4RHIA

Crystal structure of semet-labeled wild-type t. brucei arginase-like protein in p321 space group
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
316
structure length
316
Chain Sequence
b'HMFSKFLMNVKGVTPRGSDWANRLGPVALFGYGAGMPRRAPLLDFFLQSPRDCDHYAELTIHDKGPIECPPETVMFMPVLNCGQMLDEAAGTETPTSDEWYLGSLEASTELLEKGYVPVSVGGDGSATLSMVEAYKRLFPSDDIVIVHFSARPSVSDPRSPLRVLLDKGLLKGVVSVGNRQVSSEDRKVRKLHKMFYMDMHAIYSKGLFCIRDIRNDYPVFISIDASVLDPAFAPAVDSPVAGGLSTRDLLHIMNGIRGPKVVGIDVYGYNPDLDVYRKDNVGLTAIALSKIIKEGILKAYSISTHTEEEGMERVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase
publication title Crystal Structure of an Arginase-like Protein from Trypanosoma brucei That Evolved without a Binuclear Manganese Cluster.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Unknown function
total genus 89
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 4rhiA00
3PZLA 4Q41A 1P8QA 4Q3TA 3SL1A 1HQGA 1P8OA 4IE1A 3GMZA 4GSZA 1R1OA 4I06A 2PHOA 4MYNA 3LP4A 3KV2A 2A0MA 1HQFA 1P8PA 1WVAA 3GN0A 4Q3PA 1HQHA 4IU4A 1T4TA 5HJAA 1P8RA 2CEVA 1TBJA 4RHIA 1HQXA 4ITYA 1RLAA 3MMRA 5HJ9A 3RLAA 3THJA 3E8ZA 1T4PA 1P8SA 3E6KA 4CEVA 4RHJA 1PQ3A 4IU5A 4Q3VA 1TBHA 4Q42A 1T5FA 1T4SA 4RHLA 4GSMA 3NIOA 1HQ5A 4RHMA 1T4RA 4FCKA 4GSVA 1WOHA 3SKKA 4IE2A 3NIQA 3M1RA 2RLAA 1XFKA 4Q3SA 2EIVA 3THEA 4MYLA 1P8MA 4IU0A 1GQ7A 1GQ6A 1P8NA 3SL0A 4RHQA 3CEVA 4GWCA 4Q40A 2ZAVA 4Q3UA 3E6VA 4IXUA 1D3VA 5RLAA 1WOGA 4RHKA 1TA1A 2EF4A 1WVBA 1TBLA 3SJTA 2EF5A 1ZPEA 4HWWA 2PHAA 4IE3A 4MXRA 1WOIA 4RLAA 4MYFA 3MFVA 3DJ8A 3MJLA 4GWDA 4IU1A 3E9BA 3NIPA 4FCIA 3LHLA 1ZPGA 4G3HA 4HXQA 4Q3QA 3MFWA 4IXVA 1T5GA 2PLLA 3F80A 3LP7A 5CEVA 4DZ4A 4Q3RC 3E8QA 3TF3A 4HZEA 3THHA 3TH7A 4Q3RA 1CEVA 4MYKA 2AEBA
chains in the Genus database with same CATH superfamily
3PZLA 4Q41A 1P8QA 2VQWG 4Q3TA 5G0YA 3SL1A 4A69A 2VQMA 5G0JA 1HQGA 5DC6A 4QA5A 1P8OA 4IE1A 5G0XA 3GMZA 3Q9CA 4GSZA 1R1OA 4I06A 1T67A 2PHOA 4MYNA 1ZZ1A 3Q9BA 5EFBD 3LP4A 3KV2A 5EEFA 5G17A 2A0MA 1HQFA 1P8PA 1WVAA 5EF8A 3GN0A 4QA7A 4Q3PA 4RN1A 3F07A 5EFHA 4ZUPA 4BZ8A 1HQHA 5DC7A 3MAXA 4IU4A 5G0GA 1T4TA 4LXZA 1P8RA 2CEVA 1TBJA 4RHIA 4ZURA 5HJAA 3RQDA 1HQXA 4ITYA 5DC8A 1RLAA 3MMRA 5HJ9A 3RLAA 3THJA 3E8ZA 1T4PA 1P8SA 3E6KA 4CEVA 4BZ9A 4QA3A 4RHJA 4BKXB 1PQ3A 4IU5A 3MZ7A 2VQJA 3MZ4A 4Q3VA 5IX0A 1TBHA 5G10A 4Q42A 1T5FA 1T4SA 4RHLA 4GSMA 3NIOA 5D1DA 5G3WA 1HQ5A 4RHMA 2VQQA 5EENA 1T4RA 2VCGA 4FCKA 4GSVA 2V5WA 2GH6A 1C3PA 5EEKA 1WOHA 3ZNSA 3SKKA 1C3RA 5EEIA 4IE2A 3SFFA 5G0IA 3NIQA 4CBYA 3M1RA 2RLAA 1XFKA 4Q3SA 5EFGA 5LI3A 2EIVA 4QA1A 5ICNB 3THEA 4MYLA 1VKGA 1P8MA 3F06A 4IU0A 4QA6A 4CQFA 5FUEA 1GQ7A 1GQ6A 5D1CA 5EFJD 1P8NA 3SL0A 4RHQA 5EFKB 5G11A 3CEVA 4GWCA 4Q40A 2ZAVA 4Q3UA 3E6VA 4IXUA 3MENA 4QA0A 4CBTA 5JI5A 1D3VA 1T64A 5G1CA 5RLAA 1WOGA 4RHKA 3EZPA 1TA1A 1ZZ0A 5G12A 4BZ7A 2EF4A 1WVBA 3Q9EA 4ZUNA 1TBLA 3SJTA 2EF5A 5THSA 1ZPEA 4HWWA 3EWFA 2PHAA 4IE3A 4MXRA 2VQOA 1ZZ3A 5G13A 1WOIA 3EW8A 4RLAA 1T69A 3F0RA 3MFVA 4MYFA 4ZUMA 3DJ8A 3C0YA 5EFNA 3MJLA 1C3SA 3C10A 5G1BA 3MZ3A 4GWDA 5THVA 4IU1A 3E9BA 5THTA 5IWGA 4BZ5A 4RN0A 5BWZA 1W22A 3NIPA 3LHLA 4FCIA 1ZPGA 2VQVA 5FCWA 4G3HA 4HXQA 5A2SA 4Q3QA 4BZ6A 3MFWA 4IXVA 3MZ6A 5THUA 1T5GA 2PLLA 3C0ZA 3F80A 3Q9FA 3SFHA 3ZNRA 5G0HA 3LP7A 4ZUQA 5CEVA 4DZ4A 4Q3RC 3E8QA 4LY1A 4QA4A 3TF3A 3EZTA 4HZEA 5EEMA 4ZUOA 3THHA 4RN2A 5EF7A 3TH7A 4Q3RA 5DC5A 1CEVA 5G1AA 4MYKA 2V5XA 4QA2A 5D1BA 2AEBA
chains in the Genus database with same CATH topology
3PZLA 4Q41A 1P8QA 4Q3TA 3SL1A 1HQGA 1P8OA 4IE1A 3GMZA 4GSZA 1R1OA 4I06A 2PHOA 4MYNA 3LP4A 3KV2A 2A0MA 1HQFA 1P8PA 1WVAA 3GN0A 4Q3PA 1HQHA 4IU4A 1T4TA 5HJAA 1P8RA 2CEVA 1TBJA 4RHIA 1HQXA 4ITYA 1RLAA 3MMRA 5HJ9A 3RLAA 3THJA 3E8ZA 1T4PA 1P8SA 3E6KA 4CEVA 4RHJA 1PQ3A 4IU5A 4Q3VA 1TBHA 4Q42A 1T5FA 1T4SA 4RHLA 4GSMA 3NIOA 1HQ5A 4RHMA 1T4RA 4FCKA 4GSVA 1WOHA 3SKKA 4IE2A 3NIQA 3M1RA 2RLAA 1XFKA 4Q3SA 2EIVA 3THEA 4MYLA 1P8MA 4IU0A 1GQ7A 1GQ6A 1P8NA 3SL0A 4RHQA 3CEVA 4GWCA 4Q40A 2ZAVA 4Q3UA 3E6VA 4IXUA 1D3VA 5RLAA 1WOGA 4RHKA 1TA1A 2EF4A 1WVBA 1TBLA 3SJTA 2EF5A 1ZPEA 4HWWA 2PHAA 4IE3A 4MXRA 1WOIA 4RLAA 4MYFA 3MFVA 3DJ8A 3MJLA 4GWDA 4IU1A 3E9BA 3NIPA 4FCIA 3LHLA 1ZPGA 4G3HA 4HXQA 4Q3QA 3MFWA 4IXVA 1T5GA 2PLLA 3F80A 3LP7A 5CEVA 4DZ4A 4Q3RC 3E8QA 3TF3A 4HZEA 3THHA 3TH7A 4Q3RA 1CEVA 4MYKA 2AEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZL A;  4Q41 A;  1P8Q A;  4Q3T A;  3SL1 A;  1HQG A;  1P8O A;  4IE1 A;  3GMZ A;  4GSZ A;  1R1O A;  4I06 A;  2PHO A;  4MYN A;  3LP4 A;  3KV2 A;  2A0M A;  1HQF A;  1P8P A;  1WVA A;  3GN0 A;  4Q3P A;  1HQH A;  4IU4 A;  1T4T A;  5HJA A;  1P8R A;  2CEV A;  1TBJ A;  4RHI A;  1HQX A;  4ITY A;  1RLA A;  3MMR A;  5HJ9 A;  3RLA A;  3THJ A;  3E8Z A;  1T4P A;  1P8S A;  3E6K A;  4CEV A;  4RHJ A;  1PQ3 A;  4IU5 A;  4Q3V A;  1TBH A;  4Q42 A;  1T5F A;  1T4S A;  4RHL A;  4GSM A;  3NIO A;  1HQ5 A;  4RHM A;  1T4R A;  4FCK A;  4GSV A;  1WOH A;  3SKK A;  4IE2 A;  3NIQ A;  3M1R A;  2RLA A;  1XFK A;  4Q3S A;  2EIV A;  3THE A;  4MYL A;  1P8M A;  4IU0 A;  1GQ7 A;  1GQ6 A;  1P8N A;  3SL0 A;  4RHQ A;  3CEV A;  4GWC A;  4Q40 A;  2ZAV A;  4Q3U A;  3E6V A;  4IXU A;  1D3V A;  5RLA A;  1WOG A;  4RHK A;  1TA1 A;  2EF4 A;  1WVB A;  1TBL A;  3SJT A;  2EF5 A;  1ZPE A;  4HWW A;  2PHA A;  4IE3 A;  4MXR A;  1WOI A;  4RLA A;  4MYF A;  3MFV A;  3DJ8 A;  3MJL A;  4GWD A;  4IU1 A;  3E9B A;  3NIP A;  4FCI A;  3LHL A;  1ZPG A;  4G3H A;  4HXQ A;  4Q3Q A;  3MFW A;  4IXV A;  1T5G A;  2PLL A;  3F80 A;  3LP7 A;  5CEV A;  4DZ4 A;  4Q3R C;  3E8Q A;  3TF3 A;  4HZE A;  3THH A;  3TH7 A;  4Q3R A;  1CEV A;  4MYK A;  2AEB A; 
#chains in the Genus database with same CATH topology
 3PZL A;  4Q41 A;  1P8Q A;  2VQW G;  4Q3T A;  5G0Y A;  3SL1 A;  4A69 A;  2VQM A;  5G0J A;  1HQG A;  5DC6 A;  4QA5 A;  1P8O A;  4IE1 A;  5G0X A;  3GMZ A;  3Q9C A;  4GSZ A;  1R1O A;  4I06 A;  1T67 A;  2PHO A;  4MYN A;  1ZZ1 A;  3Q9B A;  5EFB D;  3LP4 A;  3KV2 A;  5EEF A;  5G17 A;  2A0M A;  1HQF A;  1P8P A;  1WVA A;  5EF8 A;  3GN0 A;  4QA7 A;  4Q3P A;  4RN1 A;  3F07 A;  5EFH A;  4ZUP A;  4BZ8 A;  1HQH A;  5DC7 A;  3MAX A;  4IU4 A;  5G0G A;  1T4T A;  4LXZ A;  1P8R A;  2CEV A;  1TBJ A;  4RHI A;  4ZUR A;  5HJA A;  3RQD A;  1HQX A;  4ITY A;  5DC8 A;  1RLA A;  3MMR A;  5HJ9 A;  3RLA A;  3THJ A;  3E8Z A;  1T4P A;  1P8S A;  3E6K A;  4CEV A;  4BZ9 A;  4QA3 A;  4RHJ A;  4BKX B;  1PQ3 A;  4IU5 A;  3MZ7 A;  2VQJ A;  3MZ4 A;  4Q3V A;  5IX0 A;  1TBH A;  5G10 A;  4Q42 A;  1T5F A;  1T4S A;  4RHL A;  4GSM A;  3NIO A;  5D1D A;  5G3W A;  1HQ5 A;  4RHM A;  2VQQ A;  5EEN A;  1T4R A;  2VCG A;  4FCK A;  4GSV A;  2V5W A;  2GH6 A;  1C3P A;  5EEK A;  1WOH A;  3ZNS A;  3SKK A;  1C3R A;  5EEI A;  4IE2 A;  3SFF A;  5G0I A;  3NIQ A;  4CBY A;  3M1R A;  2RLA A;  1XFK A;  4Q3S A;  5EFG A;  5LI3 A;  2EIV A;  4QA1 A;  5ICN B;  3THE A;  4MYL A;  1VKG A;  1P8M A;  3F06 A;  4IU0 A;  4QA6 A;  4CQF A;  5FUE A;  1GQ7 A;  1GQ6 A;  5D1C A;  5EFJ D;  1P8N A;  3SL0 A;  4RHQ A;  5EFK B;  5G11 A;  3CEV A;  4GWC A;  4Q40 A;  2ZAV A;  4Q3U A;  3E6V A;  4IXU A;  3MEN A;  4QA0 A;  4CBT A;  5JI5 A;  1D3V A;  1T64 A;  5G1C A;  5RLA A;  1WOG A;  4RHK A;  3EZP A;  1TA1 A;  1ZZ0 A;  5G12 A;  4BZ7 A;  2EF4 A;  1WVB A;  3Q9E A;  4ZUN A;  1TBL A;  3SJT A;  2EF5 A;  5THS A;  1ZPE A;  4HWW A;  3EWF A;  2PHA A;  4IE3 A;  4MXR A;  2VQO A;  1ZZ3 A;  5G13 A;  1WOI A;  3EW8 A;  4RLA A;  1T69 A;  3F0R A;  3MFV A;  4MYF A;  4ZUM A;  3DJ8 A;  3C0Y A;  5EFN A;  3MJL A;  1C3S A;  3C10 A;  5G1B A;  3MZ3 A;  4GWD A;  5THV A;  4IU1 A;  3E9B A;  5THT A;  5IWG A;  4BZ5 A;  4RN0 A;  5BWZ A;  1W22 A;  3NIP A;  3LHL A;  4FCI A;  1ZPG A;  2VQV A;  5FCW A;  4G3H A;  4HXQ A;  5A2S A;  4Q3Q A;  4BZ6 A;  3MFW A;  4IXV A;  3MZ6 A;  5THU A;  1T5G A;  2PLL A;  3C0Z A;  3F80 A;  3Q9F A;  3SFH A;  3ZNR A;  5G0H A;  3LP7 A;  4ZUQ A;  5CEV A;  4DZ4 A;  4Q3R C;  3E8Q A;  4LY1 A;  4QA4 A;  3TF3 A;  3EZT A;  4HZE A;  5EEM A;  4ZUO A;  3THH A;  4RN2 A;  5EF7 A;  3TH7 A;  4Q3R A;  5DC5 A;  1CEV A;  5G1A A;  4MYK A;  2V5X A;  4QA2 A;  5D1B A;  2AEB A; 
#chains in the Genus database with same CATH homology
 3PZL A;  4Q41 A;  1P8Q A;  4Q3T A;  3SL1 A;  1HQG A;  1P8O A;  4IE1 A;  3GMZ A;  4GSZ A;  1R1O A;  4I06 A;  2PHO A;  4MYN A;  3LP4 A;  3KV2 A;  2A0M A;  1HQF A;  1P8P A;  1WVA A;  3GN0 A;  4Q3P A;  1HQH A;  4IU4 A;  1T4T A;  5HJA A;  1P8R A;  2CEV A;  1TBJ A;  4RHI A;  1HQX A;  4ITY A;  1RLA A;  3MMR A;  5HJ9 A;  3RLA A;  3THJ A;  3E8Z A;  1T4P A;  1P8S A;  3E6K A;  4CEV A;  4RHJ A;  1PQ3 A;  4IU5 A;  4Q3V A;  1TBH A;  4Q42 A;  1T5F A;  1T4S A;  4RHL A;  4GSM A;  3NIO A;  1HQ5 A;  4RHM A;  1T4R A;  4FCK A;  4GSV A;  1WOH A;  3SKK A;  4IE2 A;  3NIQ A;  3M1R A;  2RLA A;  1XFK A;  4Q3S A;  2EIV A;  3THE A;  4MYL A;  1P8M A;  4IU0 A;  1GQ7 A;  1GQ6 A;  1P8N A;  3SL0 A;  4RHQ A;  3CEV A;  4GWC A;  4Q40 A;  2ZAV A;  4Q3U A;  3E6V A;  4IXU A;  1D3V A;  5RLA A;  1WOG A;  4RHK A;  1TA1 A;  2EF4 A;  1WVB A;  1TBL A;  3SJT A;  2EF5 A;  1ZPE A;  4HWW A;  2PHA A;  4IE3 A;  4MXR A;  1WOI A;  4RLA A;  4MYF A;  3MFV A;  3DJ8 A;  3MJL A;  4GWD A;  4IU1 A;  3E9B A;  3NIP A;  4FCI A;  3LHL A;  1ZPG A;  4G3H A;  4HXQ A;  4Q3Q A;  3MFW A;  4IXV A;  1T5G A;  2PLL A;  3F80 A;  3LP7 A;  5CEV A;  4DZ4 A;  4Q3R C;  3E8Q A;  3TF3 A;  4HZE A;  3THH A;  3TH7 A;  4Q3R A;  1CEV A;  4MYK A;  2AEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...