4QWWC

Crystal structure of the fab410-bfache complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
212
Chain Sequence
b'QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMYWYHQKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSLSVSSVEAEDAATYYCQQYNSHPMTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholinesterase
publication title Crystal Structure of Snake Venom Acetylcholinesterase in Complex with Inhibitory Antibody Fragment Fab410 Bound at the Peripheral Site: EVIDENCE FOR OPEN AND CLOSED STATES OF A BACK DOOR CHANNEL.
pubmed doi rcsb
molecule tags Hydrolase/immune system
total genus 54
structure length 212
sequence length 212
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qwwC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qwwC01
2OI9B 3WIIH 4M5ZL 5IMKB 2DD8H 3LMJH 5FYLL 3LH2L 3T4YB 5DMIL 3P9LA 1B0GA 4NNPH 3I6KA 5CZKA 3BP7B 1WWAX 3V6OE 2WIMA 1EZVY 1A6AA 1TFHA 3VFUA 4JGUA 3TCLB 4BFGA 1HK6A 2GFBB 3V52L 4KGLA 4NKIL 4XPGL 4ENEC 5C2BH 1QSEB 2NY2C 3FL7A 2R8SH 1IEHA 1TJIH 1NEUA 2NXYB 3P9MB 4M3JA 3QFJE 4IRZL 4ELMF 5IBLD 2UZIH 4Y1AB 4HEPG 3S3SA 5BQ7B 5JUEL 1XGYH 4YQXL 1NFIB 5K9KB 2H9GA 4L4TB 4WI4A 1FVCB 1F4XL 4XBGB 3SQOL 2P5EE 3W11C 1VGEL 3JZ7A 4MB3A 1T5XA 4M1CD 1JNNH 2JTDA 3T0VA 2J8UB 2RQ8A 4PS4L 3AB0C 5FB8A 1Z0MA 1W2KT 3K80A 5FO8A 3O8XC 5EZIL 4JAMA 2VH5L 1GOGA 2P46B 3TYFB 5T1KB 3HCVA 3QAZB 5HGAA 4UB0L 5GISL 4JFQA 3SGDI 4G8GD 4X9IA 2NY6C 1P53A 1QLRB 2H1PL 3P30L 4RRPG 5FO7B 5JW4N 5EPMB 1FORL 3IDMB 3HR6A 2NY4C 4N0UA 5GS1B 4FFYL 1KN4H 3JWDL 4OFDA 4FQIH 3BZEB 3MROA 3LEYL 1UCBH 1AQDB 1HZHL 4NKDA 1ZT1B 4QF1B 4ZOAA 1R3HA 1F2XK 3EDEA 1JF6A 3OXRB 43C9B 5DUPH 4FS0A 3RWEA 4EN3C 5IOPA 1WIUA 4L8SC 2VTFA 1JV5A 2DM7A 1OM3L 2KBGA 3P73B 3C60B 4POZC 4H1LH 1B6UA 4JFDE 1NAKL 5ICXB 1IQDB 5FHBL 5JO5A 4P3DA 2FWOA 5IVNA 2XWTB 5KVDL 4HGWA 4F7PA 5FUCE 2GHWB 2ESVB 4HQQL 4F33B 3VD3A 3HN3A 4AL8H 5IFJA 4R0LB 4WFFE 3FONB 5DD6A 3RTQC 4EI5B 1MIMH 3QIBB 1G84A 4NSKA 3CXHK 4PLJC 1FP5A 4HDIA 5CEXB 5DJDA 1I9EA 4JFFD 4LLVB 2AJSH 3JTTA 5FA4A 3T2NL 5D7KD 1L0QA 2ARJB 4JFED 5KVMC 4JLRB 1U8KB 3NBNA 4ZUSB 2XKSA 3S4SG 5JOFA 3BZFB 5ETUB 5HHXL 2BRQA 3LKNB 3O6LH 2BFVH 4OFIA 1PY9A 5F97E 1L6ZA 2VXSL 1Q9WB 5CINH 2X4QA 2DQJH 5A2KH 3NA9L 2ICCA 2BHZA 1IC7L 1P4BL 2Z93A 5DVLA 3X3GL 1NCBL 1SBSH 4LU5H 4OCNC 1RUPL 3VG9B 1B88A 5DR5L 3UTTB 3V5HA 1WAAE 4TTGA 2YC1A 1B0WA 1BECA 2WINA 2UWEF 1NC4A 3SJVB 3W9EB 3WIHL 3W2DL 4Q9QH 4HFUL 3GMPA 3BQUA 3VJ6B 5GS0D 1G7PB 1I3UA 4CW1B 5LCVL 4WV1A 4F7TA 5EOTA 1KUMA 5GXBB 4P23D 2F54B 4Y4FC 4M9PA 2CKBB 2AV7B 4UU9B 4KJYA 4Y1AE 1MJ8H 2OP4H 3ULUC 1WWCA 4JRYB 5KANI 1A9BB 4L4TE 4UIMB 3ILQC 5EU4B 4OV5A 4PTTB 3WKNA 4JKPL 1ZANL 4BA8A 1C5DA 1KELL 3FO9B 1F3RB 2FGZA 1DLFH 3V95A 3D1MC 3NTCH 1OP3H 5E08H 1NEZG 2VIRA 4XCFH 3T1FA 4YXHL 1RUAL 2ICWJ 4LLDB 2VDOL 3DXAA 4HGMA 5J12C 4KU1A 5E8PB 1Q94B 1P2CB 1CDCA 4BH7B 3UJJH 1U8HB 3A0OA 2CDEB 1MFAH 4NWTL 3G5VA 4X6CE 4ZPVA 1VERA 1ZT7A 1A4JA 5T1MB 2G2RB 3KLAA 3WIFA 4MJ4A 4NWUH 1I8LC 4HWZB 2IGFL 5EOCJ 4R26H 4KKBD 3WIHA 1S7WA 2VNCA 1ZGLA 5F6HJ 2AJ3A 5I1GL 3U0PB 4Z7WA 2B2XH 3K3QA 2GEEA 3UBXB 1Y18B 1WEJL 1FPTL 4APQA 4GRWB 1TQBC 4G8GB 1Z3GL 2JB6B 3ALWA 4WENB 1C1EH 2NZ9D 3L7EB 1GGBL 5E5UB 1E4XL 1DUZA 1TZHA 4OM0H 1NAMA 3OKOA 4TSAL 1T1ZA 3AS1A 1MFEH 3H3BC 1J0JA 4JHBA 5C92A 2HKHH 3B9AA 3T2PA 5T5NG 1CD8A 4HPYL 2P47B 4HF5L 1IAIM 5JHDB 5KAQF 3RZCA 3F65A 4FG6D 5BXFA 4NUJA 5J13B 5D71H 2HH0L 3U46A 4U2YA 3ULVD 3RVWC 3ZSSA 4LKXB 3E8UL 4RGNC 5BVJA 4OCRH 1NFDF 3RL2B 5L0QB 2FGWL 3D18A 2BRRL 3CFDB 1IL1B 5HYJA 2CMRL 4PJGB 2GSGB 1XGUA 1XZ0A 5IESH 2NX5D 4XWOC 2IH1A 2VDPH 1RIHH 1VSCA 4Y5YA 4XI5C 1B2WL 4TPRH 3PE9A 3FN0H 1EAJA 3ULUF 3BGMA 4ZOCA 4S1RL 1JTPA 4OLYL 4Y16A 3KJ6L 4JFFB 5GGQH 3H9SE 3NFSL 4TVPL 5F96L 4LSQH 4JFEB 4OCWH 3SDXB 1N0XH 2BSRB 4G8EA 3TIEB 2BVEA 3MFFB 4U1HA 2Z8VC 4YGVB 4WWKD 1HI6A 4PJBF 4WRLA 5E8EB 4JN2B 1UXSA 4ZOBA 5EZLB 4X6BB 1ZEAH 2F54E 2PW2A 1T5WA 5I71C 2H45A 3S6CA 2V5TA 2B1HL 5F9DC 1PFCA 4QRPD 4HT1L 5CWSA 1A7OH 3K74B 5CBAA 1C08A 3X14B 1I1AC 5A1AA 1O7SA 5CD3B 4IOIB 3O3AB 3O3BB 4ALAH 3ULUH 2XY2A 4WVRA 3C6LC 4RQQB 5IWLC 2GAZA 1F6LL 1VADA 3IDGA 4P23B 3W81A 3BISA 1JTTA 1IT9H 4P3WA 5E4EB 4LBEA 4P3CL 4KHXL 4YHZH 5J1AA 3P9WB 3HPLB 2JCCA 1JIBA 2F8VA 3WFCL 4JY5H 2EH8L 2ZNWA 4HK3J 5HJ3B 5DLML 3IJYB 1JYVA 3B8YA 3BHBB 4QHNB 3AAZB 1FO0H 1U8IB 3I9GL 3DJ9A 4HIXL 1GZQA 4OCMC 4I18C 4NC0B 3EYFA 3RDTA 5J6HB 1U8MA 3D85A 5DI8B 4WHYG 4RIRA 4KK8D 1XF4B 5C86A 1A7PH 5LWYH 4W70A 2DRUA 4PJIF 5IEHB 2UUDH 1MLBA 5HYIA 3V0VB 1QKZH 4HW6A 5SX4I 5D72H 4Z7OE 2EO9A 3OV6A 4G7VL 5GS3A 1H3UA 5JHDE 1W72H 3GMNB 2HFGL 2A83B 3PWJB 4EXKA 4X4MA 1BZ9A 1GPOH 3WD5H 3MRHA 3QDJD 2ATKA 43CAA 4EVNB 1J05A 4P4KD 3HE7C 1CICD 3L5XL 5TQ0L 4AENB 5BOPA 3CD4A 2R2EA 3DI2B 4XC3L 2P1YA 1D5MA 5KZCD 4KVNL 3SDAD 2ORBL 5HY9B 2B4CL 1FL6A 1LMKA 3CSGA 4NGHH 4UV4L 3H42H 1QO3A 4M48H 5I2IA 1CZ8H 1EGJL 3FOLB 4EKXA 5HPMB 4CVXB 3Q5TA 1YMHA 3GKWL 5L9DH 2VE6B 3PJSB 1CTOA 5HYQB 5E5MA 5EBWB 2XZQH 3NCCB 3MBED 4MJ6A 4WI8A 2EKSB 3IETB 1U8LA 4WTZG 1IC4H 5GGTL 2MPAL 2DB8A 2KH2B 2GTWB 1BD2E 1PZUB 2NX5B 2OTPA 4DN4H 4MQTB 5GGSY 1R3KB 1JFQH 4K3DL 1FL5B 2YWYA 3IJHA 4JO2H 3TP4A 3I02A 3DX6B 3GIZL 1IGYB 2VDLL 2GTZB 4N9GA 4M7KH 3UZEA 1MELA 1AFVL 1KOAA 3MREB 1QBML 3PV6A 5C07D 1UWGH 1N7MH 3QDHA 4V1DD 4JG0H 5TPWH 1QBLH 2NY7H 1J1XL 5MHSE 4FZEH 3HAEH 1S7SB 1H8OA 1XCQB 2QHLA 2Y9RT 4QRQA 3L5JA 4KJPD 4WWKB 1KNOA 3WFEL 3L3DB 1A7RH 3LS5H 4QHUA 5MENA 2MKLC 3QUMB 3KYKH 4GSDL 3F7PC 3NCJL 1I7TA 4OAWB 4BK4A 5EC1A 5J11B 3TO2A 4AM0B 4PYGA 3BUYB 3BSZH 4LCCA 3VXUD 4RFOL 1GYAA 4NDMB 4FN0A 2FR4B 5IF0A 3CFBB 4QRPB 4XNYH 1A6PA 1N64H 2XN9B 4P9MH 5BCAA 1NCCL 5T5FH 2KKQA 4GW5B 1FNHA 5EUOB 1SVZA 2DIAA 4TNWK 3MV11 3HZVA 2R4RL 5ALCL 3CPLB 1ACZA 1KXQE 3O4LA 5EU6B 3S37L 4PGZA 1TPXC 3OR6A 5ADPL 5IT2H 3QUXA 5SV3A 3ROLB 2VL5B 4BH8B 1QNZH 4PRNA 5K9OB 4WFGE 4D0BA 1FIEA 1E0OB 5BRZB 3D2UA 5EORL 5HI5C 5E2TL 4L9LB 1OAQL 1A3QA 3F5WA 1Q9OB 3KWWB 2YRPA 2DWEA 1FBIL 3C87A 5EH1A 1JZ3A 3CLEH 3P11H 5J56B 1X5XA 3UX9B 1T2QH 1JZ7A 1QG3A 2FBJH 3DETC 4IBLT 3UTSE 4QT5A 2UVEA 4D9LH 3GK8L 1WK0A 3QJFA 2EC9U 5DD1H 5ESVA 2AK1H 5J0BA 1YY8A 4G6AC 3S4SB 3VWKA 1RZ7H 3X11A 5KSBB 1U0QA 1NDMB 1FE8H 4IHOA 5I1IH 3ZMRA 3IFNL 4RWHA 3JWOL 5C71A 4O2EB 2MHAA 5LGKA 3HZKA 4G80A 2R23A 1MI5E 2BDNL 4PV8B 2QSQA 1W0YT 4CADA 3WDHA 3IJSA 3QDJB 2IAMA 1JPFA 2I9LA 5FYKE 1CICB 4M5YH 1ADQH 1I7UB 4FQ2H 5TH2B 4NRYB 3T65A 2HT2D 1BLNA 3TN0D 5C0CD 5JR1L 5KZCB 2DWDA 3SDAB 3CMOH 3OJDB 3REWA 4WFHD 3GSRA 5A2LH 3ZTJG 3CH1B 1NC2D 3GSQB 3CDFA 4GG6B 5EIIB 2AAVA 1ACYH 2K7QA 1PX3A 3FZUC 5HDBE 4OLZH 5T1LD 12E8H 1CXLA 4O00A 3QJHB 5CGTA 2EYTB 3MBEB 1NEZB 4PGJA 4WHTB 1UB6A 1BFVL 3MRDB 5F7EH 2AV1A 1D9KA 4KTYA 1E28B 2FH6A 4I0PD 4NCC1 4PJ8A 1F3JB 1KPUB 3FB5A 3QXAB 1NMBH 2QADD 1UXWB 5JXED 2WLYA 4MAYD 4P5KB 3BW9A 3L3JB 4DOHB 3CVIL 4M7JH 4JHAL 1LO2H 5JIIA 3VFWB 5C07B 1R0AL 1KFAL 3KPSA 2AXGA 4V1DB 4UBDC 1FVDB 4NJAH 5EZJB 4NN6C 4F37K 3ARFC 3BQUC 4X99B 1OPGL 2D7QA 5IV2B 2X4PA 2XN9E 2D7TH 4O51B 2B39A 4YIQB 1CFTA 4WV1C 3WBDA 3QRFM 5DTFB 1GL4B 8FABA 5B4MC 4TSCH 1SJHA 3SDYH 4IS6B 5EU6E 5DJXA 5C0GB 3NH7H 4KC3B 4PRIA 3B3IA 4XH2A 3VA2C 3VXUB 1ES0A 1I1YB 5BRZE 3BT2L 3RWHB 1WF5A 2YHGA 5C0IA 3JWNC 1UWXH 4ZXBA 1CDUA 4JRXB 4XTRD 4FNLH 4YNYA 1CF8H 5JLZA 4HUVA 5DA4A 4WU5A 5DD5L 4EI6B 3IDXL 5JW4R 5IHZA 3OXSA 4X5LA 4U0RB 4Z7UA 2CRMA 2YK1L 4JKMA 3H0TA 3WFDL 1FGVH 2IMNA 4H5SB 4NYLA 2A6IA 2R56L 4OLXL 1SEQL 3QQ4B 4YHKL 4KVCL 4KK9C 2Y72A 1AIFA 2FEEL 3T4AA 4MJIA 4NQED 2QQQA 4PJ7A 5E8NA 4UINL 3WFBH 1T1YA 1S7VA 1RD6A 2YZ8A 1K8IB 3E3QC 2BVUA 2NZIA 3HZMA 4PRDA 1NGQL 2D03L 3EFFB 4R4FH 3BWAB 5D2NA 3L5WB 3CK0H 4RGMC 3KAAA 1T3FA 2V6HA 4K2UL 3MLRL 2R1XA 3ZDXF 3QDJE 4OIIH 2XG4A 3WHE0 1JGVL 2ICWA 4HUMB 5GRXG 2AJUH 2P5WB 2G75A 2OMNA 2QQNH 3RU8H 2BCKB 2X7LA 4P2OA 2VLJA 3M17A 1ZVSA 1KJ2L 1SHMA 4X8JA 1LEKA 3GSNL 1GAFH 2NY1C 4JQIL 1G9MC 2OXGA 1PVHA 3RZCC 1DQMH 2VAAA 4HKZB 1N5YH 3RA7L 1AY1L 2VDRL 4J3XA 2QKIB 4ZDHB 1KJ3L 4HFWA 1N2RA 1T7XA 3NACH 4K71B 2HRPH 2J7LA 1P4IH 5EU3B 2DDQL 3OPZH 5EU7E 4GXVH 3KPPA 1FV1A 3HKFA 3ZT7A 2YR3A 5HPOA 4QY8B 2AXFA 3TN0B 5C0CB 5J7CC 4Y5YC 5EO1A 4ZFGH 4OGYH 3Q1SL 1IEAB 1NC2B 4OLVH 1F4AA 4X5WB 1JRHH 4XNMB 3QHZH 4FQHA 1YN7B 1HEZA 3ZT5A 1JWMA 4Z8FH 5HHVL 4LL9A 2NTFA 4PY8J 5T1LB 1IAOB 4TVSa 4LSRH 4WEBH 5GJSH 4JN1L 3N85L 3LRSA 4RFEA 1M6OB 3EO0A 3O3EA 4X0KB 3U36A 4G8FA 3OAYK 5CP3H 2J4WH 5GPRA 4JGJA 4JDZB 1PSKL 3QA3B 1CXHA 3DYPA 1O5DT 4P2RE 4I0PB 1IGCL 1MWAB 4NOFA 1QSFE 1CL7L 2QADB 2NLJA 2IMMA 1CS6A 4MAYB 4MQXC 4CN6A 1DE4A 2PYFB 1S7UA 5KANG 1JRHI 1QSZA 4QRSA 4S1QL 4PJAF 5IQ9A 3ARXA 3U1SL 3UTOA 1NGXA 1UVQA 3IGAB 4J4PA 3L5HA 3IDYC 2A9MH 4Y4KA 3NZHL 3WEXA 5L6YH 4X7FC 3O9WD 3P4OA 5B38G 4PP2B 1MCWM 3LQZB 1HWGB 4JRXE 3TM6A 1FNAA 2YXMA 4YPGB 3CGTA 1Q0XH 1YEJL 3TV3H 2XWJB 3CIQA 3K1KC 1N0LA 3TNNB 1ONQB 1LDSA 4PJXA 3QUYA 3VFSB 1KB5H 1G0DA 2VLME 2AJVL 4BFEA 2Z92B 3U7WH 3R06B 3A6BH 3H3PH 5KSUB 1U6AL 4KZEL 3FKUS 2IPTL 4E0RA 2FCBA 1AD0A 2CGRL 5F9OH 1EJOL 5A3ID 1S7QA 5I1EH 5JNYA 1HSAB 5KVFH 1OVZA 3GMLB 3QXDA 4PR5A 3EGSA 2VOTA 4G3YH 3LKPA 1P7KA 3V6OA 4MA8H 2IQ9H 4JO4L 3RDTC 1NANH 1ZV5A 4JB9H 4QHKI 4WW2B 1WWBX 4YHMH 2G5BA 3UTPD 4B7LA 2ADIA 3BKCH 1S7RA 3QFJA 2QHRL 3B9KA 5I16A 1KCLA 3EIFA 2QR0A 1LK2B 2GSIA 2P5WE 5DQ9A 1AGEA 1J88A 3EZJB 1FRGL 4ODUA 2P5EA 1L7TL 4X4ZA 1XR8A 4MCYA 5FDWB 4PGDB 3VWJD 5TGBB 4KKLC 4XCNB 3C8KB 2NNAB 3MLTB 4LLUB 2F53D 4QWWD 5D96B 3EZ8A 1ZWIB 4HWBA 2BSSA 2Y5TB 1NAMH 1FN4B 3C2AH 5IW6B 1SEBA 3LHPH 1DN2A 5EC2A 5L8LB 3IRZA 3LPFA 1AGBA 4P49A 1IGTB 4L8DA 3GJFB 1UM5L 3GBLA 2HYMA 5C0CE 2DM2A 1SJEB 5FO9A 1LILA 4JZJB 1QD0A 4XXDB 1UJ3A 1SY6A 4AK1A 4CN1A 1C5BL 2QL1A 5GGRA 3DURA 1F97A 4U7MA 5I8OL 5J06A 1H5BB 2BVPA 5D1QA 1I9RH 4UAOB 4NPYA 3VRIB 4DQOH 4OFKA 4QTIH 1LP9B 2W0FA 1RK0B 1YJDL 4IIQC 2VXTH 2O61A 5DSCA 1YMMD 2CK2A 3PQYD 4JFDA 4OZIB 4I48A 1A1OA 1IVLA 2CXGA 4EDWH 3IFLL 2IJ0C 3BRFA 5ITFB 2C3VA 4QCIA 3MV9E 1WUNT 4JZOB 1JPSH 2JCCF 5DYOA 5CEZH 5F1KC 2OL3A 4XPTH 5EBGA 3QULA 1KC5L 5E6ZA 3HZYA 5KAQG 5B39G 5C0JB 5KSAD 3ARZA 1HYSD 3LY6A 1MHCB 4H8WL 3FN3A 3HRZA 5BV7B 4Q2ZA 1JWUA 4YLQT 5F7NC 2X4RA 2IANA 1QFUH 5AZEL 2WK2A 4XVJH 1BIHA 3Q5YA 2EXYC 3RHWF 1IQWL 5T3XL 3CSYB 3WXWH 2D2OA 4LCCC 1C12A 1E6JH 5LGHL 1NBYA 1FAIL 4PGBB 5L2KB 4OZGE 3LSOA 1PEZA 2X4NA 2ZKHH 5F44A 3GGWA 5F71A 3BP4A 4UTBL 4H25B 5AEAA 3O9WB 3EO9L 4MHHI 1I75A 1CFNB 1WAAA 5DEGA 4PJEB 3T4YA 1BM3L 4PJHE 4XP4L 5HGDA 3O2DA 5H37H 5E8OB 4CNIA 4PUBH 3QUXC 4WWID 2GFBA 2B1AH 5DGQA 5ID0B 4P9HL 2AK4D 2NW3B 2HLFC 3O81A 2OQJA 3RGVD 2OTUA 4Z95H 1N59B 4KI1A 4ORGB 4Y1AA 4ZS7H 1MLCB 4GJTB 1OTUC 5K9QI 1GZPB 4OSUH 1JYWA 1NFIA 1YY9C 2R0LL 3T77A 1EMTH 4N8VG 1M71A 5I73B 2ZG3A 3G6JB 3UYRH 1A4KA 2CSPA 5ILTH 7CGTA 3QG7L 4GBXA 4Z7QF 3MXVL 1H0DB 3WNNA 3VFGH 2A0LD 1A14L 3SCMD 1QVOB 3VH8A 4X80H 1GCFA 5CD5D 3ARED 4XZUB 3QR2A 5AD0A 2P4AB 5E6YA 4WI2A 4X6CA 5EUKA 2EDXA 4AEHH 1U8JB 1KB9J 2CO6B 3BZEA 2NTSP 5CP7B 3VWJB 2FB4L 2Q6WA 1PG7H 5ALBL 1REIA 4HMEA 5E00A 2F53B 1V3MA 2RR3A 4LVHC 3DO3A 2IAMC 4M02A 3SO3C 5F7FA 43C9A 4QOKD 3MJ6A 3ZKQD 5CHNA 3NA4A 4OD1H 3G08A 1KIUA 3VGEA 1VFBB 3VI4E 2QSCH 2N7AA 2IFFH 2KUTA 4X4YA 2CLVB 4DVRL 4LLYB 4OZIE 1JPST 4MAUH 2XZAL 3PL6B 3N1GC 1ZLUH 2NY2D 4JY4A 4PV9B 2AABL 3UPRA 1MCPH 2B5IB 2CKBL 4H20L 3VU2A 3FONA 4HCRL 3S96A 3TT3L 5CEXA 3W11D 1D9KC 1FZJA 4XBEL 4ODVH 5JDSA 4PJ8C 3LKOA 1YMMB 3PQYB 3QNYA 1FIGH 1O7VA 5DMJB 3O8XD 1J86A 4NQXB 3BZFA 2AJYL 5LGJB 5GSVB 1VGKA 1BQLH 3UJTH 1II4E 2NY6D 3D25A 3CUPA 4X6DE 5CS7A 4HXBL 3HAEG 2DM4A 1TZGH 1CR9L 2KQNA 1HNFA 2NY4D 4JY6A 4M8QA 4UOW1 4X83A 5L2KE 1NJ9B 1KIQB 5T1DH 3QI9D 4U1JB 5SWQB 3E1F1 1AI1L 3H9SA 3G5XA 1A1NA 4JFYB 5EOQL 4G43B 4PJEE 4MMXC 4LSSH 1NBVH 1KCUH 1FNGB 3ARRA 1RZKC 3DROA 3VJ6A 4LRNH 2IPUK 4EN3D 2WUBL 2XNAB 4KJQD 3CFJA 3BP5B 4KDWA 1WITA 5H8DA 4DAGL 4ELMB 4OCXH 3SGJC 4M6OH 3Q6FB 1UQSA 5FGBA 1HSBA 2F54A 4HCRA 4JM2F 4POZD 2CDGB 2AEPL 2P7TA 1EXUB 4UIMA 4CJ0A 3FQRA 1OWRM 5EU4A 2EO1A 4PTTA 1N6QH 2VDNH 4DGIH 4J3VA 3U4BH 4OD2A 2P8PA 3HB3C 3LKQA 4F8TA 4KROC 1JF1B 5IM7A 1HINH 5FIEA 1TCRB 3RTQD 1UH3A 5C0EB 4U1IA 4PLJD 4JHWH 3MMEB 1OTSC 3VXTB 4QYOA 2A1WH 2VC2L 2DOCA 4OCLC 1KPRA 4BH7A 1U8HA 1ERNA 1U3ZA 5IHUH 4MNHB 4LF3A 1OD9A 1OLZA 6CGTA 4P2CG 4HEME 2G2RA 2XFXA 5D2NC 1MREL 2LE9A 4OBRA 4O02L 2UZXB 5ISZD 3IXAA 2L4OA 1ZXQA 4AMKL 1IAIH 5ADOH 3SCMB 1OSPH 5AWNH 1I3GL 1JWSB 1S5HB 2WQ8A 5DHXB 3MOBH 1U8QB 1FFOB 4Q9CA 2KL6A 4P2OC 1T2JA 4HBCL 1VKXB 1MFCH 1Q9LA 1JNJA 4NFDA 1XIWA 3OR7A 3MCKA 3N1MC 2O26U 3CSPA 1K5NA 5B38B 4AQ1B 3SKNB 5JHDA 3ULUD 2VDQL 3BKYL 3L6FA 5FECB 2YD1A 1IAII 3QCTH 3D9AL 4QOKB 3EYVB 4LCUB 3ILQD 5HHPB 1PZ5B 3QH3B 1ZHKA 4KDVA 2H2SC 4EOWL 4YR6B 3U6RB 3PQYE 4TSBH 1A5FH 4U6YB 3PF2A 1IL1A 1S9VB 1S5IL 3RPIB 3IXTB 5GS0L 3PGDA 2NY2B 1CQKA 1F4YH 3DUSB 1RHFA 1A0QL 2IF7A 2XKNA 1IZJA 2ZOLA 3ARQA 2CPCA 4HGKC 1MEXL 1YQVH 4U6HA 3U82B 3V6FB 2Z31A 1KYOK 5BZDB 4G9DB 1H3PH 4LAQL 3B6SB 2VXUH 1H3TA 2VZUA 3AB0B 4YJZL 4U3XA 3CNKA 3TBWB 3CVHA 3O8XB 1BD2A 3TO4C 1MUJA 4AIOA 2DJSA 4I2XB 4PRHE 1BX2B 3C5JA 4PJ7F 5EBLB 1LE5A 3NCYP 4J4PC 5EZLA 3RL1A 4ELME 2DQCL 2NY6B 4R4BA 4WEUD 4UT6H 1JZ4A 1CLYH 4Y4KC 2DQUH 5DQJB 2X70A 2NY4B 4HS3A 1KTDB 4K3EL 2HFTA 4MD0B 1RZKH 5TF1H 3PGCB 4PRPE 5FUZL 5TQ2L 4M43H 1G0YR 4IOIA 1CK0H 2CD0A 3FO0L 3O3AA 4LPWA 1EEZA 3ISWA 3O3BA 4EN3B 1QQDB 2BVQA 3TH2T 3RVWD 5D70L 3VMPA 4RGND 4RQQA 4OB5H 4ZNEE 1SJXA 4NKMA 3ZL4H 3V4VL 5KVGH 3LD8C 5F7MC 4XWOD 4HIJB 4PG2A 3SKMA 3V6OC 2G5RA 4XI5D 1MHPH 5HJ3A 1R5WB 3VFNB 1J0ZA 2LTQC 2VXQH 1IGFL 1R5IB 1YN6A 1YEEL 1DP0A 4HXAL 3BDYH 3AAZA 1JGDA 3DSNA 3RTQB 4X7SH 1FH5L 3B43A 4EDXB 3N9GL 3B9KC 5D1ZA 3ULVL 1HXMA 4M61A 1HHGB 5DI8A 2YS4A 2O5YL 3VXPA 1UB5B 4TUKH 1EFQA 2XV6B 2YUVA 3ARWA 3VFPA 5I1KL 3D69A 4BSJA 4D0CA 1BVLA 3TBYA 1DANU 2AEWA 4J6RH 1QEWB 4RAVB 1VFUA 1EO8L 1RULL 4R7DA 1ZHNA 1ZLSH 1F58H 5HI4D 4EXPX 5B3NA 1BP3B 5F7LB 5B39B 5ISZB 1B4JH 3UTSA 1LEGA 3BE1L 3GMNA 1J87A 2HMIC 1XF5B 3CC5A 2A83A 3PWJA 4UILL 3DTXA 4UIKL 1NFDB 1KCRH 3VXOB 4EVNA 3BKJL 2QQLH 3O2VH 4JFZH 3S7GA 3WN5A 3S88H 1TLKA 5FHAL 5ITBH 1I1AD 3GI9L 4B5EA 1N4XH 1OAUL 4ZSOB 2ZZUT 4PY7B 3C6LD 4RISL 2ICWI 1R5VA 5D1QC 1VDGA 3DV4B 1MI5A 3QUML 4JDTL 4G6KH 4JFPA 1WIOA 4WUUD 4Y4FB 5EULV 4GT7A 2VISA 4BZ2L 1A6WH 5D4QA 4P2YA 3FOLA 5HHQA 5I17A 3MRIA 4HHAA 4LLQA 1IJ9A 4W6WB 3FO2B 2EDFA 5JPNB 5IJKA 3PJSA 1DBJL 5HYQA 3L3OA 2HTLC 2UWEE 3IF1B 5DD0L 5FUCC 5EN2A 4PJBB 2Q87A 2Q3ZA 5F6HI 2GTWA 4HS8H 1HKLH 2FEEI 1D5IH 1IKNA 2VSCA 4ZO8A 1ZHBB 4G6ML 5J12B 2ZG1A 1FL5A 3GIVA 1FO0B 4XPBH 2VLRE 1KXTB 2GTZA 4HC1L 4N8VB 2CIIB 5GSRA 3BGAA 1KV3A 4KKNA 3CLFL 1YEIL 2CUHA 4PJDE 2OK0H 1RU9H 2FNBA 1IGIH 3VXSD 4XP6H 3RWCB 5FYKU 2J3SA 4PGCB 1S7SA 2YSSB 5DHVA 2CK0L 4ODXB 1XCQA 4L4VB 5EBMB 1P69B 1VHPA 4TUOB 4MLSA 3FB6B 1S8DB 5IR1A 1TQBB 1YEDB 2D7OA 1G7JA 2V9TA 3HE7D 3RVXC 1K3ZA 4GKSA 1MFDL 4OAWA 1UYWH 1W72B 2HVJA 1SYVB 3ROOB 1D5XB 3OL2A 3KYAA 3BUYA 2ARWA 5LBSH 1S3KL 1HQRB 2R15A 4A6YH 3CFBA 4O4YH 5SWSD 4KQ4H 1P7QB 4ZTOL 2P49B 1OF2A 3ZTNH 4S2SB 4DZBB 2LFGA 2XN9A 4GW1A 1UWEL 5H94A 4DW2H 3U30C 4LCIL 2JIXD 3BAEL 4GW5A 5DJZA 3UAJC 2EYRB 1OAYL 3VGGA 1V3KA 3S36X 2CIKA 1A6VL 3C09C 4RGNB 3W39A 5EU6A 2A38A 2DLIA 3BPOC 4I4WA 2HJLB 4WHDA 5HHNB 4BH8A 3MLWL 4H26B 5BRZA 1FNSH 4PLNC 4QXGL 3OB0K 1XGRA 1JTOA 2ZWLT 1CD1A 2XXMB 2YUZA 4PBWD 1S9WA 3KYMB 1Q9OA 4HX1A 3MV8D 4LNVA 5J1TC 1AP2A 5GHWL 1C7SA 1CDBA 4GBXC 4MYWB 5C8JA 4ZMAT 3MUGB 1RJYB 1B9ZA 4Q58C 3T3PF 3F12B 1PYWB 1XT5A 4U05A 1XEDA 1NFDE 1QHOA 3HMXA 5JQ6L 2GT9B 5CILH 3RKDD 4HWBH 2VRAA 4GKNB 5DJ6B 1ED3B 1FSKC 3ZSTA 2ZCLL 2ADFH 3QHFL 3K2UL 3K4AA 5DJAA 3HAEB 1AKJD 3HNTH 1G1CA 4CMHC 1IE5A 3C9NB 3NFPB 4ODTL 4QXWA 4BSVA 3V9FA 1U2CA 5I71B 3SDDA 5E5RB 1T03H 4YO0B 1F3DJ 5IHBA 5M95B 1MPAH 2CH8A 1DBAL 3HC0B 3VFMB 2IG2L 3QQ3B 4LSPL 4N1EA 1I1AB 4KTEL 3MA7B 4BK5A 4HIIA 1I7UA 4N90E 4NRYA 4Y89A 1DFBL 2E9IA 3MLSH 1HH9A 4PJBE 2FECL 4NO3B 3OB8A 4GLRI 1X5AA 3C6LB 2DQEL 5C6TL 1N3NB 2R2HB 3NN8B 4XNUL 4ZYKA 4Z0BL 3DVFA 3K0WA 1A6UH 1EX0A 5B8CC 5EIIA 1QFOA 1NPUA 5FAAA 1E4WL 4PGEB 2VSDA 3PGFH 4LSVH 1P7HL 3E6HB 4JANA 4ZD3L 2FL5B 4CL7A 1HOCB 2F58L 3QJHA 4QHLA 2EYTA 3D87B 3L1OH 3TPUB 3MRRB 4K9EH 5I76A 2LVEA 4WHTA 1OAKL 2W0PA 3ZYIA 5GGVY 2I5YL 5DFWH 1U36A 3BPCB 2BJML 5C6WH 3WFHB 4DGYL 4L4VE 3DNKA 4OCYH 3ARGC 3QXAA 4HPOH 4I18B 1JNHA 3JV6A 3OGCA 4ODSH 3RP1A 3U48A 4LRIA 3QP3A 3B5TA 4P5KA 1R6VA 2Q76A 4N68A 3Q3GA 1TVDA 1TZIB 4MHHG 2YPLE 1BJ1J 2VR4A 2DTSA 4LLWB 5ACZA 3GBNH 5FYJE 3I6GB 1CG9A 3EYOA 4DUWA 5E7BA 5T3ZE 4FXGB 5F1NA 3OKNB 1J0HA 1FVDA 3CXHJ 1AR1C 5A2IH 3MLXL 3WJLA 5DRZB 4X99A 5IV2A 5CJ5A 4P2RA 4XBPA 3RY6C 5E03A 3BD4A 4MXVF 1QSFA 1MFBH 4Y19E 5FGBC 3ABZA 2OZ4H 1MCCA 3LEXB 1KCSL 3HE7B 4IS6A 4IOSD 4X6CF 5F9WC 5IFAH 3O2DH 1OD7A 1I1YA 2ZCHH 3VA6A 3MO1B 1VA9A 4PJIE 1VENA 2EDWA 4NP4H 5SWSB 1S9KC 2XA8L 3LOWA 4JRXA 2BC4B 1AJ7L 4WI9A 4PB9L 5AYQA 3B5HA 1LK3L 3TVMA 3MNWB 5CLWA 3BRDA 2JIXB 3FZUD 2K1MA 4JFHE 1V7ML 5JHLL 1HCFX 1INQB 3T0XA 3I3DA 1RURH 3NCMA 2X9WA 3K7UA 4M7ZC 1L7IL 3QQ4A 1XGQA 4FFVC 1MAML 1R3IL 1ZLVH 1TVBB 4U6VL 1G6RA 2JK5A 2EDJA 4PRAA 4KI5E 1VFAB 3ZKSD 4JVPA 1QLEH 5JMRA 4HUWA 1CGUA 4F2MA 5E70A 1FAKT 3MV8B 1HH6B 3LQMA 3VXNA 3KR3H 3X13A 1U93B 1KG0A 3RWGB 4NOBA 4DGVL 3RUGF 3H6JA 3MRQB 3NIDF 4UBDD 4Y5XA 5IG7B 5I9QC 4QTHA 5GRJH 3AU1B 1NC4D 2A9NH 1A64A 4FZ8H 1NCAH 3BQUD 4XXCA 2ZSWB 1JK8B 3KJ4B 1XIWC 2ADGB 1FNEA 2P5WA 3HNSL 1GIGL 2P8MB 5B4MD 1MWAL 2C4FU 1AKJB 2I60H 4QNPF 2AQ3A 2DIJA 3O6KL 1WZ1H 1Z9LA 1KJVA 2J1KA 2J8OA 4LIQL 4U1GC 4XMKL 1J1PL 4S0SD 1MNUH 2DLFL 3BPNC 1B0GB 5FGCB 3I6KB 2X4SA 1A6AB 3VFUB 3STLB 2R29H 4FQ1H 2Q7YA 3QQNA 1DQDH 1L0XA 1TTFA 3DXAD 2N56A 3NZ8A 3VD5A 4GRMB 3BWUC 5D8JL 5I1CL 3VD7A 2R0KH 4RMWA 3T09A 1TPXB 2XPGA 4KK9D 1JN6A 1UWXK 2H9GB 2Z31C 4XNMA 2AJXH 3FMGL 3AS2A 1T5XB 1IAOA 3GHEH 1YPZE 3IDUA 1M6OA 2F5AL 3OAUH 3PNWA 5MP6L 5FO8B 5JW3H 1MCOL 4JAMB 3ARSA 4JDZA 4TRPL 4CN4A 3HCVB 4APQD 5E2UL 5HGAB 4JFQB 5IROA 1CVSC 2PYFA 4PJFE 3LS4H 3MV9A 5CZVH 1HIML 3MROB 4EBQL 2Z35B 3IGAA 3QIWA 2RCSL 1G7QA 2J6EA 4NKDB 4OLUL 2DBLH 3DWTA 5I0DA 1R3HB 2NY1D 3LQZA 3Q0HA 4IRZH 3RZCD 2PYEB 2LAAA 4NZTL 3RWEB 5IOPB 4YQXH 2XWJA 6FABL 4L1DA 2NY5C 1JV5B 2Y07L 1ONQA 4JO3L 1CFSB 4GMSL 4OZHF 2Z92A 3R06A 3DYMA 1JP5A 5ACMA 5JO5B 3S5LA 5HYJD 2ILLA 2QLVB 2Q8AH 4HGWB 1RUQL 4OZGA 4RMTA 4ONFL 3EJZC 4PG2C 5EZIH 1NLBL 1HSAA 5C0AB 1KCKA 1M1SA 4UB0H 5IFJB 2IADA 4XVSL 5DD6B 3O0RH 3NAAL 4NSKB 1FORH 4NZDA 4U0QB 4HDIB 4PJHA 4R96A 5DJDB 4M1GL 4Y16D 5D1ZC 3W82A 3BEWA 4J1UB 3BVNA 3JTTB 4C83A 3RY4A 4WW2A 1IBGH 5FA4B 1F4WL 4MS8C 5DJCA 4Y2DA 1VEMA 1AHWC 4JO1L 1NCWH 5JOFB 1GC1C 2Z91B 4XP1L 3VGHA 3HI5L 5DRWA 3T2QA 1CBVH 3CAFA 1H9VA 4XCCL 4OUUA 1MJ7H 4GAYA 4MQXD 1WCQA 2X4QB 4PGDA 4YDIH 2Z93B 4UNTA 3C8KA 2YKLH 4YWGL 5FCUH 3MLTA 3QUKA 1RZJL 1NAKH 1ZWIA 2DJ4A 1TJGL 2Y5TA 3WN5C 2ITCA 5KVDH 2WBWB 2YC1B 4G6FD 2WINB 4FP8H 4X6FA 5IW6A 1WSST 4NN6B 4NHCH 3ARFB 3PV7A 3GMPB 3BQUB 4QRRE 1BIIB 4YBLC 4I3SL 2HTKC 5GRZA 1OL0A 1QOKA 3GJFA 4WV1B 2Y4SA 2OMBA 2B7DT 5BV7L 4O58L 1SJEA 2HLAA 2P24A 1PDKA 4TTDC 1F90H 4OV5B 1O0VA 5I74C 4LHUA 1KB5B 5IJKC 1H5BA 1C5DB 4TVPD 3THML 2A6DB 2OS7A 4NHUB 3SO5A 1G9NL 4XCYA 2DQHH 5E2VL 3VRIA 1VPOL 1QFWL 4QRTA 2VQ1A 2VIRB 4YHOL 2ZUTA 4MA1C 3RIAK 3T1FB 1U3JA 1HHKA 4K23L 1T7WA 5TFSL 2DJUA 2GJZA 1IKNC 1NSNL 3DXAB 4XNXH 4OZIA 3RDTD 3D85D 2FZ3B 5IB2A 3W5MA 2EZ0D 3G5VB 5ITFA 3EKCA 2LQRA 4ZPVB 2P44B 3W2DH 1B6DA 1ZT7B 1A4JB 4HFUH 3IS0X 3KLAB 1DQLL 3WIFB 5A2FA 2EIBA 3EOTH 5I1HL 4MZ2A 2X5PA 4ZFZA 4OD3H 1NKOA 1PG7X 1S7WB 4C57C 1ZGLB 3MODL 5C0JA 2AJ3B 2XQBL 4UV7H 5F1IA 4I5BB 4KKLD 1X44A 1PKQE 2PYEE 3G6DH 4RGMB 5L88L 2DQGH 2C9AA 4LSUL 5IMMB 1A3RL 3PP4H 3SOBL 1JPTL 4X6DA 3ZYZA 1DUZB 4NQUA 1NAMB 3OKOB 1X4XA 1T1ZB 2UY6A 4I13B 4PGBA 5L2KA 5CJQL 4GAFB 1NGPH 5C0AE 1MRCL 5JPMA 1URLA 2NXZB 4PJEA 3QXWA 3U46B 5FFLA 4PBVC 5LXGL 4L3CA 1UADC 5FV1L 1DSFL 1X5YA 3SEPA 4CKVX 4HD9A 3IB4A 2YUXA 3D18B 4PY8I 3ZDXE 4GAJL 4KUCD 4WFEE 3QEGH 1W0WB 1XGUB 4OJFL 2FYYA 1XZ0B 4X4XA 4HSQA 1N59A 5IIEA 4ORGA 3RIFF 2IH1B 1MLCA 4Y5YB 3VGFA 3QDME 5FDYA 5DA0B 4JHZA 3WIIL 2DD8L 1ETZA 3LMJL 4GH7B 3O4OC 4NNPL 4D94A 1TQCC 3BGMB 4TOYH 1IKFH 2JB5L 1VFOA 1X5IA 1GGBH 2L7JA 3EBAA 1E4XH 1PLGH 2VR5A 5DRXA 1H0DA 4WU7A 5IW1A 4G8EB 3V8CA 4KK5C 5C2BL 2R8SL 1I9JH 1TJIL 2FEDC 4U6TA 1X5FA 4X6EB 4XZUA 1HI6B 1TENA 2BOCA 4P5MA 1UXSB 5MEND 4XP9H 1J8HE 1ZVHA 2CLRA 1U8JA 2EXYD 2PW2B 1T5WB 3SDDC 1JNNL 4NO2B 3RWJA 5F89B 3TBTB 3IYLW 4ACPA 2VZTA 4J3WA 5I18H 4AG4H 4Z7VF 5CWSB 5DJYA 1NCTA 4G6FB 5CBAB 3IDYB 3WLBB 4KFZC 3KPTA 4NBYB 3GUTA 3HE6A 2RB8A 2D7NA 2IQAA 4LCWE 5IK3B 3O4LD 2GAZB 5KG9B 3IDGB 1X5GA 3TLRA 4LMQE 1MJJA 4FQIL 3QUXD 5FYKH 3PL6A 1UCBL 2DTMH 4OF7A 2AJZA 4HK0A 4PJAE 3D2UD 4PV9A 5J1AB 2JCCB 4NZUH 5BMFH 2XKUA 4RDQF 1QR4A 1OTUD 4LQFL 5EU7C 5DUPL 1YY9D 1A2YA 1MRFH 1NCUA 2OM5A 4QXTA 4N5EC 4ZUVB 4YHYC 1GZQB 5TE6L 4LPVA 3JV5A 4LRIC 3EYFB 3RDTB 2B1HH 1U8MB 3RWFB 3D85B 3T3MF 3VWKD 4N9OB 4RIRB 4NQXA 2FD6H 4HT1H 2OYPA 2X4UA 3FN9A 4D3CL 1OCWL 1RMFH 5CGMA 5DHVH 5J6GA 4AL8L 1MLBB 3S37X 2E7HA 1MIML 5GZOC 3WJLC 1NJ9A 3MUY1 3T2OA 1RZIA 1KIQA 1F13A 4UDUA 1Q1JH 2AJSL 5E8DH 4JFYA 4G43A 4HBQA 3SHSA 3AMKA 2FIRT 3MRHB 43CAB 2ATKB 2IAMD 4J8RB 1PG7W 4PRHA 2EH8H 2XNAA 4S1DC 3BP5A 3QXVA 2BFVL 2Y06L 2H26A 1BQUA 2C1OA 1MCLA 4ELMA 1WWWX 1T20A 3Q6FA 4OGZA 1D5MB 5J1SC 5CINL 3AVEA 2UY7A 3WLWC 2CDGA 1FL6B 4HIXH 4RCAA 1SBSL 3PHOA 4LU5L 3JV0A 1QO3B 1EXUA 4PRPA 5I2IB 3TVMC 4MCZA 2HJKA 1QPXA 1TNNA 5I8KL 4DUXA 4H1LA 1FGNH 1YMHB 1OAZL 4Q9QL 2VKXA 4JFXA 5E5MB 2NMSA 1YEHH 4GQ9H 4S1SL 1U8LB 5K93A 2SEBA 1D9KD 1NUFA 4ZNEA 2BSTA 4IIQB 4PJ8D 5K9JH 5CEZE 4KKAC 2M26A 4KAQH 4RAUA 4MNHA 4IDJL 3S35H 3IJHB 3I02B 3QO0B 4NNXA 4NRXA 1P84K 5HGHA 4N9GB 3HMXH 2BOBB 3PV6B 3KPSD 3QPQD 3LN5A 1DLFL 4Y5XC 3NTCL 4X7TA 5E08L 1GGUA 4D9RE 3ORJA 4XCFL 3ARBA 4XXCC 3F7RA 1KIRA 1F8TL 4CU8A 4IM8A 1S5HA 3QNZA 4QRQB 3O2WH 3I6LE 2DF3A 3UJJL 1DL7H 1KNOB 1QLFA 4DK6A 1T6WA 1MFAL 5CEYA 3O11A 3BN9D 4QHUB 5MENB 5DUBA 1J8KA 5DMGC 2I9TA 2BHYA 1I7TB 4NWUL 3RZWA 5LQBH 4PRID 3VE0B 4R26L 4LCCB 2VZOA 1ZOXA 2BY1A 4LKCA 3V4PH 3E0GA 4ZXBD 2W9DH 1OB1A 3VDAA 2B2XL 1B0RA 4LCUA 3RBGA 3GO1L 3NIFF 3QG6B 1T4KA 2VDLH 1QA9A 4KROD 3HZVB 2VZ3A 5D1XA 5FGSA 1RK1A 1FFPA 3O4LB 2JE8A 3PWNA 4OM0L 3M8OH 4U6YA 1S9VA 3F7VA 2GI7A 2ZSVB 3OR6B 1NKRA 3ET9F 1MFEL 3QUXB 3AMLA 1OTSD 2HKHL 5DWUH 4PRNB 4MJID 3D2UB 2OJZH 3F5WB 3VRLF 4RWYH 2W59A 4MXWH 2DWEB 4NJ9H 5JOPE 5D71L 1J0IA 3WFEH 1LEIB 3FFCB 4G42B 4G9DA 4EUPA 3LKSB 1MJUH 3MLZH 1P1ZA 4U3CA 3REVA 2UWEA 4QT5B 4CJ1A 3QJFB 5BS0B 5MEPA 4X4ME 3MRMA 5JZ7C 2ED9A 5IROC 1CU4H 1YY8B 4M62H 5IESL 3HC3H 4OGXH 4R90H 2VDPL 3KGRA 1RIHL 4FQQA 1JZ2A 3X11B 4P5TA 3K81A 5DJ0A 2AKRA 3WMSA 5EBLA 3QIWC 1CXKA 4TPRL 2VLRA 4YDJB 4P2OD 1OP5H 4E41E 1P5UA 2VLJD 3FN0L 3W0WB 2VLKE 5IB4A 1K3IA 2Q3AA 3TJHC 4IRJA 4PJDA 3HZKB 4G80B 4MD0A 2R23B 2BP3A 2AEIT 2C7UA 3PGCA 5GGQL 3MUHL 5LJYH 4C58B 4LSQL 4OF6A 4OCWL 1N0XL 2R1YA 2PW1B 4LVHB 2IAMB 1JPFB 3SO3B 4Z7QE 5I0ZA 2I9LB 5GJTH 1BWMA 4YBHA 3V4UH 2CJUH 3VMNA 1BLNB 2D0FA 3IKCA 4YE4H 1ZEAL 2FECI 2DWDB 3GSRB 1DDHB 1CD9B 1X5HA 3RVVC 3VXRB 4LEOA 1A7OL 3HA0A 1G6RH 3WV0A 5E6IC 3MRCA 4GAGH 5L8KB 2X1OA 4ALAL 4Y2DC 3ULUL 4PFEA 1HXYB 4H88L 1UB6B 2AV1B 3U83A 1D9KB 3VH8G 1RZ8A 5C0BE 3TA3C 3V2AR 1E6OH 4PJ8B 3FB5B 1IT9L 1I7RA 4E5XA 4W4OC 1MCSA 4ZAKA 1YNLH 4JY5L 3DUHA 3CX2A 4HUUA 4RAVA 1WFUA 3STZB 1RZFL 1YEFH 3EDKA 4HJJH 4J4PD 3KPSB 2AXGB 1BBJA 5MEQA 2FHBA 1FO0L 4FOMA 4Y4KD 2X4PB 4L5FH 1NFDA 3WO4B 5D7IF 4YEEA 3RGHA 4F7MA 1CFTB 4ZO6A 8FABB 3QUYD 1AE6L 2VDMH 1A7PL 1UCTA 5LWYL 5BOZG 4XPHH 4UNUA 3OG4B 1T7ZA 2AP2A 5DJXB 1QKZL 4PRIB 3B3IB 4HK3N 4LP5A 4XH2B 5D72L 1FZKB 3FRPG 1ES0B 4HULB 4Y4FA 1CT8B 5C0IB 3H9HA 1IM9A 2XICA 4NKQB 2MMXA 5JW5A 1W72L 5F21B 2BHUA 2HAZA 3FB7A 1GPOL 3FFCE 4YNYB 3WD5L 5JLZB 4HUVB 1B3JA 4WU5B 4B41A 5JPNA 4HG4J 4JHAH 3MRKA 5IHZB 3OXSB 4JQVA 3H0TB 3CH8A 4KROB 4NYLB 1R0AH 3W5NA 2C4XA 5BS0E 5TDOA 1HHJA 3I2CH 2K9UA 4NQVB 1AIFB 2JJWA 3QFJD 2NQCA 1WBXA 3B9KD 3PWUA 3T4AB 3GRWA 4NGHL 4FTVE 4PD4J 4PJ7B 1ZHBA 3H42L 5DMKA 3V0AC 4OI9A 5E8NB 3H7BB 3IT8D 3SE9H 4OZGF 4M48L 1CZ8L 1T1YB 1S7VB 3WL9A 4U1LA 3WUZA 4H0IA 1INDH 4WI6A 2P5ED 3W0WE 4U1NA 2WP3T 2CIIA 3HZMB 5L9DL 4PRDB 2PTVA 2GITB 2XZQL 4TUJA 5D2NB 1PY4A 2W07A 1GSMA 4PJHF 2C3GA 2FDBP 4PREA 3OSKA 1T3FB 1IC4L 4K7FA 2R1XB 2J6EH 4L4VA 4G9FE 3SE8H 4Z7NF 4DN4L 5IBUB 1EERB 4NC2B 5B3JF 2HMID 4O9HH 5BVPH 2ICWB 4TUOA 5KW9L 1JFQL 2E6PA 5DVKA 2G75B 4JO2L 5D7SH 1L4IA 1JMZA 4P2OB 3SE4A 5C1MB 4M7KL 2YPLA 5ID1A 1W72A 1SYVA 1ZVSB 2YK1H 1LEKB 1UWGL 1N7ML 4I3GA 4X8JB 4WW1A 5C2UB 3MV7B 4OFPA 1T1WA 5TPWL 5IVZA 1HQRA 1QBLL 5F1SA 4KVCH 2NY7L 3VXRE 3MRBA 1P7QA 1N2RB 5D1QD 1KEGL 4S2SA 3FT4B 4XVTH 4YK4C 5KOVC 1IC5H 2D4DA 4QRUA 3KPPB 1FV1B 1A7RL 4Y19A 3LS5L 2EDYA 3KYKL 2AXFB 2HJFA 3D48R 1JI1A 5IEKA 4JFDD 2HTLD 5EO1B 3DV6A 2FLRT 4ZUWB 3C2SA 3BSZL 2EE3A 2W91A 5FYJU 4K2UH 4PJIA 1T80A 4XNYL 4NN7C 1HEZB 2ZG2A 3ESUF 1MCKA 4WFFD 1N64L 1JCKA 1JWMB 2NTFB 4P9ML 1I8IB 3BRGC 4FHBD 5T5FL 4RFEB 3EO0B 1ZLWH 3O3EB 3U36B 4LGSB 4G8FB 3NFNA 2FJFA 1Q72H 3GSNH 3N1QC 1KN2H 3MPCA 2V9QA 5CLTA 3ARVA 5IT2L 2GT9A 2BY2A 2IAND 2HT4C 5TE7H 2APFA 1QNZL 2NLJB 5AG8A 2ZUQC 1ED3A 1S7UB 4XB8A 3TO4B 4QRSB 2QQKH 5IQ9B 1NGXB 4CMMA 3CLEL 1UVQB 3P11L 4LAJH 3RVXD 1T2QL 4O2FA 2V9RA 4XT1C 3NFPA 2FBJL 4KMLB 2YD6A 1JHKH 4D9LL 5DD1L 1GVIA 3HE6C 3D0LB 5FOBA 2E7CA 1RZ7L 3HC0A 4N0CC 3VFMA 3JV4B 4Y8DC 1N6UA 1FE8L 4M7LH 5I1IL 3ALXA 5HYEA 4B53A 4X6DF 4XP5H 4U7KA 4E0RB 1AD0B 4Y1AD 4PJ7E 4YXKH 1S7QB 5JNYB 3NN8A 3QXDB 3G6AA 2Y36H 4PR5B 3TZVA 1YC8A 3VI3F 1CL7H 3EGSB 2EDQA 5TE4L 2YPVH 1NMCC 3LD8B 5C3TA 2A2QT 3MBXH 1P7KB 1HOCA 3DUUB 2JJSA 4M5YL 5D2NE 2J5LC 4GBXD 1ADQL 2DI9A 3DX7B 2LTQB 4FQ2L 5J3HC 3RWIA 4F80A 4WI7A 4K8RC 2G5BB 3BPCA 4FQJH 5GGSA 5C0NC 3INUH 1CIDA 4XC1H 1OGAE 2ADIB 1S7RB 3SKJH 3CMOL 3QFJB 3VDBA 1FJ1A 4XNQA 3B9KB 5I16B 2PR4H 3VW3H 4Y88A 1CDIA 3GMMA 5DQ9B 2ADJA 2ZP0T 5EO0A 1ACYL 3UC0H 1TZIA 1AGEB 4ODUB 5D2LF 1C5CH 3I50H 4OLZL 7FABH 1XR8B 3DX8A 1A21A 3MV7E 12E8L 4HAFA 4FXGA 1YPZA 1CGWA 5F7UA 5K59F 1U6AH 2BSSB 4KZEH 4P99A 5F7EL 4CRPA 1SEBB 1KT2A 3WDJA 1FNFA 3EYQC 4DUVA 4P57A 2VZSA 1NMBL 5EC2B 2YRZA 1AGBB 5IP4A 3KPMA 4L8DB 4Z76B 3OKMA 4M7JL 4HJGA 1LO2L 4PJFA 1K9TA 5GS2H 5FO9B 2PN5A 3U4AA 1AGCA 4OLWH 3ZKNC 3AM8A 4NJAL 3BH9B 4IJ3C 3DURB 5JORA 4MVBC 2BVPB 5D1QB 1Y6MR 2D7TL 4MDJA 4NPYB 4QO1A 3WCYA 1QFWI 2W0FB 4YFEA 1JPGB 4TSCL 5IGXH 3SDYL 4JFDB 2AVGA 4KPHH 4ZQKA 4I48B 2WZPD 3NH7L 4MNQE 5KJRH 1A1OB 4JREC 4Z5RA 4ONGH 4G6JL 4U49A 2C3VB 4QCIB 1M7XA 1U58B 2Q7NA 1Q38A 5DYOB 1AO7E 1CF8L 3ARBC 2OL3B 4MWFA 3QULB 3HZYB 4K3GA 4OFYA 3BDBA 3H9SD 4JEGB 4XMLH 4M03A 4N0YH 3MRQA 4FQXA 2VZVA 4DN3H 1NGZA 3AU1A 1AR1D 1BBDH 3HRZB 4Q2ZB 1JWUB 2C5DC 2RGSA 2E27H 2X4RB 2IANB 3OJ2C 3O3DA 1JK8A 5DHYA 5FUOL 1DLHA 4LARH 4LOUC 2P8MA 2F54D 4IMLA 2CRIA 3BJ91 1NBYB 3D0VA 5EA0H 2DL2A 4CAGA 1MCQA 3WJJA 3GGWB 4R4FL 2E9JA 3HI6H 3P4MA 3CK0L 4UDTA 1CI5A 5DEGB 1QYGH 4OIIL 4QRRA 5D1XC 5HGDB 3BJLA 3STLA 3UZVB 2AJUL 5LAXA 4CNIB 2QQNL 3RU8L 3U30B 1CN4A 3JUZA 2YN5A 4KTDH 5E24E 3G04B 2AW2A 3IFPA 4GRMA 2OQJB 3OKEB 2OTUB 3C09B 3MNVA 5DZOA 5ESAA 1GAFL 1VACA 2I07A 4FFVD 1DQML 1F3DH 5DRNA 3BPOB 3T77B 3UJIH 3ZYOA 3T0WA 2ZOKB 5KSVB 1M71B 3NACL 2HRPL 5HDQL 3UTZB 1P4IL 4K8RH 1NGYA 2ID5A 5CBEA 2V2TB 3OPZL 1AXTH 1A4KB 4GXVL 4E42A 5T3XH 2MCPH 4GBXB 4PJCF 1DBBH 1FAIH 1HE7A 3VH8B 1YNKH 4ZFGL 5I66A 4P5TC 2FX8H 4OGYL 2AERT 5E99L 4UTBH 2GUOB 4MX7A 5EFIA 5AD0B 1XGPA 2A77H 1CFQA 2OBGA 3PHQB 1G7IB 1JRHL 3QCUH 2OTWB 4X6CB 3QHZL 3R1GH 5EUKB 3WE6A 1IFHH 4IRJC 3TCXA 1XIWD 4PYHA 5IFHH 2WV3A 3VG0H 1FSKB 4Z0XA 2Z35A 4LSRL 2Q6WB 2R0WH 5AYUH 1KYOJ 3KPLA 5E00B 4UUJA 3JTSB 4CMHB 2J4WL 4IRSA 5JHDD 1PKQA 2PYEA 4OZ4A 3MRJA 3CXDH 5CHNB 4DZ8A 5F9JA 3T3PE 4BUGA 3G08B 5FKAB 1BJ1H 1CFSA 2DI8A 4X4YB 4R97C 1F11A 2QBWA 5JXAL 4K7PX 4WJ5A 3A6OA 5J9PB 3LQAC 3MXVH 2PXYA 4MA7H 2NY3C 5C9KA 4JY4B 2A9ML 2IBZX 3UPRB 4WDIA 5L6YL 5C0AA 4GRLA 1MCJA 1Q0XL 2Z31D 5B8CB 5E1HB 3S96B 3TV3L 4LVEA 3RUGB 5C70A 3KPOA 3OZ9L 4XGZA 1FZJB 4F8QA 1PX4A 1KB5L 4J1UA 5JDSB 4ODHH 5EG6C 3U7WL 3LKOB 3QNYB 1XGTA 3SKUD 3A6BL 5E9DE 3H3PL 2RFXA 2X1PA 4KDTA 4ZAKC 1BD2D 2IANE 3MACH 3GM8A 2Z91A 4WGVB 5I1EL 3I3EA 3QDMA 5KVFL 1VGKB 1BZ7A 3ARGB 3N1FC 1UFUA 3D25B 3CUPB 5CP3A 1QP1A 1MCWW 1J11A 1BF8A 4G3YL 4JY6B 4M8QB 2IQ9L 3OQ3B 4DTGH 3H9SB 3G5XB 4JB9L 5DO2D 1A1NB 3TNMA 1ZHLB 3QEQE 4YHML 5MHSD 3QRGH 4AEEA 3BKCL 3PHSA 1G7LA 2AABH 3ARFA 2H2PC 5KVEH 3V8OA 3DROB 4FQLL 1BIIA 1EVTC 2EH7L 1KJMA 3CFJB 3P0VL 1JZ6A 1J8HA 3HRPA 1UQSB 1HSBB 2G9HA 2AXJA 4PG9A 1BAFH 2Q1EA 3OF6A 1R3JA 2P7TB 1KSRA 2CRYA 5F9WB 1RUKH 3FQRB 4PJDF 1NUNB 1NAML 3EJZD 1F45A 1KB5A 3OTTA 1S78C 1G7HB 4OD2B 2P8PB 4AY0A 4JQVC 2HA1A 2HP4A 2A6DA 3LKQB 4NHUA 5INDA 2RAMA 3VCLA 5IM7B 1U3HB 4L3AA 5F6IC 2ENSA 5D6CA 4IEFB 1G9ML 3SBWA 4U1IB 5I8CA 3NMEA 4LCWA 4ZFOA 4MXVE 1WZMA 4MNGB 4QYOB 5D1ZD 4EUPH 4D9QE 1KPRB 2FZ3A 1AI1H 4MS8D 4M7ZB 4WFGD 4PJAA 5F7DA 4LF3B 3DHJA 4QLRA 3ZT6A 4UOJA 2HKFH 1U8OA 3ZE0F 3C8HA 2XFXB 5HDOA 4DQOL 3HG1E 4QTIL 4DAGH 1N26A 1PEWA 1U9KA 2OSLA 4KKBC 1A7BA 3IXAB 9CGTA 1SQ2N 3GMQA 3UTSD 3AROA 4I5BA 2VXTL 4JPWH 2HN7A 4Q6IA 4XNZC 1DEDA 3F62A 5ELIA 5I9QB 1AGFB 4EDWL 3SE4C 4K94C 5D5MF 5IMMA 3MTRA 4RAHA 1Q9LB 5DJ8B 3QUZA 2NZ9C 1HN1A 2HTKD 3DGGA 2F74A 1JPSL 1W0VA 1XIWB 3OR7B 5CEZL 3WNPA 3MCKB 1BWWA 2VN4A 4JJ5A 5I75C 2W65B 1MI5D 3QDAA 1K5NB 3QYCA 1BPVA 3L6FB 1IZKA 5IW3A 4NC1C 4MGXA 4TTDD 4NQDB 4LPYA 4U1GB 3RUGE 4U1MB 4LDLB 3L3IA 5FYKD 3BPNB 1ZHKB 3HFMH 3NIDE 4XVJL 5KBNC 5CSBA 3LQAH 4XCEA 1B90A 1T0PB 1WFNA 5DK2A 3WXWL 3B5GA 4L29A 5L8JB 1E6JL 1W0WA 5E95B 2O5ZH 3PGDB 4IOFD 3M45A 2C1PA 1I8MA 2ZKHL 3VFRA 3KDMA 1HHIB 5FA3B 2XKNB 2ZOLB 4QNPE 3X17A 3NPSC 3FFDA 2ZUUA 3GJEA 4U6HB 4HBCH 2Z31B 1YYMH 3GSXA 5HTSA 5C0DA 2XRAH 2IPKB 5FYLE 4PUBL 2B1AL 3LKRA 4FQPA 1OT2A 4KI5C 4KHTL 2DKUA 2Z4QB 4Z95L 2WNGA 3CVHB 1BD2B 4X6EA 1MUJB 4ZS7L 4OSUL 2YD5A 3CMGA 3C5JB 1LE5B 3RL1B 3BOVA 4ONHA 3LIZH 3HR5A 4R4BB 2X70B 4I77L 3BD3A 4HS3B 3MRPA 4NO2A 5F89A 3TBTA 1R24B 2OXHA 5ILTL 2GJ6A 4GKZA 5HSFA 3E2HC 5BJTA 1I3RB 1A7QH 1MH5B 1RIVL 4DEPC 1Q9KA 3WLBA 2XN9D 4X80L 3TC9A 1KENH 4NQCA 1T21B 1A0QH 1EEZB 5IBTL 1AXIB 1XR9B 2BVQB 1MEXH 5IK3A 3KPQB 4MNGE 1KBGH 5EU6D 5KG9A 4NZJA 4AEHL 1FDLH 2UYLA 1LNUB 2DKMA 2DKSA 4LPXA 4NKMB 3UXFA 1PG7L 3U7YH 5A2JH 5I15H 3TZVC 5BRZD 3S35X 3H9YA 4Y4HA 3SKMB 1RFDH 2JJSC 1JZ5A 4OCSH 3D5OF 3GRWH 3GFUA 1SYSB 5L7XH 2PCPA 1YN6B 4OD1L 2HRLA 5C3LD 1JGDB 4ZUVA 2QSCL 4F58H 1S9XA 2IFFL 4AT6A 3KLDA 5D1ZB 1HXMB 4W68A 4MAUL 4M6NH 4M61B 3RWFA 3ULVF 4OZHE 3VXPB 5FUZH 1EFXA 3VFPB 4DKEH 4KK5D 3D69B 1AHWB 4D0CB 1MCPL 1BVLB 2FEDD 3TBYB 1J5OH 2E7LA 5I1DA 2OJEB 5FKPA 1RIUL 1JUFA 4R7DB 1ZHNB 2FX7H 5D70H 3GZKA 1MRDH 5F7YC 1TVHB 3WNKA 4ODVL 3SDDD 3UTSB 4R4NC 4K94H 1LEGB 1FIGL 5FYJH 2Y1VA 3CC5B 1DN0B 3DTXB 4NQDE 5T3ZH 3WN5B 4J8RA 4Y5VA 3AY4A 2K3TA 4P4KC 3TGXA 1QSVA 1BQLL 4KI5F 4YBLB 3UJTL 3G9AB 4E41A 3S5LG 5D7JA 1R3LA 4HXAH 2VLKA 4UMGA 3AM8C 1TZGL 1FH5H 2YA0A 1R5VB 4JFPB 1MI5B 3ULVH 1K4DA 2VISB 3LVEA 5K33A 3KVQA 5HHQB 1ZMYA 1TIUA 3ARYA 4LSSL 5I17B 1NBVL 3MRIB 1KCUL 4HHAB 1P5VA 4LLQB 3B2UD 4U1KB 3E6FB 4WY7H 5I74B 3AFLA 4R2GC 4LRNL 3L3OB 3NGBC 2EIEA 3MNZA 2E9BA 1AH1A 4TNWF 4OCXL 1ZA3A 4M6OL 4N5ED 5EN2B 4ZOEA 4MA1B 4IIQA 5ANME 1EEYA 3IAQA 1OGTB 3V0WH 1F4HA 4JG1L 1XF2A 2R0ZH 3SPVB 3GIVB 4HAGA 5J8OA 3QO0A 1N6QL 2BOBA 1CXIA 5GSRB 4JM4H 2C3WA 4M4PA 4X5XB 4FQXC 5EWIH 2CQVA 4XX1E 1WIPA 2WBKA 1MCHA 5GZOD 5JOEA 2GW5A 1S7XA 4JHWL 5IMLA 3F58H 2F5BL 4RISH 5DHVB 5I8EA 3KJ4C 4P2RD 5C0BA 3BZDA 3QUMH 4BZ2H 4R8WH 1QSFD 3QWOB 1OHQA 5IHUL 4KJPC 2Y7QB 3VD4A 5IR1B 3P77A 3DHMA 4V2CB 3UYPA 1G7JB 4GKSB 4D0DA 2HVJB 3WJJC 1Z5LA 3VE0A 3NVQA 4OFVA 1E4JA 1WTGT 5KSBF 4OT1H 2APXA 1YPZF 3WLWD 4LHUG 3LN4B 4JRXD 1IAIL 3UCRA 5ADOL 1TTGA 1OF2B 5AWNL 4G6MH 2CLZA 4GW1B 5I1JH 3TVMD 5H94B 3MOBL 3QG6A 2X1WL 2R1WA 2WSKA 15C8H 1BMGA 4HC1H 4MB5A 5DJZB 1AR2A 4LVOC 4M9OA 1UKTA 1L9MA 1MFCL 2VLMD 2CIKB 5AAWA 2X89A 3CLFH 3W39B 1YEIH 4YFDB 4WO4A 2ZSVA 4I4WB 4ZPTA 4PJFF 3D3VB 2WBJA 4ZO9A 1CLZH 1XGRB 1CD1B 1S9WB 4HX1B 3GSUA 3GI8H 1EPFA 4KKAD 1T89A 1AP2B 3UTQB 1LEIA 1H3WM 3FFCA 4G42A 1F6FB 1YEKH 3QHTC 1FYTE 1T04A 3O4OB 5C8JB 3LKSA 4GG6F 1TQCB 5C0FA 4OTXH 4TSBL 5D9SA 1A5FL 5BS0A 1V7NL 3EAKA 5ICYA 3MJ9A 1UACL 4B0MM 3EFDH 4FTVA 3ARDA 1ZE3C 1F4YL 3MGOB 4KRLB 2P5WD 3MSPA 4YDJA 2BY0A 4JM2A 3W0WA 1YQVL 5FXCH 2IBGA 5DJAB 5TDNA 3QPXH 5HGBA 1H3PL 4KV5F 5DMGD 1T66D 4IRSC 1ULVA 3CZJA 5C6PB 5BZWA 2VXUL 5B21A 4BSVB 3SDDB 2GYSA 2V2XB 1J1OH 3SGEH 4F37F 2E6QA 2PW1A 3S98A 2F8XC 4G9FA 4O5LH 3QEHB 3ELAT 1X5KA 1DBMH 4Z18A 4M1DH 4POUB 1H8NA 4W81A 3FAWA 4HIIB 1DQQA 5GHWH 5HDLA 2PXYC 1HH9B 4UT6L 4N0RA 1CLYL 1ORSA 2APWA 2DQUL 2EDOA 4GRLC 1MCNA 3SKOA 4YDVB 5IMOB 3P0GB 1DDHA 1E4KA 1FL3A 1RZKL 4FFWC 4ZYKB 1MVUA 2BNQB 5JQ6H 3VXRA 4LASH 1JHTB 1INEH 2DQIH 3KLHC 1X5ZA 3SGEI 4M43L 3MUJA 4JANB 1MF2H 1VCAA 2XWBB 1CK0L 4Z7VE 4QHLB 2N1KA 2ZCLH 1KB9K 2FATH 3F6LA 4KDTC 1MVFA 4DWHA 2VABA 4YX2H 5I76B 4QHMA 1HXYA 1X6LA 4Z77A 4OB5L 4JPIA 2MWCA 4YHYB 5C0RH 3ILPA 5A16A 3BD5A 3ZL4L 1JNHB 2WUCH 3T0EE 3JV6B 3OGCB 5JZ7D 5KVGL 2Q76B 1D5ZA 1JHLH 1JVKA 3Q3GB 2ZCKH 3WHE1 1EUUA 3MV9D 4B7IA 3VRJA 5ACZB 1MHPL 1CG9B 3EYOB 3STZA 3GSWB 3QIWD 2VXQL 3DRTA 3G5YB 4Y0GA 2UVFA 5F1NB 3BDYL 5JIKA 4AIZB 1HHHB 3QO1A 4X7SL 1T83C 3TJHD 2Z9TA 4MLIA 4PLOB 3RJQB 3MRNB 4P2RB 4XBPB 4TUKL 1QSFB 4LNRA 3C08H 1UH4A 2IWGA 1F6AA 4RA0C 5HHMB 3U0WH 3EOBA 3RX8A 3OHXA 4YUEH 2V7NA 1OP5K 2DQTH 3T3ME 4J6RL 4KQ3H 2BMKA 1CGSH 2V7HA 3D3VE 1ZLSL 1F58L 1FZKA 5LVEA 2NPLX 3K1DA 3SGJA 1OAKH 1CT8A 1D6VH 1KLFA 1B4JL 1GOHA 1ZVYA 2OR9H 4F57H 2H8PB 3KXFB 1MIEH 1KCRL 3SBWC 3TVMB 4NO0A 2VMFA 2QQLL 3O2VL 4JFZL 3RVVD 3S88L 5DF0A 5E2WH 2XQYG 2X9YA 5ITBL 4PBXA 5EOCL 1F2QA 1N4XL 3IDNA 1XGQB 4M93C 4Y2DD 5GRUH 4ZS6C 4NQVA 1G6RB 2JK5B 5SX5K 4PRAB 5ENWB 4BSWA 3MJ8B 3H7BA 4G6KL 4HUWB 4F2MB 1A6WL 4MSWA 4LP4A 3VXNB 1K4CB 1AQKH 3X13B 1NBZA 2GITA 1KG0B 3EYSH 4Q6IC 1K6QH 5JQHC 4OQTA 4Y5XB 4QTHB 4JRWA 1NL0H 3JBG7 4UT7H 3UO1H 3AC0A 1OGAA 2Z8RA 5DD3L 4HS8L 1HKLL 3QUZC 1A9EB 2XA8H 3WXVH 2X1QA 1FNEB 3DPBA 1OWWA 4XPBL 5F7HA 5JMOC 1CTNA 2XTJE 4OLEA 3MV7A 3GM0A 1FLTX 3ES6A 2CUIA 2R2BA 2NXZC 2OK0L 1RJLA 4YBQC 3MR9A 1RU9L 1L7IH 1KJVB 1IGIL 4XP6L 1T22B 2BNQE 4LHUD 5FV2A 3FT4A 4H1LG 2XY1A 3NCEB 4BFBD 2HWZH 2X4SB 4PP1C 3BN3B 3RKPA 1BQSA 5CMAA 4KMTL 3MA9H 2Q7YB 3HNVH 3T1WA 3NZ8B 3QSKB 1OP9A 3NCYS 4ZUWA 3PIQA 3OAYH 5LBSL 3O6MH 2XPGB 5HD8C 1EBPA 1JN6B 3IDIA 4TQEL 4YDLC 4O4YL 4KQ4L 3G5ZA 4NBZB 3ZTNL 1QRKA 1I8IA 4CVZA 1FG2A 4DW2L 3P4NA 1IGML 4V2BA 5IB5A 4KXZH 2AEQH 3PNWB 5IVXF 4PJ5E 4XMPH 1FFNA 1CIUA 1I1RA 3NIFE 3L3GB 1MCEA 4NKOA 3P0YH 3QIUA 5D7IB 5IKCA 3C5SA 4MNQA 4LIQH 5EB9A 1JGLL 4XMKH 5BW7C 5HHME 1FNSL 5L2JA 4YAQB 1KPVB 1KLGA 3TO4A 3LRHA 5E56A 3MV9B 1OSZA 1AO7A 4WTWA 3IVKA 5L2KD 3QIWB 2BVTA 1G7QB 3VRLE 3DMMA 3ZE2F 1DVFA 4KXZI 4NRZA 2X6MA 2ATPA 1RUMH 3TBSA 3KXFE 3D0LA 3KPRE 5KS9E 1EUTA 3JV4A 1I7ZB 5CILL 4HWBL 2FIKA 3LCYA 2M8XA 4A6YA 2ADFL 5C7XH 5C09B 3S5LB 4KZDH 3HNTL 4JR9H 4HUKB 4Y4HC 4OZGB 5KN5B 3O6FA 1T03L 1IC1A 3U4EA 2JLLA 3EOAA 2IADB 3CFKA 2YRLA 4XWGH 1MPAL 4LEXH 4FABH 1QUNA 4EUPG 1SY6L 4PJHB 3GNMH 3DUUA 4R96B 4G5ZH 4XVUD 3GHBH 5E6IB 3NABL 3BEWB 3A67H 3BVNB 3DX7A 4C83B 1HIMH 5DJCB 4Y2DB 4YDKH 4HWNA 5I19H 4DVBA 1D3CA 2E7LC 1OARH 1LDPL 5DRWB 5TDPA 1M4KA 2ERJC 2EDBA 3TA3B 3C5ZA 1A6UL 2ZUXA 2HT4D 4BM7A 1RJCA 5SWZB 4OUUB 3FRUB 1VB9A 3CFEB 1FFRA 2BVOA 4GAYB 4LMQI 4LSVL 2V17H 4JO3H 3I84A 3QUKB 2G60H 3L1OL 1NANI 3QFDB 3IKKA 5E7FA 2ITCB 4Y5VC 4X6FB 3AY4C 4ETYA 4NQSA 2OL3L 1NLBH 3HUJF 4OCYL 2XZCH 4HPOL 4UTAH 3LN9A 3H3KA 3MJ7A 3HE6D 4ODSL 1LO5A 2HFEA 5D7JC 1X4YA 4Z76A 4N0CD 4PB0H 3OAZK 2EIZA 3GBNL 2B20A 3GDBA 2NYYC 5EO9A 3PL6D 1KTLA 2HLAB 3GJFK 1X6NA 1ZSDA 2P24B 3QZWA 3BH9A 4JO1H 4LHUB 4JCMA 4NN5C 2Z8SA 2PO6A 4I1NB 4XCYB 3QT2A 3CJJA 4I0CC 2QEJA 1J9CT 2VQ1B 4QRTB 5DS8A 1HHKB 1JPGA 2GJZB 4OKDA 5D7IE 5EU5A 4LLMA 1EHLH 3LV3A 2A73A 5IB2B 3O2DL 5J3HD 1U92A 2N4IA 4KUZH 4K8RD 1FQ9C 1U8NA 5C0ND 2M1KA 2ZCHL 3RBSA 3NIGF 1P6AB 4NP4L 4BQ6A 1U58A 4WUKH 1HQ4B 1CDYA 3TIDA 2Q8BL 1VESA 3ZHDA 4ZFZB 4P2QB 4J3OC 1I3VA 4L3EE 5F1IB 1RURL 3R0MA 5E9DA 5T33H 4HJ0C 1KCVH 4LGPB 2QSTA 4OUOA 2YD4A 3FHQA 4PRHD 5GIRA 1QLEL 3EYQD 1T1XB 4X6DB 5C09E 3KR3L 4ZFFA 4URTB 1CFVH 3I85A 5HI3C 4P4RA 2W60A 3CSBA 3EUUA 3BI9X 2ZJSH 2X41A 1MCIA 1VEPA 3VFOA 4PRPD 2FHCA 3GMOA 5JPMB 3QEQA 3SDCB 2OZ4A 5GRJL 3T0BA 3IU3B 3ZKND 1YZZA 4FZ8L 4F7CA 4L3CB 4MVBD 1I85A 4JFOA 5ICZB 1NUGA 5MI0C 3NCBB 4YK4B 4WO4C 5DK0B 2DQFA 1EBAA 4Z7NE 1E27A 4FFZL 3G04A 2WBJC 4RBPK 5B3JE 2VITA 3LB6C 4X4XB 2I60L 2FYYB 3OKEA 4YHIA 5IIEB 3VXME 1WZ1L 1T89C 3LEVL 4RMSA 1N8ZA 3RX7A 5SWZE 1ETZB 1TCMA 4EQ2A 2QTEA 2ZOKA 5KSVA 2VXVH 4Q9BA 1MNUL 1JNLH 1EA9C 3UTZA 1PW3A 3PP3K 4NFCA 3WNLA 3P4LA 2V2TA 2GQHA 4NN7B 2Z8WC 1NGWA 2R29L 4FQ1L 3ARBD 5DRXB 3S8WA 4WU7B 5IW1B 1DQDL 2EDNA 3ARDC 1BQHA 1U42A 2UV3A 4LHJB 2MNUA 2VO5A 3AREC 2GUOA 2R0KL 4JM2C 4P5MB 2BOCB 4DKFH 4HWUA 3PHQA 3R8QA 1G7IA 3FTGA 2OTWA 2AJXL 3L3KA 5D7LA 5HHOE 3Q2CA 2F9BT 2CLRB 2ZUQB 4IMKC 3WNMA 1DSFH 4ZUTB 3RWJB 1BFSA 2F19H 2EEBA 3HG1A 4KJWC 3MXWH 4EQ3A 3OAUL 4GAJH 1AD9B 2LU7A 3JTSA 2R69H 5JW3L 2IFGA 3M1BB 5DJYB 4BQBA 3GUTB 1EEUA 3IFOA 3HE6B 5FKAA 1UKSA 1OAXH 3P40A 3I3BA 3UZQA 1UM4L 2IQAB 2ZPKH 5D1XD 3LS4L 2JB5H 1E4KC 4AEFA 3BO8A 3U0TA 1MJJB 5CZVL 3QDGE 5J9PA 2OR7A 2AJZB 4HK0B 3FRPA 4ENED 2DBLL 2XACC 4RGOL 3SY0A 4YHPA 3OKYA 3R8BB 4UT9L 3SGDH 5FK9B 2PNDA 5B8CA 3MJGX 1A2YB 3RUGA 4QXTB 3OX8B 4P2QE 4OV6F 1ND0B 1NMCB 2ITDA 3VGAC 2BNRE 1BOGB 2PF6A 5B22A 3J7HA 2ICEB 2J5LB 2XQYK 2Q8AL 1DUYA 4HLJA 4PTUA 2X4UB 4P5TD 4NT6A 1G0XA 3ARGA 2D7MA 2VLRD 3HLAB 2O93L 5J6GB 1CFBA 3U2SA 4ODBD 3O0RL 3D39E 4IRJD 3ZHKA 1RZIB 3MCLH 1IM3A 3U9UA 4UDUB 3VI3E 4P59L 3QI9C 4HMDA 4OM1H 3WO4C 4MD5A 3WO3B 1ZHLA 1IBGL 3PWPE 2YZ1A 2APTA 1TETH 1NCWL 2EDRA 1J0KA 4N0FB 4PRHB 4LQFH 4ISVA 1CBVL 3RY6A 3CDGA 2H26B 4KJQC 2C1OB 4MDIA 4U1SA 1MJ7L 5HBBA 1T20B 1D5BA 1EHAA 2H41A 3BMVA 4P46A 2A6KA 3GSVB 4YDIL 2YKLL 3PHOB 1Z9MA 4NUGH 4YH6A 5ESQA 5FCUL 5TE6H 5D2LE 3V7AE 4PRPB 4MCZB 2HJKB 5AUMA 1A6TA 2NY3D 4FP8L 1G7HA 4ZTPL 4H1LB 3ZDYF 2WWKO 4IJ3B 4NHCL 4D3CH 4C56E 1OCWH 2WM0A 5K59E 1U3HA 3MOAH 4JFXB 4PJCB 5IB1A 1QHPA 5D93C 4ZUUA 4ZG1A 1I9IL 5DJ2B 1NLDL 1WC7A 4MJ2A 2AGJH 3GBMH 2SEBB 2GKIA 4MNGA 1RVFH 4QXUH 4ETQB 4ORZC 2BSTB 1LE9A 4HIEB 4U2ZA 3WYRA 5DVOA 3BP6A 1H3VA 3DLQR 1F90L 2BK8A 4RAUB 3BIKB 4ZAKD 1DTUA 3LZFH 3PDDA 4X7DC 4NNXB 4JREB 4NRXB 4WCYH 5HGHB 3QNXB 3MJ9H 3WKMH 1Y6KR 2YOCA 2DQHL 2Y06H 3LN5B 4BQ8A 4X7TB 2GCYA 4DCQA 3ARBB 5BO1L 1KIRB 4XNXL 2CUMA 3QCVH 4XAKE 4K7PL 3QNZB 4OZHA 1F00I 1AGFA 1QLFB 5DT1H 5CEYB 3O11B 3X3FH 5I8KH 2H2PD 5DUBB 5DJ8A 3MLYH 2P42B 1OAZH 1WBZB 3F7YB 2I9TB 1YECL 3CVHL 3EOTL 4OD3L 1IRAY 4S1SH 2W65A 4LKCB 5IB3A 1NDGA 4UV7L 1NMAL 2YMXH 4NZRH 1QSEE 4Y4FD 1IM9D 4F7EB 2MQCA 1OB1B 1B0RB 4ZODA 4NQDA 3G6DL 4GS7C 4IDJH 4JE4B 4U1MA 2DQGL 1T4KB 1S78D 1DEEA 5EIVA 3HC4H 1QA9B 3PP4L 4N90D 5D1XB 1RK1B 1FFPB 2J8UE 3TJEH 3PWNB 1ZA6A 3F7VB 4I3RH 2D31A 1F8TH 1NGPL 2NY5L 25C8H 5T3XE 1JGUL 1L9NA 1HHIA 2Q20A 5FA3A 3FQNA 1MHHA 2DLEA 4HKBA 4YHLL 2DS4A 4EUPB 1OP3K 3QIUC 5KTEH 1D7FA 3FQUA 2IPKA 1P1ZB 1KULA 3REVB 2UWEB 3L7FA 5MEPB 5M7QA 3T08A 3MRMB 3QEGL 1FLRH 1U95A 1G9EA 4L4VD 2Z4QA 5ANMA 4HLZH 3PWVB 1S9YB 2YA2A 4FQQB 4HUXA 4P5TB 1M7DA 1ZT4A 5DJ0B 2AKRB 3GO1H 2VLRB 5DEZA 2YPLD 3DMMC 1DVFC 2AI0H 2DQDH 5FYJD 4TOYL 1IKFL 3CZFB 5IB4B 5T3ZD 1R24A 4IRJB 4PJDB 3STBA 2C7UB 1PLGL 1GC1L 1I3RA 2DM3A 1P7QD 5AAMA 3BZ4A 4GKOA 5GQBA 1MH5A 1Z0NA 1Q0YL 2R1YB 1I9JL 2ESVE 2ED8A 1T21A 4NM4H 4PJCE 2I24N 3FJTA 4Y19D 2VN7A 1XR9A 4X9GA 1FVEA 2JELH 4XP9L 5DC9B 2FJHA 3FCTA 3KPQA 1BEYH 3IKCB 3O6FC 1LNUA 4JZNA 4R97B 5I30H 4UZGA 4X9BA 5EZOH 3MRFA 5I18L 4L8CB 4AG4L 1CXEA 4LEOB 4KK6C 2NY3B 2W9EH 1ZTXL 3MRCB 1OY3B 1SYSA 4K55A 3EYUH 4JFHD 2BNUA 4UQ2A 4EEEA 1ZAGA 2W0LA 5CIPA 4NM8H 1F5WA 4W6YB 1RZ8B 1RJZA 4LPTA 3C5ZC 4L4JA 5D5MB 3UPCA 4BKLB 5FYKL 3UTTE 5CJOH 1WBYA 1MY7A 2DTML 2WIIA 4KI5D 1I7RB 4E5XB 1TJHH 4PJ9A 1AHWA 4OQTH 4ZAKB 2EDHA 1DQJA 4NZUL 3SJVE 5BMFL 3QWQB 5F7KC 1I4FA 2OJEA 4HUUB 2C3XA 3PDGA 2O5XH 1MRFL 3SGKA 2WMPA 4HWEH 1BBJB 1T0NA 1FYTA 5MEQB 5HI4C 1XAUA 1TVHA 2L0DA 2DL9A 2HVKA 3EO1B 3U9PH 4G7YH 5HVWA 1DN0A 2P48B 4JRYE 4JQXA 4TNVF 4F7MB 1CQYA 1DQTA 2FD6L 5H35A 8CGTA 1X5JA 2A74A 3R4DA 4HIHB 1RMFL 4Q74A 1OQOA 2MKWA 3K4ZA 4H88H 3BGFC 3TT1H 1DBKH 4GW4A 1Q1JL 2PO6C 3H9HB 4XRCA 1IM9B 1WZLA 2XA3A 5E8DL 5JW5B 2X4OB 2XXCB 3TZVD 4A2MA 4P48A 5CUSH 3A6CH 4GMTH 3FB7B 4U1KA 3E6FA 3FQTA 1NCDH 5MERA 3MRKB 3ULSA 4OI8A 1CCZA 1RZFH 3BKML 5SX4H 5F6IB 5TDOB 2APBA 1HHJB 1G6VK 3CFCH 1CDHA 1WBXB 3PWUB 3HMWH 5DMKB 1OGTA 1CE6A 4K9EC 3DIFB 1CGYA 1QR1A 3SPVA 3WL9B 3S34H 4U1LB 4GRWE 3VD9A 2V5MA 4G8GE 4U1NB 1FGNL 4OKVA 3T8XB 1AE6H 2EDLA 4X5XA 2WAHA 4Z7VA 4TUJB 3MV01 5DUMH 1YEHL 1CLCA 1I1FA 4GQ9L 4PREB 4TNVK 4OF3A 4Q0XH 4K7FB 1A7NL 3B2VH 4BZ1H 5F3BB 4HKJA 4R4ND 1KLUB 1EH9A 5K9JL 3EHBC 3T0EA 3QWOA 3W9DA 1NH6A 2NY0C 2WWMC 4XNZB 2Y7QA 3FT3A 1LO4H 4KAQL 3S35L 4ERSH 3OKKA 3UPAA 2UUDK 3HMXL 2YPLB 5ID1B 4WW1B 1WCBB 2IEPA 1T1WB 1EDQA 5CZXC 5IVZB 3ZE0E 4PJGE 3LN4A 3MRBB 4U31A 1I85C 3LAFA 4PRBA 4X98A 5I75B 2NR6C 2BERA