 1N48A 4JV0A 2Z30B 4CQ1A 4EGLA 2NPFA 1N54B 2IRYA 1NSPA 4PQUA 2DO0A 1XR7A 1MSWD 1OVQA 5EU7A 4PZVA 4WF9L 4WYBA 2QEXS 1OKJA 3C6TA 1KQKA 3NMRA 5GADP 2Z2MA 2M3DA 1KSPA 2KI2A 1FFSB 4OHYA 1U1OA 3CMEN 2V4JA 2OKQA 3CJAA 2J6UA 3DOKA 3Q23A 4DTOA 2JNJA 1LNQA 4GVMA 3O8WA 4OX7A 3WNEA 1XNQJ 1IM4A 3QDKA 4Z7YA 3CMAN 2E1RA 2EWHA 3HRGA 3KYLA 2GNKA 2W01A 4USVA 1ACMB 4GC6A 1XN9A 1S7HA 3KK3B 2VFVA 3OFEA 1RGVA 4P2XA 4Z4EA 1OSCA 2QGFB 2E66A 4IKFA 4CI6A 3TA0A 1WUAA 4WE1B 1S0OA 3NDKA 1RWUA 4GVLA 3FK4A 1NBEB 3ZNUA 1R0BG 2G8IA 2PA8D 3I8DA 4ZHRB 1NRKA 2ROGA 2D0AA 1JLQA 3R8EA 1Y0HA 2BANB 4E7KA 3AA2A 1R0CB 4G9ZA 5KFDA 3C16B 5AZIB 1YF5L 3SDEB 3D7EO 1T95A 2AYGA 1N33K 4WFYA 4LF1A 3SV4A 3MZIA 4CF1A 2X1GA 2R9LA 1W7WA 3IWLA 2RHKA 3CC7N 4FF3A 4OPKA 1SJQA 4Y0FA 1ZZFA 3THTA 1TL3B 3NXZA 3EVWA 3JTPA 1DURA 1J5EJ 1OSDA 3UKUA 4UF4A 2NRTA 2PMWA 3TWZA 2HLTA 2VBYA 4JNEA 1HA1A 2F3JA 3TAPA 1VQ4S 2MSSA 3OYKA 3BN4A 4DXLA 4MIBA 4NXNJ 1S59A 1FEHA 1F9EB 4U7UK 1RNHA 2YWEA 3Q8RB 5AQXA 4KHSA 4DCOB 2CGLA 3PX4A 4F3MA 4DV1K 1SQGA 1QSLA 3HSZA 2J6TA 5CYMA 2WK4A 4W92B 2YWWA 5E41A 1TKTB 4WZQA 4UZBA 3DHWC 1H1VA 1TQLA 5DZ7A 5AQLA 2IM3A 4PUOA 4A8XA 4IDKB 2A6OA 3UNGC 1REVB 4JKEA 3PEHA 4M3UA 3K5OA 3BN7A 1V4TA 4NCGA 3KHRA 1FRXA 2W9CB 3IXQA 1ZM2A 1TV6B 1Z2LA 2YWKA 4H54A 3CCUS 3KVGA 4CLPA 3HOTA 3CCJN 3OW2M 4TXSA 2FHMA 3G10A 5AJ3F 2DY1A 5KRSA 1RU1A 3PIOL 2C2EA 4EI2A 4ZLNA 4MFBA 4NLRA 3BO4A 4HKQA 3ADAC 4FM2A 3C6UB 5K5MA 1TAUA 1CJKB 1B7FA 3GOIA 2CGJA 2N4CA 3CCES 2UVWA 4QU6A 4ZHRA 2K2PA 2CPFA 3ISND 3CGIA 4H4KA 1SC6A 1EKSA 3TSQA 1P6TA 4G1PA 2R7RA 2WOMA 3CMAS 3NGUA 3M8YA 5IT9U 1S1UA 1D9DA 1UVNA 3VVUA 1RDCA 1CQMA 1GLLO 4O44B 1HKGA 4RWWA 3O9TA 4IFVA 2RRAA 3RAXA 2OD6A 1RXOB 5LMUJ 4NLTA 9ATCB 5HQMA 3WEEA 2VFUA 1E6YA 5ETSA 3DLLQ 3NS7B 3OL8A 4BWMA 5GAGU 2O5DA 4PR6A 3UDLA 2BYCA 1U26A 2L9NA 4JYAF 4B9UA 4JI7J 3K2PA 4DV3J 2E5LF 4BRQA 4F2SA 2LLZA 2YTCA 3G25A 2CQ3A 4AQYJ 1W25A 2W42A 5IV4A 3LPEA 2AYEA 1MROB 3DLEB 2EHGA 3OYBA 3QT5A 1S4FA 2GGPB 4X4OA 3KG0A 2BACA 2HURA 4M3YA 3OVBA 2RQ4A 1PILA 1G1XA 3PFOA 4A8SA 3CJ1A 3NCPA 3IRXB 1LKZA 5KFYA 4LD0A 4RNFA 3L4BC 3CPWM 2HAFA 2XMWA 2YNIB 4RW7B 1H6KX 1HNVA 2MSTA 4FKXA 2LFVA 3HJVA 2UUAK 4J5OA 4FOIA 1VQ8N 1YAGA 2WB4A 2QO3A 1V5IB 3CM6A 2VBWA 3W3SA 2GAHC 2KLAA 1SQKA 1BCOA 1DLOA 3HSDA 3VGTA 2ZZMA 2BJ3A 4J9KA 5DM6Q 1S22A 3BGUA 4DSJA 3EZOA 2CVIA 3P4UB 4P9SA 4HI2A 3PW5A 2PN6A 2JJ4D 3GIIA 3O44A 4NEYA 1VQ9S 2NSCA 2V52B 3K9JA 2OLWA 1O51A 2GJFA 1MNEA 3PDNA 2XMVA 3DOKB 1IVZA 3E1YA 4RNNA 1ZPVA 4WE1A 1SKSA 2ZM6K 3TR5A 1VRTA 1IWAA 2VG7A 4ES1A 1U6FA 5JUMA 3F9KA 4I6MB 1Q82T 5AR0A 1N33F 4M1KA 4H0PA 2W7PA 4BQZA 3O9QA 2P9IB 4FJKA 4KTZA 2XO6A 4FS1A 1I39A 5AQGA 3ITHB 4JHDA 2F4FA 3RB4A 4ECRA 3V9SA 2R7UA 3OYFA 1U04A 3FCVA 2LU1A 3CSKA 3PFEA 4K25A 3ID8A 1KCFA 1HW9A 1VQ5S 4NX9A 1JJCB 1RT7B 2Z2ZA 1VHFA 1YJRA 3EPGA 2SXLA 1IBCB 1R8PA 2HNDB 4IRDA 3VQSA 1MMNA 2HFUA 1CC7A 2CRLA 2ROPA 4LVOP 4L73A 3G6ES 2RHSB 2ZGYA 3EGVA 4BREA 4JI3K 3FQLA 5T7BA 3LGMA 4R8UB 1DEJA 3A5NC 3KK2B 2RNEA 1YJ9S 1AA1B 2BQRA 4K4TA 4BGAA 2MYFA 5LXYA 2NZTA 4BRIA 4B1VA 3BYRA 4FL9A 4FK0A 3EZUA 2J76E 1Z6RA 3AO3A 4P73A 5BPMA 1QQOA 2NRXA 3U1LA 4DPOA 4NA1A 2B8QA 3TAMA 1YIJN 3EMTA 3AVJA 2ASDA 4JI8K 2K8GA 4I6AA 1UFLA 5CQGA 4HCBA 2HS0A 1RWOB 2CA9A 4L3NA 1T44A 2B4PA 1QQMA 1RHRB 1A5VA 5AQIA 4F02A 4IOAQ 3M1FA 2QL9B 1N6QA 2ETJA 3DGPB 4BRNA 3VAMA 4CJ5A 1DQAA 2B7BB 3O4QA 2E7VA 4BR2A 4ZVUB 4BHQA 3Q7BA 2X3GA 5E3AA 3CCSN 3LGNA 4DL2A 1PG5B 5GADI 1AYEA 3QGPA 1YG0A 4Z4FA 4QYZJ 4AQYK 2LXIA 1MDUB 1R59O 2CWKA 2HFVA 5GMDA 2ZE2B 3X3UA 5LT5A 3N5FA 4N5SA 3TR8A 1HWIA 2WONB 4ED3A 3KMSA 5BXIA 1T9WA 5KI6A 1S57A 4WKYA 2ASMA 1VRUB 3FZ2A 4OPHA 4BQLA 2NLXA 5D3GA 4X4QA 4YB1P 4LBIA 4DX8H 5KG1A 3MDQA 2V7ZA 4GRSA 2IA6A 1EXQA 1WC0A 2CG4A 4AE5A 3MM6B 3JXUA 3O4NA 1S1VA 2UXDJ 2DYAA 3EN9A 2BJ7A 2FSNA 1FD8A 2HHHF 2FVCA 1WSIA 3V1QA 2V8HA 1IWGA 3GCWP 2EFGA 2FUG9 3P3DA 3AA4A 3OTDA 4PXCA 2FSKA 4Z4IA 3SDEA 5KFCA 1RAJA 1U25A 2I7NA 4RG8A 3GFYA 4N7TA 3O6QA 1SL0A 4DSFA 3TAQA 3PY8A 4NEZA 1Q53A 3M32A 3QRQA 5I9EB 2UUBJ 3L6QA 4PKIA 4NLYA 4C6AA 4JI0K 5THWA 4WFNQ 2R2SA 3JTNA 1A9NB 3V6HA 1ITGA 3GYNA 4EIAA 5LJ5Y 2B4VA 1VC5A 4FWMA 1YTAA 1S79A 3HFKA 5KG5A 1KEKA 3SUNA 3W65A 4ZA1A 4JD2A 5BYRA 2HVEA 4QW8A 2CPIA 3ZSVA 2JL9A 1ZBFA 3L09A 5EHHA 4WCEQ 4NWBA 4QIGA 1WC6A 3B8HA 4RR5A 5FRMA 3ULDA 4E8UA 3T6BA 2HAIA 2KJWA 1HNWK 3O08A 2D3O1 1X0PA 4CVNE 3FZKA 1QY7A 3NFAA 2KJVA 2GO9A 1K0TA 4MMOA 3OJSA 2AMCB 4UOCA 3E01A 1VQ9N 2CIMA 2CPXA 3DC2A 2R3VA 1UFWA 2G9OA 2WVDA 3K5LA 1QHAA 4CJ4A 2O8FA 4ETXA 2V50A 1K6YA 5JS1A 1XIQA 4RWXA 4KHUA 3NBPB 2YQ3A 4RUHA 3OYLA 3DU5A 1G3OA 2HBLA 4WWSA 4BR5A 4MK7A 4DV7F 1AZSB 3IAYA 3QYYA 3HP6A 2QMXA 4FWLA 1IH7A 4CJUA 3PJ9A 3C6UA 3J7A1 4B17A 4PABA 5A2QO 4GW6A 5EN1A 2X74A 1FE0A 3IWXA 4K0KJ 4KHMA 4OZ5A 1YJNN 2F40A 4I2PA 5DM7Q 2AP1A 1S7IA 3VA0A 4NASA 5GIPA 4IO8A 2KT5A 5E0OA 1HYSA 5D78A 3U02A 1OO0B 3AD7C 3TP2A 5DGAA 1S9GA 4LY7A 5A8WB 2NRHA 4IG3B 1URNA 2R7WA 2KVQE 3SUPA 3POTA 1ZA1B 2FVPA 2UXBK 3HJFA 3RSEA 3MEGB 4MK8A 4ID1A 1M5KC 3AODA 2XZWA 1XMQJ 3HK2A 3OYJA 1SUQB 1Z2ZA 1T0TV 2VQFJ 1F5AA 1AB8A 1EARA 3R6MA 3PSFA 2AX1A 4DPTA 1U49A 1F9FA 3V4IA 1XNRK 2IDEA 4CDIA 1JB0C 3TUIC 3UR3C 2DGWA 5LY3A 3W8GA 4QIWD 4PG5A 2GVZB 5J1PA 3CJQA 2OPSB 4O0NA 1PIEA 2DGVA 1RT1B 3TAFA 1S1WB 1AT1B 1FDNA 4CO2A 3CC4N 3C7NA 1YSJA 1Q7LB 3PR5B 2GIQA 2R2UA 5L9NA 4USJC 1HBOA 1D5AA 1JWWA 2VQFF 5AQSA 1JQGA 2BA9A 5FRNA 1IKVA 4LF6F 4NLOA 5H9EJ 1EP4B 4O23A 2AGQA 4X4UA 1CXUA 1XC3A 7FD1A 2P9NA 3DOLB 5D0RA 5KT3A 2RVJA 5DS7A 4WFZA 1RB0A 2CPDA 2YWFA 1X5SA 3OFGA 3QZ7A 2AJ0A 2RMLA 3LALA 4UY85 1TP7A 1AZSA 3SEOA 2QLFB 2O8CA 4G65A 4CO5A 4YN3B 2G0CA 3ZO7A 2ALZA 2VCPA 1XWLA 3CCVS 1EKRA 3S3NA 4CP5A 1HQEA 5HN0A 3I0RA 3R9PA 1SIWB 2C3PA 2P51A 1RTIA 2GWKA 4LH4A 4CH7A 1TL7B 2V2ZA 2DISA 2CADA 3Q8YA 3IGNA 3IN5A 3EE8A 3ILLA 5M1OA 3L0QA 5DG7A 1ATRA 5F0WA 3CXCM 5AZJB 3IO1A 3E3XA 4DR4K 3EZWA 1RCOB 3VGVA 2XLIA 2YKMB 3H45C 2HHHK 1V6HA 4MAKA 5KFWA 1KC8T 4OQJA 1XNQF 4Q45A 3NH1A 2CG8A 2PI4A 4URSA 4H4KC 8RUCA 3BSCA 4CD3A 2IAJB 2PBDA 2HHUA 3J7YU 2W7AA 3ZC4A 1RQ0A 4CTAB 2X3DA 3WIVA 3G6XA 1VQ7N 4TNOA 2CQBA 1U0HA 1B64A 2C2DA 2XY8A 5KFRA 2HQFA 2LXFA 3QGHA 1TK8A 2HOEA 4X2BA 4H0TB 3CD7A 3MUTP 1KFSA 1XNRJ 1IR1A 3LPYA 4CNYA 2YKAA 4B3SJ 1U0SA 3MR3A 4R8UA 5A8KB 5KFQA 4M63C 3PO5A 4A59A 2G8KA 4PWWA 2Q3SA 3VGKA 2AGPA 3AA9A 3CCQN 2R2RA 5LMNF 1NG9A 3BQ1A 4YR2A 4WP3A 2EEYA 5KFPA 1WHWA 2JLEA 3OYDA 1ZS6A 3KKFA 5F3ZA 1YI2S 1E6YB 1VIXA 1KS2A 1JKHA 3JSMA 3O9RA 3N01A 3Q86A 4JD2B 5HRRA 3KLEA 4DX7A 2EFNA 3TUJC 3NH2A 4ID8A 4USUA 1APSA 1SV5A 3SFUA 2HNDA 3T7ZA 1KHWA 1SZ2A 2V8PA 3KLGA 2MQLA 3O3GA 2QL5B 3D6FB 1BUPA 3GFZA 3ALYA 1T9UA 4FJMA 2XHCA 4PPDA 4Q44A 3JB9k 2DXEA 3AXKA 4Q8FA 1NCLA 4DPWA 1L3VA 2Y9HA 2QWQA 5KG7A 4QYRA 1VBYA 2FYXA 3OFHA 1JJ2M 3UCUP 3CC7S 1S9EA 1TL7A 3H98A 2V4RA 4WPAA 4GV3A 1ZM9A 4KBIA 2JWKA 4CJ3A 4NXMJ 2AEJA 3QFPA 3CD5A 4DQQA 3V6JA 3AVIA 1FK9A 4LFBF 4CHOA 1Q9YA 1WF0A 1UJ6A 3M8ZA 1RLCL 3AARA 2HHWA 2ACYA 2Z58B 4B3RF 2UUTA 1N52B 4QOTA 2E2NA 3NGYA 3GP9A 4LFCJ 2OTJS 4CM0A 1XEZA 3GDQA 4KV8B 4JYAK 2KTQA 2J8SA 3C14A 4BE2A 4KGZB 2H5IB 2JFDA 2Y0BB 3CCEN 2MEWA 2OEMA 3P39A 2VGNA 1FI4A 2X7IA 3VVTA 4PYAA 1SAZA 3HTVA 4NRUA 2P9LB 3MGJA 5F3TA 5K8NA 5T7LA 4GY2B 4JI2K 4N41A 4QZVB 2GHVC 1TKXA 2P9CA 1Y00A 3CCTA 2P9UB 5DLGA 1B0VA 5JLHA 1H72C 4LFAJ 1YITN 4LF4J 3QATA 5E2QA 4ZP9A 5C7PA 5CD4H 5BR9A 2VOOA 3M3ZA 5KOXA 5K14B 1QDUB 3WNHA 2GQ2A 2D5RA 4LQ9A 2NUHA 3THWB 2DNZA 1ASUA 5A76A 3BY5A 3IFRA 3TANA 1YT3A 4CJQA 1UWBA 4KO0B 2EFOA 4F0MA 2BUNA 4Q0BA 1GLAG 5AQRA 3PW7A 2V4QA 4CECA 5HSPA 3RWUA 2HHXA 1Y10A 4URQU 2RT3A 3T5JA 2ZJQL 4ZJQA 3OJUA 2FF3B 1EQ0A 3J7AN 2EKNA 2HBMA 5GAEI 3T1AA 2D3OR 4FJJA 1MN7A 4C3LA 3DFEA 3WZ0A 1I94K 4IO9L 3C19A 3A8EA 1HPZB 1BXNA 4GNIA 2XMTA 3C46A 1TV6A 3CNQP 4FVUA 3CJSA 2DCLA 2A2DA 1S1TB 4NLDA 4MYUA 2Z0GA 1HQEB 2O8FB 4KYZA 5EUHA 1SL1A 3MXIA 3NBPA 1IKXA 2AJ2A 2WAQD 3TTFA 4XO0A 4MO5A 3FLCO 4USWA 1PYTA 2VDHA 3K2YA 5HLFB 4OHWA 3PIPL 3IG1A 5JMVA 2IIHA 2NXCA 2LXUA 4EU0A 2A41A 3AOCA 4I6WA 5F8LA 2Y8WA 2X78A 4NXNF 3A1YG 3HM8A 2ADCA 2OPRB 5SWMA 3C16A 5ETRA 5GAEP 5FPNA 3T19A 5EWEA 3CFPA 2QLXA 4M5HA 4M7XA 1XJWB 4OZLA 1S1XA 2R7QA 1SKRA 1MWZA 1BIUA 3E8OA 2VPXB 3QSIA 1VSMA 3LAKA 4DFJA 2C3MA 1Y3KA 4NB4A 3IBWA 2DR8A 4EP5A 4DV0J 2LECA 2GHPA 3KHHA 3OXFA 4CZJA 4JS4A 5A8WA 2MZTA 4FM1A 2V2VA 3FCWA 3ZSYA 4CT8A 3UO0A 3POTB 5AJ3J 1JXVA 2CQ0A 2CH5A 3GMGA 2M88A 2QLWA 4LFAK 2HWTA 4Z7CA 3CI5A 1P9YA 1F2GA 3FGUA 1HNWF 2E2PA 1W2BR 4DV6F 1U1LA 4XH5A 1AUSL 2DNRA 3L3CA 3WXKA 1IQZA 2OTLS 4DV2K 2VFSA 3N4PA 3SQ2A 4CRJA 3SQ4A 4FW2A 4FJHA 3C15A 4HHUA 2GMLA 3KLHA 2V8VA 2UVUA 1WELA 3TRGA 1IN0A 3QEWA 3QPIA 1RT1A 1X4AA 2F4VK 2VWKA 4CJEA 1E6VA 1FKAF 3O6WA 3KD1E 4ZIWA 1IBKF 5LSRA 4F0KA 3AB4B 2PI5A 4QIVA 3CMQA 3KDNA 5KT4A 2KYXA 5BR8K 2OPQB 1U1KA 3SJHA 3AVFA 1FT8A 4KKOB 3ETMA 1FK9B 1ZBUA 3KK7A 1R6VA 3FCHA 4JV1A 4DLEA 1X0FA 3H3NO 1RISA 1OYDA 3ENBA 3U3GA 3UE5A 4I9LA 2BRKA 1M1HA 6FD1A 3QFUA 1FJ7A 3DYAB 1RTIB 3ULEB 4JI6F 2EW9A 2CAJA 1NSAA 4OI0A 1NMEB 1WOOA 2HBZB 3CWJA 2QTDA 4PQUB 1Y11A 1HYZA 3SPYA 2H65B 4WFAQ 4C8NA 3J81U 2O8EA 2ZJPQ 3OVAA 4LSLA 1Q5YA 4B1XB 4CLKA 5T41A 3OBYA 4J2BA 2QN6B 4PXBA 1YGYA 5A0YA 4O4GA 3D6RA 2OMLA 4TY9A 1VQPS 3L9ZA 2CFXA 3MCNA 2YXLA 2NRVA 1LK5A 4MJKA 1FWPA 2HS4A 4C97A 3O2IA 3TTDA 3M4XA 4MIWA 3K9KA 1C0UA 2GQQA 5H9FJ 2AJ1A 3R5DA 3EGWB 3FQKA 4KSEB 4TKTA 5FD1A 2HMIA 2CGKA 2NS1B 3VAFA 2W4CA 2HYIB 3G6EN 5LMUF 1HKCA 3I55N 4B9TA 1UL3A 3MM9B 3HPOA 4YDXA 1NMDA 2RHQB 3VHQA 1Q4RA 1UJ4A 1H2UX 5G0RB 3MAQA 2UUAJ 3T69A 5IS2A 2CQ4A 3I5CA 4YORA 2DGOA 1GAOA 2OO4A 1T3VA 3WQTA 1K73O 4AQYF 2MZRA 3E9OA 3CD0A 3DRSA 4KKOA 2PD1A 2WBMA 4OFZA 3GFHA 4EAHD 1L3KA 5F8HA 1GMUA 1FESA 5E7OB 1NO8A 3FRYA 2E9TA 2ILYA 2HF4A 1LWCA 3GTYX 3GPAA 3NGIA 3M7VA 5SUHA 3ZT3A 4MH8A 3UPFA 1S6QB 1REVA 5L46A 3WQUA 4S0MA 1VC0A 3TUPA 3GG0A 2MHEA 4CFAA 1X31C 2W9CA 3VGLA 5BN9A 3SMPA 3PO4A 4RZRA 3MMBA 4Y1CA 4A8WA 2WSEC 3V5RA 4DSEA 2KFZA 3V9WA 4CESA 3ZTPA 4DR2K 4I2QB 3C14B 4DQIA 4QU7A 1VHXA 4DR5K 5A0YB 1BI4A 4JI6J 1RTHA 1FJGJ 1GOBA 3D2FA 4PXEA 4TLRA 2YH1A 3IWNC 2HKEA 2Q0UA 3H20A 3WXMB 2JVOA 4HTLA 1L3UA 3CCWA 3FBCA 1CJUA 3AXMA 1S49A 3PCOB 4IOAL 2YKMA 1KXPA 1Q86T 1GMWA 1U48A 2Q6CA 3G87A 2ZHOA 4B9LA 5KFBA 3DLLL 3HFZB 4MKBA 2R8KA 2A40A 3WBZA 4IO1A 3BEXA 3M1VA 1NDPA 3PYDA 4K0KK 3KTQA 1YX2A 2UUWA 3M2RA 1KAYA 3JYTB 1RAFB 1XR6A 4HDHA 4ED2A 1TFYA 2W9BB 2VQEF 3OL6A 5J2MA 3HVWA 4WBFA 5C42B 4WXWA 2ZOGA 3PKMA 1VQOS 2YX4A 3HD2A 4KGVB 1T05A 2DGTA 4CLZA 2WUSA 2M4MA 4HTJA 1HW8A 1WD6A 2WTUA 3O8MA 3L2QA 1XMQK 1WKLA 5E3QA 4Y2IA 5J1NA 4O55A 4OMFG 3MM8B 3VF4A 1VSDA 3BB5A 4USMA 3TVKA 1ZETA 4EYIB 5IM0A 4WQ5C 1Y9OA 3MURP 5HBMA 5H9EK 1FE4A 3KLFA 2DGQA 5CCMA 2RD5C 5HL7L 4KPYA 4X62J 4J37A 2DPNA 4YFUA 4ZVRB 2BXJA 3V81B 2CJQA 1S3XA 2IBKA 2XWYA 3MR7A 3W3DA 4BR4A 4RO0A 3HHDA 3V6DA 2IVYA 4NLVA 3WHIA 2MKHA 4FWPA 3WXIA 2FC8A 2YNIA 4RW7A 1U09A 1OMSA 3NOGA 4Z0UA 3OR1A 2RKIA 1LW2A 5KQ8A 3MECB 5ADXA 3W8PA 1YBTA 3SXLA 3HI0A 3L4QA 2NQPA 3IR5B 3I6PA 4YR0A 2MZQA 3BR8A 4JI2F 1NWKA 4IOBA 1LQ9A 4AHVA 1S6OA 2J9DE 4NYFA 3B6BA 3AVKA 4OL8A 1LFPA 5ETMA 4A48A 4HUFA 4FF4A 2OD4A 1CEZA 4JKFA 5JLFA 1B92A 5FDLA 2D0OA 3H46O 3OXLA 1R3NA 4FJ8A 3QINA 4Z4GA 3A8YA 4QAGA 4HH1A 4J91A 3QBCA 5GADU 4C8KA 3K59A 4HACB 4UOHA 5KPTA 1Z26A 5F0UA 3NNAA 1Y5LB 2O66A 3BSNA 1QSYA 2XY7A 3PRBA 1WB9A 3TW0A 2M7SA 1V9OA 4FF1A 1PGZA 1J9AA 1HARA 4B3TK 2QWLA 4V19J 5AXLA 3CCLN 1XBWA 1RTJA 3HHEA 3IAS9 1W9HA 3SCLE 5I4MA 4CZFA 1NPKA 2VONA 4Y0WA 1EO1A 3G86A 4K43A 3PRDA 3IDHA 2NXUA 4O3RA 5J2PB 1TMJA 2RH3A 1SQEA 2OP5A 4IFEA 2LDIA 2O4IA 2ERRA 3O5TB 4W5OA 1HNXK 3VAGA 1HNXF 1DAXA 5F41A 4YHHK 4K4YA 4ECSA 4CO3A 2VWJA 3DDKA 2NYIA 3LDOA 4OX9J 3S01A 4FJ7A 3V81A 4J2AA 4P2MA 3CJKA 3G9CA 3IA0A 4X4TA 1NGJA 2QIFA 3KD5E 3NF7A 4NRTA 2O8CB 4ISGA 4DG1B 1DY3A 1HKBA 1QD1A 3G71S 3KLHB 2VL1A 2BR0A 3K57A 3NS6A 3ZETA 1E4GT 1CJVA 3ET6A 1GLJO 3GONA 5GAHI 1NNDA 4Y00A 4RW8A 1T8EA 2PE8A 4ZN3A 2QXLA 1RE1B 4C98A 3MOZA 1GLCG 2ZE2A 3LP1A 4V1Ak 3C95A 1IKYA 3VOVA 5KFHA 3GG4A 4RUAA 4PL8A 3E01B 4CJRA 5HANA 2PEHA 5GAEU 5ETLA 4DR1F 3KWIA 2RAQA 4YOYA 1IQTA 3QBXA 4GO5X 2XC9A 2W7OA 3OTBA 2J8AA 2HIQA 5A6WA 5DMRA 2BKNA 2X1FA 1IO2A 4QR0A 2O8DB 1CSJA 4F8RA 3MCSA 2DTUA 2E29A 4HH0A 1IKXB 2J0WA 3OPKA 1BG3A 2XY5A 1JJ2R 2CNLB 2E9RX 3AY9A 3LM2A 5I3UA 1RTHB 1VJQA 3DOMB 3QWUA 2F7VA 2ZBRA 4F9OA 2J9DA 2VG7B 2ZQBA 3ULEA 4K0KF 4LR8A 4J9QA 4FBUA 4GV6A 1KWMA 2E1YA 3MAAB 4IG3A 5HMXA 1I6JA 1GMWD 1C4AA 2JC1A 2MKCA 4M7YA 4PKHA 5CYQA 4U67L 4YHHJ 4GMJB 3BJYA 2HVIA 3UN5A 1PKUA 2WW8A 5JS2A 4YOVA 1Y64A 3D9BA 1ULRA 3R6LB 4FWOA 2IM2A 4A62A 2BABA 2ZJRQ 1QJHA 1N8RO 1D4XA 5U47A 1G2EA 2VB6A 4BDZA 4LR7A 1X9WA 5AQMA 4OX6A 1HWKA 5B0EA 2K7JA 4AD6A 1JLGA 4DV2F 4URGA 2BBEA 4QBUA 5KFZA 5T14A 1GQEA 1GTHA 2C3YA 2HVDA 3Q0AA 2LKZA 4R79A 4JKHA 3A12A 4RW9A 4ZTJA 2CKWA 1KD1O 2MJNA 2MKSA 3D54A 3LP0A 1BQMA 4ZCLA 4PUOB 2G1HA 3RW6A 2G8FA 4AHSA 4OHXA 1PAEX 3VQAA 3PW4A 3G2XA 1NGGA 4NA3A 4QPTA 5KPRA 2P6TA 4HVZA 2HZAA 4OJ1A 3PX6A 5C24B 5FLXU 3GSDA 2CWXA 3OYAA 3VQTA 1RABB 3PUFA 3HD1A 2FJXA 1FRIA 1XNRF 4JI0F 4EO8A 4CHYA 4GVEA 3AVLA 1J27A 2BOAA 2HZCA 2DPIA 1M5SA 4DPXA 1BI4B 4ECQA 2B4UA 2JZ5A 1VMBA 3G6VA 4BVOA 2K7KA 3Q2SC 3SQOP 4IOXA 3BO2A 2HB5A 3KHGA 3GJQB 4DSIA 2I9SA 1RDBA 4KB7A 2V63A 1EETB 3HPHA 4FPRA 3FFKB 4IFYA 2JRSA 1WC3A 4EBDA 3BUZB 5IXUA 2ZH1A 4DV4K 3LTOA 3G8SA 4DL6A 2R4FA 1JLCA 3KK1B 4I2QA 4E89A 4N56A 3BKUA 3P38A 2WVEA 3W5ZA 2NZ4A 3U1NA 4NXMF 3W61A 2ZC3A 3TJ9A 4ID5A 5IQ6A 2VJUA 5IV3A 4F04B 3SMZA 5HVFA 1HR0F 3HZ6A 3NG8A 4I1TA 2EPIA 1R8BA 3PVXA 1ZOTA 1RYSA 1HBMA 2X1AA 1QAJA 2VA2A 4EFAC 2MY7A 5F8GA 1BDGA 5AFUH 2DGXA 3SIPB 3M9MB 2YX7A 4R0JA 4X66F 1U2VB 3JAMO 4M3WA 1C1CB 2E5IA 3HM9A 2PDAA 4X64F 4ED6A 1BL3A 1D9FA 4B3SF 2A3ZA 3VV2B 1JKHB 5IWAJ 1RBLA 2OZSA 2COLA 3DOLA 2P9NB 3E9LA 4DV3F 2LQ5A 1IKVB 3PW0A 4J7CA 4ELUA 2J4RA 3FZMA 5D4NA 2P9KB 1X3NA 1S1WA 4ZPAA 2ATCB 2AP6A 2VD3A 1JXEA 1IBLF 3HPGA 3CF5L 3KZBA 5I42B 4JI3J 2E1CA 4I7FA 3QJLA 1R8AA 2LEBA 2BDPA 3FGVA 4QWEA 3ATVA 3HVRA 2BH1A 2IBOA 3THVA 1N5YA 2DK2A 5AE3A 1M0SA 2GS8A 4P2FA 3AA3A 1QAIA 4LRCA 2YNHA 4CGDA 4TN2A 2UP1A 5F9LA 4DFPA 4WYLA 5T7LB 3I4HX 1NKBA 4ETZA 4IRKA 4DV4F 3LQVA 2N7CA 1UEVA 2QM1A 1H74A 3O5BA 3UQSA 1YJTA 4K8XA 1RACB 1WSFA 4PPZA 2ZJQQ 4C9DA 1X9MA 4DI6A 1LW2B 2CQHA 2BUPA 2MDAA 3C8YA 4RBUA 1UVLA 4OLAA 3M5RA 3BF3A 5DLFA 5TKWA 2ABYA 2GC8A 2YI1A 2XSJB 4OGCA 3C94A 1ASWA 5E3CA 3KJVB 2LMIA 1UWBB 3M8SA 2VFTA 1H3DA 1NK0A 3U9ZA 3VEWA 3I31A 1TUVA 3FVYA 2ZWOA 4OZJA 1URRA 3SK3A 1WHVA 3RBEA 4WQ4C 4JKAA 4CJFA 3B78A 4F4XA 4O3PA 2RN2A 3M8WA 1X7VA 1ZAWA 3DLBA 1Y5NB 3T1YF 4X4RA 1LCUA 4MLEA 2GV9A 4WFBQ 2OELA 1WOSA 3L2WA 3UKRA 1NGAA 4X66J 1F21A 4YB7A 4OJ3A 1Q81T 4IWVA 4UY8T 2BTFA 4LF4K 4YOUA 2H54B 4M8LA 2UXCK 2ZH8A 1TL1A 2OEJA 3N4QA 1M1KO 5J2QA 1BQMB 4R25A 4F3OA 4DCPB 2MZ1A 2ZBQA 4BC5A 1LWEB 4EHUA 1WEYA 5GVQA 2I8EA 1RBVA 4K5RA 5B0AA 4BC3A 3CIPA 1KTQA 4YDDB 1RHMB 2EI5A 3T1YJ 1HFEL 1WBBA 2OH2A 1BQXA 4CZCA 1VRTB 3CJ3A 3DXSX 4B9QA 4JV2A 3MM7B 4B3MJ 5K8MA 5KFKA 1AROP 3FMWA 1U7LA 3DRYA 4M95A 3UFCX 3MTJA 3I5BA 1C0TB 1JMTA 4XTTA 2B0GA 2BZ2A 4JI3F 2ITGA 3VERA 1WSRA 1Q82O 1VFJA 3A5LC 4IO9Q 3ZZRA 4DQPA 2QFJA 3K0SA 5C10A 3QIPB 1VLOA 4KHRA 1IBMF 3ONQA 1M5OC 1L3TA 1TUYA 2KXNB 2VGMA 3W2VB 3GL1A 1RWXB 2LVWA 1RBOB 1CC8A 1KHVA 3TSUA 4OZ3A 5KT6A 3X1LB 1KTVA 3MX2A 2IPOB 2QLJB 4KRWA 4U95A 2CZ9A 3THPA 1NKCA 4CLTA 4C0HA 1QQNA 3EY1A 5EGYA 1A0OB 4CEZA 4H5TA 1IXKA 3S41A 1S1XB 3MTKA 4IJAA 1NH8A 2D74B 1TU0B 4ECTA 1HHQA 4OYMA 1X4EA 4FOEA 1OY9A 1ATNA 2IC3B 2EFVA 3ZX2A 4BE0A 3MAAA 2OFHX 3QICA 2Q2RA 3CJ9A 4IQXA 4UQGA 3KUGA 3UD3P 2LQBA 4L3KA 3OHRA 1KVBA 4XAKA 5DDOC 3G0ZA 2ZH2A 4DR2J 1VSHA 4OYPA 2KVIA 1UAXA 2H5EA 1SI9A 1TK5A 4IUFA 3H40A 3ZTQA 4FKYA 5HP1B 3G6YA 3HYFA 3DMJA 1RHJB 3DWLA 1NGIA 1KONA 5B0GA 1RTZA 3O3HA 1UP1A 2Q0RA 1HX1A 3ZX3A 1FEEA 3FR0A 3MWBA 3RB3A 3BP8A 3P1GA 5A8RB 3F9MA 5K14A 2UUBF 4JI1K 2KKZA 3W66A 2BJEA 1CZBA 2X51A 3T41A 3NEKA 2BE2A 3KJNB 2ZBPA 2V7YA 3RAQA 1KLMA 2W6KA 3AY0A 3DLKA 4KRFA 1FA0A 4EEYA 5FPDA 1NLKL 2GIRA 3FJ2A 1FRMA 3W9IA 2WFBA 3ENOA 2YNHB 2IMOA 1JJ4A 1Y4ZB 3PG9A 2B51A 3LUYA 1HMVB 1M5PC 4FLXA 4W4MA 1NM1A 3CE8A 2OAUA 3GFXA 2HW3A 3RUBL 3VA3A 2KL8A 3JXOA 3O4WA 5MAOA 3DAWA 4IBNA 1VAZA 1MN9A 5KT2A 2G2ZA 2MKKA 3NAHA 5C2CA 3Q8SB 1C0GA 3WC2A 4RKUC 1N32F 2QWNA 4JI5F 3US5A 5M1PA 1P27B 4L76A 2E5GA 1VHIA 2MGZA 4M42A 4HDGA 4OZ0A 3HHLB 4LF5F 3RMBA 2RQKA 1CXQA 1TKDA 2YHYA 3A8IA 3V4IB 2FLNA 4BC2A 4DTMA 2D3ZA 3AA8A 3ELHA 3LDPA 2RUSA 4NE9C 3LGHA 3IM8A 1QZ5A 1BHNA 3RBZA 3SNNA 4DKWA 3BDPA 5GIOA 4H4OB 1IM6A 2WSFC 5BREA 4KHWA 3IMXA 1R6YA 2G2YA 2B3TB 2ZJPL 1JL2A 2Y1RI 3M32B 3OYHA 5D6GA 5IZHA 2E44A 4AF1A 1BWVA 5J1EB 4DMZA 1XQSC 3VQPA 2UU9J 4YY3J 4JAXA 1NHKL 1WF2A 2A10A 3HP9A 1UOCA 3H90A 2XI2A 2VODA 3H2LA 3A3PB 3TARA 1T11A 3AVNA 3MN9A 3KK2A 2F4VF 3RVCA 1F5CA 5KGWA 2M0GB 2W8LA 1MU2A 1Q5VA 4CYUA 1JCFA 3MCAB 3E51A 3GBTA 1IV0A 3MK6A 1T6DA 3R5GA 5IT0A 3EX7B 2P9KA 4H4MA 3C15B 3KKRA 1YZ7A 2UZAA 4K2JA 1U45A 2QSFA 1PC5A 4GC7A 2DNMA 2ACMA 3OR2A 2JEJA 1ZBHA 2QWOA 4ZMMA 3J80Y 1Z1ZA 4OYXA 3ZFVA 3L2UA 3RRGA 2Q36A 4PG7A 4CCHA 2YX1A 3ASMA 1P90A 4DHVA 1NPPA 2QC3A 3MAHA 4QYZK 4ANDA 3RU0A 1GMVA 2WRMA 4IXCA 1R27B 3FEXB 1X9SA 1GX5A 4CJWA 3QIPA 3ZEUB 4DUZJ 3D3BJ 3OHBA 4Y1DA 2ZH9A 5AQUA 3Q8VA 4ZTFA 3ENQA 4ZCMA 2RE1A 1SPBP 2ZFHA 4BC7A 4MO4A 2RU9A 2D9PA 4J8FA 3TZXA 1HYSB 1NPRA 3H1QA 4V19S 2NUUG 1K8AT 1FVQA 4NLSA 4YOTA 3JYTA 5HLFA 4IR1A 2WVBA 4TY8B 2NNWA 3V9ZA 4JBCA 1QVGM 3HSJA 3B82A 5HP1A 4LSNB 4ZN1A 2RILA 2MLZA 5D4OA 5JXSA 1CLQA 3HKZD 1FJGF 3FMBA 1NGDA 4CJSA 3CB4A 1R8CA 1D8ZA 4RTFD 4DHYA 1RYRA 5KG4A 1PYOB 2D7SA 3AOAA 4H5RA 2DNPA 4U67Q 2KZMA 2VBXA 3RAMA 2G8UA 2G4BA 3P49B 2O3DA 3BV8A 3VEXA 4XPEA 1LWFB 4PXDA 2XSJA 1NNEA 2P9PA 1VQ5N 2D0CA 1K9MO 3CD6N 3IRWP 4DR5F 3FSIA 3OVNA 2CJ9A 1X5OA 3RGIA 2OZMA 2BEFA 1H0HB 2ZH3A 2F4VJ 2JEFA 4EBEA 2VQEJ 4O0JA 3C65A 1EJ7L 3HT0A 1K0VA 3CDWA 1K8KB 2RF2B 2QMUB 1LK7A 5HROB 3KWMA 1BC6A 5CCLA 3QO9B 3DI6A 1SKUB 3CDEA 4Z4HA 1BMQB 1RDRA 1KQGB 4RU9A 1KC8O 1RHQB 4B1UB 2W41A 2WHOA 3J80O 2OHDA 2KM8B 5E3RA 2FHKA 2B9XA 4AHUA 4YEAA 5ETKA 4F26A 2HQDA 4Y2CA 2MQNA 4ECZA 5GMEA 2K3KA 4H03B 1A5WA 5FDLB 1CJKA 1HIYA 2HMPA 5B0FA 5DM6L 3P96A 2HF3A 3CCVN 3WUHA 3BQ0A 1G99A 2HBQB 1RWKB 3KOAA 1OQ6A 1F60B 4CK3A 3N6NA 1LWCB 2ZKTA 4NLPA 2DD8S 4DSKA 4IOCL 5LMUK 1QVFM 4BC4A 2BGGA 3HFVA 2DT9A 4ISEA 3CYMA 4KC5A 2LQ8A 2DFFA 3R1XA 1L3SA 5E84A 4JV5J 3O1WA 4LIWA 4KHPK 1VCTA 2R8GA 2LYVA 2ZHAA 1NJIO 3R7NB 3M2VB 2DHGA 2ZOMA 2GJ2A 1F2HA 3M6XA 4BRMA 4JLHA 4AM7A 2HNYA 3MM5A 1MWYA 2DR7A 1LAWA 1R0AB 1PJ6A 1F6TA 3EXYA 4CLLA 2GQCA 5DQIA 3NWGA 2GZOA 1IR2A 3R8YA 2HGLA 2JDJA 5MLCV 5DG9A 1NHVA 2FZCB 3WXJA 3DLJA 4HI1A 5AXMA 2O4GA 1HR0J 2HS3A 1ZBSA 3RW7A 2XZDB 1SC3B 1Q0NA 3KJQB 2ZH6A 5H9FK 3QO9A 3TA2A 2FBYA 4AHTA 4OZNA 2KT3A 3ZSZA 4ZVFA 4CHPA 2MXYA 4CH0S 4DDFA 3UDCA 3CHWA 4HL9A 2CZ4A 2LU2A 2V34A 3O1LA 2R7VA 3TWHA 2KKHA 4KY3A 4X64J 1Q8KA 2YWGA 2JLGA 5C2GA 2PFFB 3DXMB 5AQJA 1YLXA 3EVOA 1XR5A 1DBDA 4HHJA 2GJIA 3LPTA 4FYVB 2IRXA 2NLWA 1HL6A 2UXBF 1S12A 1NGEA 3OUYA 2YWHA 4FVCA 4DN9A 1NU0A 1K1QA 3OR1B 1X4GA 4KH0B 3CCSS 2W2NP 1WF1A 4F4YA 3IKMA 5DQGA 4FWQA 3KXDA 3LDLA 4FK4A 2C2OB 3BH6B 4ER8A 1U2FA 1OPZA 3OTEA 2DPJA 1UKUA 5CYJA 3M9OB 4K4XA 4NMXA 4OYBA 2YKQA 4M3ZA 3GILA 3VTIA 1YRUA 2MQOA 2G8HA 4FJLA 1HBUB 2KDOA 1XI1A 1L5UA 2A1RA 1ESVA 1CS4B 2P9IA 4XH1A 3ENVA 2QYCA 2YPYA 4JHDB 4Y2AA 5JMNA 4DR4J 3HX9A 3QRRA 4CK2A 4JI6K 2IYIA 3VWSA 3FFIA 1J5EK 2UXCJ 3KMQA 3OYNA 3UCGA 3VQCA 5AQKA 3SI6A 2PSZA 4DV5K 4UT4A 5L8RC 1NUEA 4LF8F 1FRLA 4F2RA 1FF2A 1K44A 3UI3A 3M05A 3CJCA 3N79A 2V69A 4DQRA 5M1QA 5B09A 4FLYA 4A46A 1NEEA 3DHXA 5HVGA 3CJ0A 4FYWB 4RU2A 4DR6K 3ZSXA 1S5ZA 3NGTA 4M63A 4TU8A 1RCHA 4LFBJ 3VEOA 3AJ2A 3P4IA 5C2FA 5K8OA 1U0HB 3GLJA 2ZVIA 4Y65A 3M8RA 4DV0F 5ETPA 3TQ1A 1NU4A 2CDRB 3R7SB 4DFKA 2DH9A 5HRNA 1WTBA 4BDPA 1PYSB 4ILLA 1Z25A 4A61A 2F1FA 4ZKAA 1Q86O 1RT6B 1V3ZA 3OUYB 1RBSA 4KGMA 1XQIA 2YCHA 4B3OA 2JOQA 2QA2A 2HVZA 3OW2R 2QA4N 3GQCA 2HFOA 1TVRB 3VQ7A 3BBCA 1HNWJ 2E6MA 1KVIA 2RIJA 3UB5A 2RF2A 4QW9A 3AAPA 3Q7CA 4DV6J 6AT1B 3MPUB 2J0QD 3ZLJA 3QGGA 3MEDA 2HVHA 3S6EA 3VAKA 2VICA 2XNRA 4EK2A 1X5PA 3QJJA 3TX8A 4YDUA 1ZM3A 1VSLA 1HBNA 3SQGB 4IOCQ 4FZZA 2YKPA 4DUYJ 4DG1A 3CJ2A 1FNMA 2C1EB 1YJUA 4KFBA 2KRRA 2NR0A 1VQ6S 3UVJA 4HT5A 3Q8UA 3ATUA 2QZ8A 1OIAA 3AQPA 1RBAA 3MCMA 3LP2A 2XS5A 1IBKJ 4MK9A 5ELZA 4FWNA 2EX3A 3OTOJ 1X9JA 2DR5A 4F25A 3T1YK 1N32K 1NGBA 1KVAA 3CIMA 3DKDA 2C2RA 1UEKA 3AD8C 3NGSA 4E1JA 1FTCA 2RRBA 1GOCA 3LOUA 2KN4A 4DR4F 4P7VA 2FY1A 2QX0A 3V1OA 4OI1A 4KR0B 1J5EF 3S9HA 2MZJA 3QQCD 2MY8A 2ASYA 3NH0A 5KTQA 1NH7A 4DOZA 2ZEJA 2K1RA 1B9FA 1YJNS 3PJXA 3MEEB 3QJPA 2N82B 2W2OP 4TQSA 3VAHA 1BU6O 2GFFA 3THWA 4LUBA 4MDBA 3F44A 2O1PA 2YBVA 1VK0A 2H48B 3OV7A 4DR2F 2UVRA 5AT1B 3GWCA 3TVZA 4AH9A 4B02A 3DU6A 1RHUB 1OH7A 3GIKA 1J54A 3A5MC 1TVRA 4BRDA 1FKPB 4OHZA 5A8KA 1WTFA 1UPMB 3D1QA 4KGXB 1FFWB 2ZH5A 1GX6A 2QTWA 3HOSA 1C6VA 3KG1A 1U1PA 1D8YA 1NJIT 3NNCA 1P9QC 1EKEA 3ENWA 3EL2A 2UXDK 2OTLN 3AVAA 3CW2C 3Q24A 1HBNB 4ZVPB 3MCOA 4M94A 2D69A 3GIMA 2ZWHA 4KH1B 4RPFA 1W2IA 1DZ5A 4WKRA 4KH5A 2NUBA 4DL3A 2PMZD 4LMZA 1VSEA 1Q78A 3QBWA 4DSLA 3P6YC 2WC9A 1CZAN 1WDDA 3EXCX 4P2SA 3NGZA 2UUAF 3HBTA 2A18A 3T6JA 1XMBA 3PJWA 2CNNB 3ZETB 1N5YB 4ZP7A 1WHXA 2WZ1A 1VBZA 2M5YA 4FJNA 2I0XA 4YNQA 2GWJA 1MMDA 4WTOB 1S1VB 2EFPA 2GEMA 1OY8A 3JQMA 3L7PA 2DFEA 3B4DA 3FBEA 2HSTA 4WFBL 4DU8A 3D1OA 1SH0A 8AT1B 1VOMA 1UAWA 1OVYA 1MMLA 1RT2A 2FSJA 2HQGA 4JKGA 2NXEA 3CF5Q 2VJVA 3B54A 2WVCA 2BV3A 2IIRA 4LF7K 2WONA 2W4DA 5TKYA 3D2WA 3KUHA 5JVGQ 4BR7A 2FY8A 5D3GB 3LANA 1KQSM 1YJWN 1RT4A 4JRQA 3ZT4A 4KAZA 3K5MA 3I56S 3S7RA 2XMUA 3MMAA 2HNYB 3O3FA 1LXJA 5KFIA 1HJOA 2E6LA 2XWXA 3GJTB 3SSSA 3PR4A 1T03B 3D5MA 1VK8A 2YNFA 3CTRA 3CJ5A 2L08A 2G1DA 4MIAA 2FGCA 3Q89A 3MI7X 2QSWA 2JGUA 1IJEB 1X5TA 5EOYA 4W5RA 3F56A 3R3TA 4FWRA 1NHUA 2AU0A 1QUVA 3CULA 2OJ3A 2X1BA 5KFNA 2VC1A 3IUCA 1Y5IB 1C1BB 4CLWA 3PM9A 2E7WA 2BW2A 3HHLC 2ATLA 4YY3F 2F8HA 4X4SA 2KU7A 3GYXB 5KPZA 2Z56B 2LEPA 1X4BA 2FZKB 2ZZNA 2K06A 2VKRA 4B1YB 3CCRS 4U7UD 3D28A 1FVSA 3UD5A 1V5VA 1XC9A 3MOJB 2GUPA 3WIUA 5F2RA 3V2UC 4NCAA 3TX0A 3ICLA 2HEKA 2HHSA 1VQ4N 4H0YB 3I87A 3HCXA 5KFOA 1SCJB 5C25A 1RT6A 2QA4G 3NAEA 3LZIA 3ILIA 2I1RA 5KOWA 4KTWA 4KH6A 5DRKA 2A6MA 1T02A 2Y1IA 4NLGA 1ZBTA 1ZC6A 1H2VZ 3VEYA 3D0HE 5K8PA 2LCWA 3TZYA 1M5HA 2BW7A 2DNQA 5M2PA 1I3AA 2F96A 4K41A 4RUBA 4U9RA 2VBZA 2OI2A 3RZAA 4DBQA 3P8BB 2QKBA 2LP4A 4CLYA 4M3XA 3THYA 3IAM9 5F9NA 5ETNA 5D4LA 3AVCA 5IC4B 1VLYA 4PA1A 1FXLA 1E6VB 1H7WA 4W5QA 3M8QB 4B3MF 4KFBB 3DGPA 1HBUA 4DUZF 1RT5B 1SUQA 2QA1A 2JEIA 3E2EA 5JJBA 3MCPA 5LJWA 1ITPA 1EQYA 2K3IA 2XZTB 4DTXA 2QK9A 4KHPF 1SL2A 2K1RB 3M9NB 2X6SA 4L3QA 4JK8A 4FXDA 1X4HA 3I9ZA 4PEOA 4GVBB 3G82B 5JVGL 2QLBB 2MQ8A 2IFXA 4DTSA 3J7YI 3SV3A 2D0BA 2H4WB 4JI2J 2EFQA 5J2MB 4J90A 3TO8A 3QB0A 3B6PA 4I68A 3DMJB 4I6MA 3DM2B 4QWBA 2V8GA 2PEBA 4ZPWR 3Q83A 2HIYA 3L7OA 4L8RB 1RWNB 1TFWA 3CCRN 5HRSA 3ZT1A 2NCKL 4AXIA 5HATA 1S6PA 3QEPA 4ZCIA 1VR6A 1KOOA 1RWVB 2Y1JA 1NJWA 4O4GB 4QR2A 1MU2B 4CYUB 4FZXC 4GKKJ 3LZJA 1T05B 1WSHA 4QCLA 4PAAA 4B3TJ 4KE5A 2PZSA 4HVJA 4MDAA 1SC1B 2B9EA 5LMNK 3T1HK 1RBUA 2ZOFA 4KAIA 3C2PA 1RGIA 5D8HB 3VF6A 4M5JA 4DR3J 5AQHA 1KDNA 4CFBA 2YY3A 2R2TA 3BH7B 5HQ8A 1KAZA 3OLAA 3JQKA 2VQEK 2CJYB 2KZZA 2ASPA 2XHWA 5L1IA 2DCUB 3PV8A 1U6ZA 2ATQA 4PKGA 3K5NA 4H5NA 4J9SA 2RKIB 4OI6A 1VYAA 4C11B 4LF6K 4M5KA 1ZTTA 4WK3A 1NZAA 4N47A 4O5FA 3VQBA 5IM0B 3R1LA 4NCGB 1HNXJ 4HTIA 4UUWA 2E7XA 4FLTA 5AQZA 5L1JA 1FJCA 3FZHA 4OGEA 3KLIB 3DRRB 2VV5A 4CZHA 2UU9F 3V6DB 4NI2A 1KRPA 1Y3JA 3LAMA 4EUVA 3CMES