4QUPA

Crystal structure of stachydrine demethylase with n-methyl proline from low x-ray dose composite datasets
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
415
structure length
414
Chain Sequence
GTENLYFQSMMTANPTSIHQRLDRRLSGFSLEQPFYTSPEVYALDLQHIFYKQWLYAVPVCQLAKAGSYTTLRVGAYEVVIVRSRDGEVRAFHNSCRHRGSLICKARQGQVAKLVCPYHQWTYELDGKLIWANDMGPDFDASKYGLKPVNLRNLDGLIYICLSDTPPDFQTFAQLARPYLEVHDLKDAKVAFTSTIIEKGNWKLVWENNRECYHCSSNHPALCRSFPDPEVAGVQADGGVSKKLQAHFDRCEAAGTPAQFVLAGDGQYRLARMPLQEKALSYTMDGKAAVSRHLGRVAPPDAGTLLMFHYPSTWNHFLPDHSLTFRVMPISPTETEVTTTWLVHKDAVEGVDYDLKRLTEVWIATNDEDREIVETNQQGILSPAYVPGPYSPGQESGVMQFVDWYAASLERALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tracking photoelectron induced in-crystallo enzyme catalysis
rcsb
source organism Sinorhizobium meliloti 1021
molecule tags Oxidoreductase
molecule keywords Monoxygenase; demethylase
total genus 130
structure length 414
sequence length 415
ec nomenclature ec 1.-.-.-:
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4qupA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 4qupA01
2E4PA 4H13D 2BMOA 3EQQA 4HM5A 1BE3E 3L72E 2B24A 3VMHD 4HM2A 2ZT9D 3GCEA 4HJLA 5KLVE 3H1JE 1PP9E 2YVJB 4NBFD 2DE5A 1NU1E 2QJPC 3GB4A 1RFSA 4NBGD 1RIEA 4HM8A 1SQQE 1WQLA 4NBCA 5KKZC 1KB9E 2E74D 4HM4A 1UUVA 2NUMA 4QDCA 1VCKA 4NB9A 1UUWA 3GZYA 4NBEA 3CXHE 2CKFA 4NBGA 3H1LE 4NB9D 3GCFA 1KYOE 1O7HA 1NTME 3GL0A 2JZAA 4H44D 5AEUA 1Q90C 3BCCE 4PD4E 2FYUE 4QURA 4PV1D 3GL2A 3VCAA 1O7WA 2Q3WA 4NBHA 1Z03A 4H0LD 1WW9A 4NBDA 2YFJA 3L73E 2DE7D 3GTEA 3L71E 2FYNC 2NVGA 2GBWA 2BMQA 1L0LE 5AEWA 4OGQD 2YFIA 3D89A 1ULIA 3TGUE 5BOKA 3VMGD 2QJYC 2XSHA 3H1KE 3DQYA 2YFLA 3L75E 1EG9A 2B1XA 2DE6D 2DE7A 3N0QA 1PPJE 4NBHD 3GTSA 4QDFA 3C0DA 2HMJA 3L74E 1ZRTE 1VF5D 5HL4A 4NBCD 3AZCA 4HM3A 2XR8A 4NB8D 1G8JB 2GBXA 2E75D 1JM1A 2I7FA 5KLIC 1G8KB 3H1IE 4NBBD 3EN1A 3VMIA 4NBAD 4AAYB 4QUPA 1SQXE 4P1CH 1SJGA 3VCPA 3L70E 2BMRA 3VMHA 1O7MA 4HM6A 1NTZE 1NYKA 2XRXA 2QJKC 3GKEA 2QPZA 2DE5D 4NBFA 4QDFB 2NVFA 1SQPE 4U3FE 4EMJB 3GKQA 3FOUA 3CX5E 2A06E 4NB8A 3GZXA 3VMID 4NBBA 1NTKE 1O7PA 4HM0A 1BCCE 3GOBA 2E4QA 1VM9A 2HMOA 2HMKA 2HMNA 4QCKA 4HM7A 4HKVA 2NWFA 2BCCE 2IBZE 2NVEA 1FQTA 2DE6A 2HMMA 1Z02A 4QDDA 2YIUC 2HMLA 1O7GA 1SQBE 2D2CD 1O7NA 1ULJA 3CWBE 4HM1A 1NDOA 5CXMA 3H1HE 1Z01A 4NBAA 2JO6A 2ZYLA 2E76D 4NBED 4P1BH 1EZVE 1P84E 3VMGA 1L0NE 2NUKA 4QUQA 2XSOA 1SQVE 4NBDD 4AIVA
chains in the Genus database with same CATH superfamily
2E4PA 4H13D 2BMOA 3EQQA 4HM5A 1BE3E 3L72E 2B24A 3VMHD 4HM2A 2ZT9D 3GCEA 4HJLA 5KLVE 3H1JE 1PP9E 2YVJB 4NBFD 2DE5A 1NU1E 2QJPC 3GB4A 1RFSA 4NBGD 1RIEA 4HM8A 1SQQE 1WQLA 4NBCA 5KKZC 1KB9E 2E74D 4HM4A 1UUVA 2NUMA 4QDCA 1VCKA 4NB9A 1UUWA 3GZYA 4NBEA 3CXHE 2CKFA 4NBGA 3H1LE 4NB9D 3GCFA 1KYOE 1O7HA 1NTME 3GL0A 2JZAA 4H44D 5AEUA 1Q90C 3BCCE 4PD4E 2FYUE 4QURA 4PV1D 3GL2A 3VCAA 1O7WA 2Q3WA 4NBHA 1Z03A 4H0LD 1WW9A 4NBDA 2YFJA 3L73E 2DE7D 3GTEA 3L71E 2FYNC 2NVGA 2GBWA 2BMQA 1L0LE 5AEWA 4OGQD 2YFIA 3D89A 1ULIA 3TGUE 5BOKA 3VMGD 2QJYC 2XSHA 3H1KE 3DQYA 2YFLA 3L75E 1EG9A 2B1XA 2DE6D 2DE7A 3N0QA 1PPJE 4NBHD 3GTSA 4QDFA 3C0DA 2HMJA 3L74E 1ZRTE 1VF5D 5HL4A 4NBCD 3AZCA 4HM3A 2XR8A 4NB8D 1G8JB 2GBXA 2E75D 1JM1A 2I7FA 5KLIC 1G8KB 3H1IE 4NBBD 3EN1A 3VMIA 4NBAD 4AAYB 4QUPA 1SQXE 4P1CH 1SJGA 3VCPA 3L70E 2BMRA 3VMHA 1O7MA 4HM6A 1NTZE 1NYKA 2XRXA 2QJKC 3GKEA 2QPZA 2DE5D 4NBFA 4QDFB 2NVFA 1SQPE 4U3FE 4EMJB 3GKQA 3FOUA 3CX5E 2A06E 4NB8A 3GZXA 3VMID 4NBBA 1NTKE 1O7PA 4HM0A 1BCCE 3GOBA 2E4QA 1VM9A 2HMOA 2HMKA 2HMNA 4QCKA 4HM7A 4HKVA 2NWFA 2BCCE 2IBZE 2NVEA 1FQTA 2DE6A 2HMMA 1Z02A 4QDDA 2YIUC 2HMLA 1O7GA 1SQBE 2D2CD 1O7NA 1ULJA 3CWBE 4HM1A 1NDOA 5CXMA 3H1HE 1Z01A 4NBAA 2JO6A 2ZYLA 2E76D 4NBED 4P1BH 1EZVE 1P84E 3VMGA 1L0NE 2NUKA 4QUQA 2XSOA 1SQVE 4NBDD 4AIVA
chains in the Genus database with same CATH topology
2E4PA 4H13D 2BMOA 3EQQA 4HM5A 1BE3E 3L72E 2B24A 3VMHD 4HM2A 2ZT9D 3GCEA 4HJLA 5KLVE 3H1JE 1PP9E 2YVJB 4NBFD 2DE5A 1NU1E 2QJPC 3GB4A 1RFSA 4NBGD 1RIEA 4HM8A 1SQQE 1WQLA 4NBCA 5KKZC 1KB9E 2E74D 4HM4A 1UUVA 2NUMA 4QDCA 1VCKA 4NB9A 1UUWA 3GZYA 4NBEA 3CXHE 2CKFA 4NBGA 3H1LE 4NB9D 3GCFA 1KYOE 1O7HA 1NTME 3GL0A 2JZAA 4H44D 5AEUA 1Q90C 3BCCE 4PD4E 2FYUE 4QURA 4PV1D 3GL2A 3VCAA 1O7WA 2Q3WA 4NBHA 1Z03A 4H0LD 1WW9A 4NBDA 2YFJA 3L73E 2DE7D 3GTEA 3L71E 2FYNC 2NVGA 2GBWA 2BMQA 1L0LE 5AEWA 4OGQD 2YFIA 3D89A 1ULIA 3TGUE 5BOKA 3VMGD 2QJYC 2XSHA 3H1KE 3DQYA 2YFLA 3L75E 1EG9A 2B1XA 2DE6D 2DE7A 3N0QA 1PPJE 4NBHD 3GTSA 4QDFA 3C0DA 2HMJA 3L74E 1ZRTE 1VF5D 5HL4A 4NBCD 3AZCA 4HM3A 2XR8A 4NB8D 1G8JB 2GBXA 2E75D 1JM1A 2I7FA 5KLIC 1G8KB 3H1IE 4NBBD 3EN1A 3VMIA 4NBAD 4AAYB 4QUPA 1SQXE 4P1CH 1SJGA 3VCPA 3L70E 2BMRA 3VMHA 1O7MA 4HM6A 1NTZE 1NYKA 2XRXA 2QJKC 3GKEA 2QPZA 2DE5D 4NBFA 4QDFB 2NVFA 1SQPE 4U3FE 4EMJB 3GKQA 3FOUA 3CX5E 2A06E 4NB8A 3GZXA 3VMID 4NBBA 1NTKE 1O7PA 4HM0A 1BCCE 3GOBA 2E4QA 1VM9A 2HMOA 2HMKA 2HMNA 4QCKA 4HM7A 4HKVA 2NWFA 2BCCE 2IBZE 2NVEA 1FQTA 2DE6A 2HMMA 1Z02A 4QDDA 2YIUC 2HMLA 1O7GA 1SQBE 2D2CD 1O7NA 1ULJA 3CWBE 4HM1A 1NDOA 5CXMA 3H1HE 1Z01A 4NBAA 2JO6A 2ZYLA 2E76D 4NBED 4P1BH 1EZVE 1P84E 3VMGA 1L0NE 2NUKA 4QUQA 2XSOA 1SQVE 4NBDD 4AIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E4P A;  4H13 D;  2BMO A;  3EQQ A;  4HM5 A;  1BE3 E;  3L72 E;  2B24 A;  3VMH D;  4HM2 A;  2ZT9 D;  3GCE A;  4HJL A;  5KLV E;  3H1J E;  1PP9 E;  2YVJ B;  4NBF D;  2DE5 A;  1NU1 E;  2QJP C;  3GB4 A;  1RFS A;  4NBG D;  1RIE A;  4HM8 A;  1SQQ E;  1WQL A;  4NBC A;  5KKZ C;  1KB9 E;  2E74 D;  4HM4 A;  1UUV A;  2NUM A;  4QDC A;  1VCK A;  4NB9 A;  1UUW A;  3GZY A;  4NBE A;  3CXH E;  2CKF A;  4NBG A;  3H1L E;  4NB9 D;  3GCF A;  1KYO E;  1O7H A;  1NTM E;  3GL0 A;  2JZA A;  4H44 D;  5AEU A;  1Q90 C;  3BCC E;  4PD4 E;  2FYU E;  4QUR A;  4PV1 D;  3GL2 A;  3VCA A;  1O7W A;  2Q3W A;  4NBH A;  1Z03 A;  4H0L D;  1WW9 A;  4NBD A;  2YFJ A;  3L73 E;  2DE7 D;  3GTE A;  3L71 E;  2FYN C;  2NVG A;  2GBW A;  2BMQ A;  1L0L E;  5AEW A;  4OGQ D;  2YFI A;  3D89 A;  1ULI A;  3TGU E;  5BOK A;  3VMG D;  2QJY C;  2XSH A;  3H1K E;  3DQY A;  2YFL A;  3L75 E;  1EG9 A;  2B1X A;  2DE6 D;  2DE7 A;  3N0Q A;  1PPJ E;  4NBH D;  3GTS A;  4QDF A;  3C0D A;  2HMJ A;  3L74 E;  1ZRT E;  1VF5 D;  5HL4 A;  4NBC D;  3AZC A;  4HM3 A;  2XR8 A;  4NB8 D;  1G8J B;  2GBX A;  2E75 D;  1JM1 A;  2I7F A;  5KLI C;  1G8K B;  3H1I E;  4NBB D;  3EN1 A;  3VMI A;  4NBA D;  4AAY B;  4QUP A;  1SQX E;  4P1C H;  1SJG A;  3VCP A;  3L70 E;  2BMR A;  3VMH A;  1O7M A;  4HM6 A;  1NTZ E;  1NYK A;  2XRX A;  2QJK C;  3GKE A;  2QPZ A;  2DE5 D;  4NBF A;  4QDF B;  2NVF A;  1SQP E;  4U3F E;  4EMJ B;  3GKQ A;  3FOU A;  3CX5 E;  2A06 E;  4NB8 A;  3GZX A;  3VMI D;  4NBB A;  1NTK E;  1O7P A;  4HM0 A;  1BCC E;  3GOB A;  2E4Q A;  1VM9 A;  2HMO A;  2HMK A;  2HMN A;  4QCK A;  4HM7 A;  4HKV A;  2NWF A;  2BCC E;  2IBZ E;  2NVE A;  1FQT A;  2DE6 A;  2HMM A;  1Z02 A;  4QDD A;  2YIU C;  2HML A;  1O7G A;  1SQB E;  2D2C D;  1O7N A;  1ULJ A;  3CWB E;  4HM1 A;  1NDO A;  5CXM A;  3H1H E;  1Z01 A;  4NBA A;  2JO6 A;  2ZYL A;  2E76 D;  4NBE D;  4P1B H;  1EZV E;  1P84 E;  3VMG A;  1L0N E;  2NUK A;  4QUQ A;  2XSO A;  1SQV E;  4NBD D;  4AIV A; 
#chains in the Genus database with same CATH topology
 2E4P A;  4H13 D;  2BMO A;  3EQQ A;  4HM5 A;  1BE3 E;  3L72 E;  2B24 A;  3VMH D;  4HM2 A;  2ZT9 D;  3GCE A;  4HJL A;  5KLV E;  3H1J E;  1PP9 E;  2YVJ B;  4NBF D;  2DE5 A;  1NU1 E;  2QJP C;  3GB4 A;  1RFS A;  4NBG D;  1RIE A;  4HM8 A;  1SQQ E;  1WQL A;  4NBC A;  5KKZ C;  1KB9 E;  2E74 D;  4HM4 A;  1UUV A;  2NUM A;  4QDC A;  1VCK A;  4NB9 A;  1UUW A;  3GZY A;  4NBE A;  3CXH E;  2CKF A;  4NBG A;  3H1L E;  4NB9 D;  3GCF A;  1KYO E;  1O7H A;  1NTM E;  3GL0 A;  2JZA A;  4H44 D;  5AEU A;  1Q90 C;  3BCC E;  4PD4 E;  2FYU E;  4QUR A;  4PV1 D;  3GL2 A;  3VCA A;  1O7W A;  2Q3W A;  4NBH A;  1Z03 A;  4H0L D;  1WW9 A;  4NBD A;  2YFJ A;  3L73 E;  2DE7 D;  3GTE A;  3L71 E;  2FYN C;  2NVG A;  2GBW A;  2BMQ A;  1L0L E;  5AEW A;  4OGQ D;  2YFI A;  3D89 A;  1ULI A;  3TGU E;  5BOK A;  3VMG D;  2QJY C;  2XSH A;  3H1K E;  3DQY A;  2YFL A;  3L75 E;  1EG9 A;  2B1X A;  2DE6 D;  2DE7 A;  3N0Q A;  1PPJ E;  4NBH D;  3GTS A;  4QDF A;  3C0D A;  2HMJ A;  3L74 E;  1ZRT E;  1VF5 D;  5HL4 A;  4NBC D;  3AZC A;  4HM3 A;  2XR8 A;  4NB8 D;  1G8J B;  2GBX A;  2E75 D;  1JM1 A;  2I7F A;  5KLI C;  1G8K B;  3H1I E;  4NBB D;  3EN1 A;  3VMI A;  4NBA D;  4AAY B;  4QUP A;  1SQX E;  4P1C H;  1SJG A;  3VCP A;  3L70 E;  2BMR A;  3VMH A;  1O7M A;  4HM6 A;  1NTZ E;  1NYK A;  2XRX A;  2QJK C;  3GKE A;  2QPZ A;  2DE5 D;  4NBF A;  4QDF B;  2NVF A;  1SQP E;  4U3F E;  4EMJ B;  3GKQ A;  3FOU A;  3CX5 E;  2A06 E;  4NB8 A;  3GZX A;  3VMI D;  4NBB A;  1NTK E;  1O7P A;  4HM0 A;  1BCC E;  3GOB A;  2E4Q A;  1VM9 A;  2HMO A;  2HMK A;  2HMN A;  4QCK A;  4HM7 A;  4HKV A;  2NWF A;  2BCC E;  2IBZ E;  2NVE A;  1FQT A;  2DE6 A;  2HMM A;  1Z02 A;  4QDD A;  2YIU C;  2HML A;  1O7G A;  1SQB E;  2D2C D;  1O7N A;  1ULJ A;  3CWB E;  4HM1 A;  1NDO A;  5CXM A;  3H1H E;  1Z01 A;  4NBA A;  2JO6 A;  2ZYL A;  2E76 D;  4NBE D;  4P1B H;  1EZV E;  1P84 E;  3VMG A;  1L0N E;  2NUK A;  4QUQ A;  2XSO A;  1SQV E;  4NBD D;  4AIV A; 
#chains in the Genus database with same CATH homology
 2E4P A;  4H13 D;  2BMO A;  3EQQ A;  4HM5 A;  1BE3 E;  3L72 E;  2B24 A;  3VMH D;  4HM2 A;  2ZT9 D;  3GCE A;  4HJL A;  5KLV E;  3H1J E;  1PP9 E;  2YVJ B;  4NBF D;  2DE5 A;  1NU1 E;  2QJP C;  3GB4 A;  1RFS A;  4NBG D;  1RIE A;  4HM8 A;  1SQQ E;  1WQL A;  4NBC A;  5KKZ C;  1KB9 E;  2E74 D;  4HM4 A;  1UUV A;  2NUM A;  4QDC A;  1VCK A;  4NB9 A;  1UUW A;  3GZY A;  4NBE A;  3CXH E;  2CKF A;  4NBG A;  3H1L E;  4NB9 D;  3GCF A;  1KYO E;  1O7H A;  1NTM E;  3GL0 A;  2JZA A;  4H44 D;  5AEU A;  1Q90 C;  3BCC E;  4PD4 E;  2FYU E;  4QUR A;  4PV1 D;  3GL2 A;  3VCA A;  1O7W A;  2Q3W A;  4NBH A;  1Z03 A;  4H0L D;  1WW9 A;  4NBD A;  2YFJ A;  3L73 E;  2DE7 D;  3GTE A;  3L71 E;  2FYN C;  2NVG A;  2GBW A;  2BMQ A;  1L0L E;  5AEW A;  4OGQ D;  2YFI A;  3D89 A;  1ULI A;  3TGU E;  5BOK A;  3VMG D;  2QJY C;  2XSH A;  3H1K E;  3DQY A;  2YFL A;  3L75 E;  1EG9 A;  2B1X A;  2DE6 D;  2DE7 A;  3N0Q A;  1PPJ E;  4NBH D;  3GTS A;  4QDF A;  3C0D A;  2HMJ A;  3L74 E;  1ZRT E;  1VF5 D;  5HL4 A;  4NBC D;  3AZC A;  4HM3 A;  2XR8 A;  4NB8 D;  1G8J B;  2GBX A;  2E75 D;  1JM1 A;  2I7F A;  5KLI C;  1G8K B;  3H1I E;  4NBB D;  3EN1 A;  3VMI A;  4NBA D;  4AAY B;  4QUP A;  1SQX E;  4P1C H;  1SJG A;  3VCP A;  3L70 E;  2BMR A;  3VMH A;  1O7M A;  4HM6 A;  1NTZ E;  1NYK A;  2XRX A;  2QJK C;  3GKE A;  2QPZ A;  2DE5 D;  4NBF A;  4QDF B;  2NVF A;  1SQP E;  4U3F E;  4EMJ B;  3GKQ A;  3FOU A;  3CX5 E;  2A06 E;  4NB8 A;  3GZX A;  3VMI D;  4NBB A;  1NTK E;  1O7P A;  4HM0 A;  1BCC E;  3GOB A;  2E4Q A;  1VM9 A;  2HMO A;  2HMK A;  2HMN A;  4QCK A;  4HM7 A;  4HKV A;  2NWF A;  2BCC E;  2IBZ E;  2NVE A;  1FQT A;  2DE6 A;  2HMM A;  1Z02 A;  4QDD A;  2YIU C;  2HML A;  1O7G A;  1SQB E;  2D2C D;  1O7N A;  1ULJ A;  3CWB E;  4HM1 A;  1NDO A;  5CXM A;  3H1H E;  1Z01 A;  4NBA A;  2JO6 A;  2ZYL A;  2E76 D;  4NBE D;  4P1B H;  1EZV E;  1P84 E;  3VMG A;  1L0N E;  2NUK A;  4QUQ A;  2XSO A;  1SQV E;  4NBD D;  4AIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...