4RGWB

Crystal structure of a taf1-taf7 complex in human transcription factor iid
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
144
structure length
123
Chain Sequence
ELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPKKFIWNHGITLPLKNVRKRRFRKTAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transcription
molecule keywords Transcription initiation factor TFIID subunit 1
publication title Crystal structure of a TAF1-TAF7 complex in human transcription factor IID reveals a promoter binding module.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 123
sequence length 144
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04658 TAFII55_N TAFII55 protein conserved region
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...