4R6NA

Jacalin-carbohydrate interactions. distortion of the ligand as a determinant of affinity
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
133
structure length
133
Chain Sequence
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITGFTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTSGTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Jacalin-carbohydrate interactions: distortion of the ligand molecule as a determinant of affinity.
pubmed doi rcsb
molecule keywords Agglutinin alpha chain
molecule tags Sugar binding protein
total genus 31
structure length 133
sequence length 133
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 4r6nA00
1TP8A 4DDNA 1J4SA 3O44A 1C3MA 2NUOA 2GUEA 5JM1A 1WS5C 1WS4A 2BN0A 4GX7A 1J4UA 4PITA 3LKYA 1VBOA 1OUWA 4MQ0A 4AK4A 1UH1A 3P8SA 3LL0A 1ZGSA 3LL2A 4AKDA 1WS4C 3AQGA 2BMYA 3WOCA 2GUDA 1TOQA 3MIVA 3LLZA 1VBPA 2NU5A 5BN6E 2HYQA 3VZEA 4WOGA 3LLYA 5EXGA 1PXDA 3R51A 1ZGRA 4PIUA 1UH0A 3APAA 1XEZA 3VY7A 4AKCA 1KUJA 4R6OA 1KU8A 1J4TA 4PIKA 3WOBA 2GUXA 1JOTA 1C3NA 2GTYA 3R52A 1M26A 1UGXA 3VZFA 5J51A 3LM1A 1UGYA 4R6QA 3MITA 4R6PA 2BMZA 1X1VA 2GUCA 1UGWA 1XXQA 3MIUA 1JACA 4AKBA 2HYRA 4PIFA 1WS5A 4R6RA 1UGYC 3R50A 2JZ4A 5J50A 3LL1A 3VZGA 1C3KA 3VY6A 1XXRA 5J4XA 5J4TA 4R6NA 5AV7A 1UGWC
chains in the Genus database with same CATH superfamily
1TP8A 4DDNA 1J4SA 3O44A 1C3MA 2NUOA 2GUEA 5JM1A 1WS5C 4QX3A 1WS4A 2BN0A 4QX2A 4GX7A 1J4UA 4PITA 2QP2A 4ARXA 3LKYA 1VBOA 1OUWA 4MQ0A 4AK4A 1UH1A 3P8SA 3LL0A 1ZGSA 3LL2A 4AKDA 4ARYA 1WS4C 3AQGA 2BMYA 3WOCA 2GUDA 1TOQA 3MIVA 3LLZA 1VBPA 2NU5A 1DLCA 5BN6E 2HYQA 3VZEA 4WOGA 2C9KA 3LLYA 5EXGA 1PXDA 3R51A 1ZGRA 4PIUA 1UH0A 4W8JA 3APAA 1XEZA 3VY7A 4AKCA 1KUJA 4R6OA 1KU8A 1J4TA 1I5PA 3TOWA 4PIKA 3WOBA 2GUXA 4MOAA 4QX1A 1JI6A 1JOTA 1C3NA 2GTYA 3R52A 1M26A 4QX0A 1VMOA 1UGXA 3VZFA 3EB7A 5J51A 3LM1A 1UGYA 4R6QA 3MITA 4R6PA 2BMZA 1X1VA 2GUCA 1UGWA 1W99A 1XXQA 3MIUA 1JACA 4AKBA 2HYRA 4PIFA 4D8MA 1WS5A 4R6RA 1UGYC 3R50A 2JZ4A 5J50A 3LL1A 3VZGA 1CIYA 1C3KA 3VY6A 1XXRA 5J4XA 5J4TA 4R6NA 5AV7A 1UGWC
chains in the Genus database with same CATH topology
1TP8A 4DDNA 1J4SA 3O44A 1C3MA 2NUOA 2GUEA 5JM1A 1WS5C 1WS4A 2BN0A 4GX7A 1J4UA 4PITA 3LKYA 1VBOA 1OUWA 4MQ0A 4AK4A 1UH1A 3P8SA 3LL0A 1ZGSA 3LL2A 4AKDA 1WS4C 3AQGA 2BMYA 3WOCA 2GUDA 1TOQA 3MIVA 3LLZA 1VBPA 2NU5A 5BN6E 2HYQA 3VZEA 4WOGA 3LLYA 5EXGA 1PXDA 3R51A 1ZGRA 4PIUA 1UH0A 3APAA 1XEZA 3VY7A 4AKCA 1KUJA 4R6OA 1KU8A 1J4TA 4PIKA 3WOBA 2GUXA 1JOTA 1C3NA 2GTYA 3R52A 1M26A 1UGXA 3VZFA 5J51A 3LM1A 1UGYA 4R6QA 3MITA 4R6PA 2BMZA 1X1VA 2GUCA 1UGWA 1XXQA 3MIUA 1JACA 4AKBA 2HYRA 4PIFA 1WS5A 4R6RA 1UGYC 3R50A 2JZ4A 5J50A 3LL1A 3VZGA 1C3KA 3VY6A 1XXRA 5J4XA 5J4TA 4R6NA 5AV7A 1UGWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TP8 A;  4DDN A;  1J4S A;  3O44 A;  1C3M A;  2NUO A;  2GUE A;  5JM1 A;  1WS5 C;  1WS4 A;  2BN0 A;  4GX7 A;  1J4U A;  4PIT A;  3LKY A;  1VBO A;  1OUW A;  4MQ0 A;  4AK4 A;  1UH1 A;  3P8S A;  3LL0 A;  1ZGS A;  3LL2 A;  4AKD A;  1WS4 C;  3AQG A;  2BMY A;  3WOC A;  2GUD A;  1TOQ A;  3MIV A;  3LLZ A;  1VBP A;  2NU5 A;  5BN6 E;  2HYQ A;  3VZE A;  4WOG A;  3LLY A;  5EXG A;  1PXD A;  3R51 A;  1ZGR A;  4PIU A;  1UH0 A;  3APA A;  1XEZ A;  3VY7 A;  4AKC A;  1KUJ A;  4R6O A;  1KU8 A;  1J4T A;  4PIK A;  3WOB A;  2GUX A;  1JOT A;  1C3N A;  2GTY A;  3R52 A;  1M26 A;  1UGX A;  3VZF A;  5J51 A;  3LM1 A;  1UGY A;  4R6Q A;  3MIT A;  4R6P A;  2BMZ A;  1X1V A;  2GUC A;  1UGW A;  1XXQ A;  3MIU A;  1JAC A;  4AKB A;  2HYR A;  4PIF A;  1WS5 A;  4R6R A;  1UGY C;  3R50 A;  2JZ4 A;  5J50 A;  3LL1 A;  3VZG A;  1C3K A;  3VY6 A;  1XXR A;  5J4X A;  5J4T A;  4R6N A;  5AV7 A;  1UGW C; 
#chains in the Genus database with same CATH topology
 1TP8 A;  4DDN A;  1J4S A;  3O44 A;  1C3M A;  2NUO A;  2GUE A;  5JM1 A;  1WS5 C;  4QX3 A;  1WS4 A;  2BN0 A;  4QX2 A;  4GX7 A;  1J4U A;  4PIT A;  2QP2 A;  4ARX A;  3LKY A;  1VBO A;  1OUW A;  4MQ0 A;  4AK4 A;  1UH1 A;  3P8S A;  3LL0 A;  1ZGS A;  3LL2 A;  4AKD A;  4ARY A;  1WS4 C;  3AQG A;  2BMY A;  3WOC A;  2GUD A;  1TOQ A;  3MIV A;  3LLZ A;  1VBP A;  2NU5 A;  1DLC A;  5BN6 E;  2HYQ A;  3VZE A;  4WOG A;  2C9K A;  3LLY A;  5EXG A;  1PXD A;  3R51 A;  1ZGR A;  4PIU A;  1UH0 A;  4W8J A;  3APA A;  1XEZ A;  3VY7 A;  4AKC A;  1KUJ A;  4R6O A;  1KU8 A;  1J4T A;  1I5P A;  3TOW A;  4PIK A;  3WOB A;  2GUX A;  4MOA A;  4QX1 A;  1JI6 A;  1JOT A;  1C3N A;  2GTY A;  3R52 A;  1M26 A;  4QX0 A;  1VMO A;  1UGX A;  3VZF A;  3EB7 A;  5J51 A;  3LM1 A;  1UGY A;  4R6Q A;  3MIT A;  4R6P A;  2BMZ A;  1X1V A;  2GUC A;  1UGW A;  1W99 A;  1XXQ A;  3MIU A;  1JAC A;  4AKB A;  2HYR A;  4PIF A;  4D8M A;  1WS5 A;  4R6R A;  1UGY C;  3R50 A;  2JZ4 A;  5J50 A;  3LL1 A;  3VZG A;  1CIY A;  1C3K A;  3VY6 A;  1XXR A;  5J4X A;  5J4T A;  4R6N A;  5AV7 A;  1UGW C; 
#chains in the Genus database with same CATH homology
 1TP8 A;  4DDN A;  1J4S A;  3O44 A;  1C3M A;  2NUO A;  2GUE A;  5JM1 A;  1WS5 C;  1WS4 A;  2BN0 A;  4GX7 A;  1J4U A;  4PIT A;  3LKY A;  1VBO A;  1OUW A;  4MQ0 A;  4AK4 A;  1UH1 A;  3P8S A;  3LL0 A;  1ZGS A;  3LL2 A;  4AKD A;  1WS4 C;  3AQG A;  2BMY A;  3WOC A;  2GUD A;  1TOQ A;  3MIV A;  3LLZ A;  1VBP A;  2NU5 A;  5BN6 E;  2HYQ A;  3VZE A;  4WOG A;  3LLY A;  5EXG A;  1PXD A;  3R51 A;  1ZGR A;  4PIU A;  1UH0 A;  3APA A;  1XEZ A;  3VY7 A;  4AKC A;  1KUJ A;  4R6O A;  1KU8 A;  1J4T A;  4PIK A;  3WOB A;  2GUX A;  1JOT A;  1C3N A;  2GTY A;  3R52 A;  1M26 A;  1UGX A;  3VZF A;  5J51 A;  3LM1 A;  1UGY A;  4R6Q A;  3MIT A;  4R6P A;  2BMZ A;  1X1V A;  2GUC A;  1UGW A;  1XXQ A;  3MIU A;  1JAC A;  4AKB A;  2HYR A;  4PIF A;  1WS5 A;  4R6R A;  1UGY C;  3R50 A;  2JZ4 A;  5J50 A;  3LL1 A;  3VZG A;  1C3K A;  3VY6 A;  1XXR A;  5J4X A;  5J4T A;  4R6N A;  5AV7 A;  1UGW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...