4RHMA

Crystal structure of t. brucei arginase-like protein quadruple mutant s149d/r151h/s153d/s226d
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
308
structure length
308
Chain Sequence
b'SHMFSKFLMNVKGVTPRGSDWANRLGPVALFGYGAGMPRRAPLLDFFLQSPRDCDHYAELTIHDKGPIECPPETVMFMPVLNCGQMLDEAAGTETPTSDEWYLGSLEASTELLEKGYVPVSVGGDGSATLSMVEAYKRLFPSDDIVIVHFDAHPDVSDPRSPLRVLLDKGLLKGVVSVGNRQVSSEDRKVRKLHKMFYMDMHAIYSKGLFCIRDIRNDYPVFISIDADVLDPAFAPAVDSPVAGGLSTRDLLHIMNGIRGPKVVGIDVYGYNPDLDVYRKDNVGLTAIALSKIIKEGILKAYSISTHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase
publication title Crystal Structure of an Arginase-like Protein from Trypanosoma brucei That Evolved without a Binuclear Manganese Cluster.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Unknown function
total genus 109
structure length 308
sequence length 308
chains with identical sequence B, C
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 4rhmA00
1PQ3A 3NIQA 1HQFA 4GSVA 1XFKA 4DZ4A 4G3HA 1RLAA 1WOIA 2PHAA 4Q3QA 1ZPEA 4RHMA 1HQHA 4MYKA 3TF3A 1T4SA 4RHKA 1R1OA 2AEBA 1D3VA 3CEVA 3MJLA 2PHOA 1GQ6A 4FCIA 4IU4A 4IXUA 4IE2A 4RHQA 3E6KA 3TH7A 3SJTA 2CEVA 3LHLA 4Q3RC 4RHJA 1WOHA 4Q40A 4RHLA 4GSZA 1TA1A 4IU0A 4Q42A 1P8MA 1HQXA 3SKKA 3SL1A 1HQGA 4RLAA 1T5GA 1WVBA 2ZAVA 1ZPGA 4IE3A 4IE1A 4GSMA 4RHIA 1P8PA 4CEVA 1WVAA 4Q3UA 3E6VA 3MFVA 3E9BA 1TBHA 1P8QA 1TBLA 3NIPA 4HXQA 1HQ5A 3DJ8A 4IXVA 3THJA 1WOGA 1P8NA 4Q3PA 1TBJA 1P8RA 4Q3SA 4MXRA 3MFWA 3SL0A 1T4TA 4Q41A 2EF5A 4MYLA 1P8SA 4Q3RA 3THEA 3F80A 3GMZA 1T4PA 1P8OA 3M1RA 4GWCA 4ITYA 3THHA 3KV2A 1GQ7A 4GWDA 2EF4A 2A0MA 3GN0A 3PZLA 4HZEA 4Q3VA 3E8QA 3LP4A 5CEVA 2EIVA 3LP7A 5RLAA 2PLLA 1T4RA 4HWWA 4I06A 3RLAA 3NIOA 4MYFA 3E8ZA 4Q3TA 3MMRA 1CEVA 5HJ9A 4MYNA 4IU1A 5HJAA 4FCKA 1T5FA 2RLAA 4IU5A
chains in the Genus database with same CATH superfamily
1PQ3A 3NIQA 1T64A 1HQFA 1T69A 3EZTA 5EFJD 4GSVA 1XFKA 4DZ4A 4G3HA 1C3RA 1RLAA 1WOIA 2PHAA 1ZPEA 4Q3QA 5IWGA 4RHMA 5D1DA 1HQHA 5G0YA 4MYKA 3TF3A 1T4SA 4RHKA 5G12A 1R1OA 2AEBA 5DC5A 1D3VA 4RN2A 5EFNA 3CEVA 5EFHA 5G0GA 3EWFA 5G10A 3ZNSA 3F0RA 3MJLA 2PHOA 5EEFA 4CBYA 1GQ6A 5EEKA 1C3SA 4RN1A 4FCIA 5FCWA 2GH6A 4IU4A 4IXUA 4IE2A 4RHQA 4ZUMA 5G13A 5ICNB 5A2SA 4BZ8A 3E6KA 3TH7A 4QA1A 2CEVA 3LHLA 3MZ6A 3MZ4A 4Q3RC 3C0YA 3SJTA 4LY1A 4RHJA 1WOHA 4Q40A 5JI5A 4RHLA 5EFKB 2VQVA 1TA1A 4GSZA 4IU0A 4Q42A 5DC7A 5D1BA 1P8MA 1HQXA 5EEIA 1ZZ3A 3SL1A 3SKKA 1HQGA 3MZ3A 4ZUNA 3SFFA 4RLAA 1T5GA 1WVBA 2ZAVA 1ZPGA 4QA0A 1T67A 4IE3A 4IE1A 4GSMA 4QA3A 3Q9BA 4RHIA 2V5WA 1P8PA 4QA5A 4CEVA 1WVAA 5G0XA 4Q3UA 5G3WA 3E6VA 4A69A 4CQFA 3MFVA 5EFGA 3E9BA 1TBHA 5EENA 4ZUQA 5EF8A 1P8QA 1TBLA 3NIPA 4RN0A 4HXQA 1HQ5A 3DJ8A 3RQDA 4IXVA 5THTA 2VQJA 3THJA 5LI3A 1WOGA 1W22A 5D1CA 3EZPA 1P8NA 4Q3PA 1TBJA 1P8RA 5EF7A 5THVA 4QA2A 4Q3SA 4MXRA 1ZZ0A 5THSA 3MFWA 3C0ZA 3SL0A 2V5XA 1T4TA 4Q41A 2EF5A 4CBTA 4MYLA 1P8SA 3MZ7A 4Q3RA 4QA6A 5EEMA 3THEA 3F80A 3GMZA 1T4PA 1P8OA 3M1RA 5EFBD 4GWCA 4ITYA 4QA4A 3THHA 3KV2A 1GQ7A 3Q9EA 4GWDA 5FUEA 5IX0A 3MENA 3ZNRA 2EF4A 4ZUOA 2VCGA 2A0MA 3GN0A 4QA7A 4BZ7A 3PZLA 4HZEA 5G11A 5G0HA 1C3PA 4Q3VA 3E8QA 3LP4A 4BZ6A 5CEVA 2VQOA 4ZUPA 3SFHA 3F07A 2EIVA 5G1AA 4BKXB 5G17A 3LP7A 5RLAA 5G0JA 2PLLA 1T4RA 4HWWA 5G0IA 4I06A 5BWZA 3C10A 1ZZ1A 4ZURA 3RLAA 3Q9CA 2VQMA 3NIOA 4MYFA 3E8ZA 4LXZA 3Q9FA 5DC8A 5G1CA 3EW8A 4Q3TA 3MMRA 1CEVA 5HJ9A 4MYNA 2VQWG 4IU1A 5HJAA 4FCKA 1T5FA 5G1BA 4BZ5A 2RLAA 1VKGA 5THUA 3F06A 5DC6A 4BZ9A 4IU5A 2VQQA 3MAXA
chains in the Genus database with same CATH topology
1PQ3A 3NIQA 1HQFA 4GSVA 1XFKA 4DZ4A 4G3HA 1RLAA 1WOIA 2PHAA 4Q3QA 1ZPEA 4RHMA 1HQHA 4MYKA 3TF3A 1T4SA 4RHKA 1R1OA 2AEBA 1D3VA 3CEVA 3MJLA 2PHOA 1GQ6A 4FCIA 4IU4A 4IXUA 4IE2A 4RHQA 3E6KA 3TH7A 3SJTA 2CEVA 3LHLA 4Q3RC 4RHJA 1WOHA 4Q40A 4RHLA 4GSZA 1TA1A 4IU0A 4Q42A 1P8MA 1HQXA 3SKKA 3SL1A 1HQGA 4RLAA 1T5GA 1WVBA 2ZAVA 1ZPGA 4IE3A 4IE1A 4GSMA 4RHIA 1P8PA 4CEVA 1WVAA 4Q3UA 3E6VA 3MFVA 3E9BA 1TBHA 1P8QA 1TBLA 3NIPA 4HXQA 1HQ5A 3DJ8A 4IXVA 3THJA 1WOGA 1P8NA 4Q3PA 1TBJA 1P8RA 4Q3SA 4MXRA 3MFWA 3SL0A 1T4TA 4Q41A 2EF5A 4MYLA 1P8SA 4Q3RA 3THEA 3F80A 3GMZA 1T4PA 1P8OA 3M1RA 4GWCA 4ITYA 3THHA 3KV2A 1GQ7A 4GWDA 2EF4A 2A0MA 3GN0A 3PZLA 4HZEA 4Q3VA 3E8QA 3LP4A 5CEVA 2EIVA 3LP7A 5RLAA 2PLLA 1T4RA 4HWWA 4I06A 3RLAA 3NIOA 4MYFA 3E8ZA 4Q3TA 3MMRA 1CEVA 5HJ9A 4MYNA 4IU1A 5HJAA 4FCKA 1T5FA 2RLAA 4IU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PQ3 A;  3NIQ A;  1HQF A;  4GSV A;  1XFK A;  4DZ4 A;  4G3H A;  1RLA A;  1WOI A;  2PHA A;  4Q3Q A;  1ZPE A;  4RHM A;  1HQH A;  4MYK A;  3TF3 A;  1T4S A;  4RHK A;  1R1O A;  2AEB A;  1D3V A;  3CEV A;  3MJL A;  2PHO A;  1GQ6 A;  4FCI A;  4IU4 A;  4IXU A;  4IE2 A;  4RHQ A;  3E6K A;  3TH7 A;  3SJT A;  2CEV A;  3LHL A;  4Q3R C;  4RHJ A;  1WOH A;  4Q40 A;  4RHL A;  4GSZ A;  1TA1 A;  4IU0 A;  4Q42 A;  1P8M A;  1HQX A;  3SKK A;  3SL1 A;  1HQG A;  4RLA A;  1T5G A;  1WVB A;  2ZAV A;  1ZPG A;  4IE3 A;  4IE1 A;  4GSM A;  4RHI A;  1P8P A;  4CEV A;  1WVA A;  4Q3U A;  3E6V A;  3MFV A;  3E9B A;  1TBH A;  1P8Q A;  1TBL A;  3NIP A;  4HXQ A;  1HQ5 A;  3DJ8 A;  4IXV A;  3THJ A;  1WOG A;  1P8N A;  4Q3P A;  1TBJ A;  1P8R A;  4Q3S A;  4MXR A;  3MFW A;  3SL0 A;  1T4T A;  4Q41 A;  2EF5 A;  4MYL A;  1P8S A;  4Q3R A;  3THE A;  3F80 A;  3GMZ A;  1T4P A;  1P8O A;  3M1R A;  4GWC A;  4ITY A;  3THH A;  3KV2 A;  1GQ7 A;  4GWD A;  2EF4 A;  2A0M A;  3GN0 A;  3PZL A;  4HZE A;  4Q3V A;  3E8Q A;  3LP4 A;  5CEV A;  2EIV A;  3LP7 A;  5RLA A;  2PLL A;  1T4R A;  4HWW A;  4I06 A;  3RLA A;  3NIO A;  4MYF A;  3E8Z A;  4Q3T A;  3MMR A;  1CEV A;  5HJ9 A;  4MYN A;  4IU1 A;  5HJA A;  4FCK A;  1T5F A;  2RLA A;  4IU5 A; 
#chains in the Genus database with same CATH topology
 1PQ3 A;  3NIQ A;  1T64 A;  1HQF A;  1T69 A;  3EZT A;  5EFJ D;  4GSV A;  1XFK A;  4DZ4 A;  4G3H A;  1C3R A;  1RLA A;  1WOI A;  2PHA A;  1ZPE A;  4Q3Q A;  5IWG A;  4RHM A;  5D1D A;  1HQH A;  5G0Y A;  4MYK A;  3TF3 A;  1T4S A;  4RHK A;  5G12 A;  1R1O A;  2AEB A;  5DC5 A;  1D3V A;  4RN2 A;  5EFN A;  3CEV A;  5EFH A;  5G0G A;  3EWF A;  5G10 A;  3ZNS A;  3F0R A;  3MJL A;  2PHO A;  5EEF A;  4CBY A;  1GQ6 A;  5EEK A;  1C3S A;  4RN1 A;  4FCI A;  5FCW A;  2GH6 A;  4IU4 A;  4IXU A;  4IE2 A;  4RHQ A;  4ZUM A;  5G13 A;  5ICN B;  5A2S A;  4BZ8 A;  3E6K A;  3TH7 A;  4QA1 A;  2CEV A;  3LHL A;  3MZ6 A;  3MZ4 A;  4Q3R C;  3C0Y A;  3SJT A;  4LY1 A;  4RHJ A;  1WOH A;  4Q40 A;  5JI5 A;  4RHL A;  5EFK B;  2VQV A;  1TA1 A;  4GSZ A;  4IU0 A;  4Q42 A;  5DC7 A;  5D1B A;  1P8M A;  1HQX A;  5EEI A;  1ZZ3 A;  3SL1 A;  3SKK A;  1HQG A;  3MZ3 A;  4ZUN A;  3SFF A;  4RLA A;  1T5G A;  1WVB A;  2ZAV A;  1ZPG A;  4QA0 A;  1T67 A;  4IE3 A;  4IE1 A;  4GSM A;  4QA3 A;  3Q9B A;  4RHI A;  2V5W A;  1P8P A;  4QA5 A;  4CEV A;  1WVA A;  5G0X A;  4Q3U A;  5G3W A;  3E6V A;  4A69 A;  4CQF A;  3MFV A;  5EFG A;  3E9B A;  1TBH A;  5EEN A;  4ZUQ A;  5EF8 A;  1P8Q A;  1TBL A;  3NIP A;  4RN0 A;  4HXQ A;  1HQ5 A;  3DJ8 A;  3RQD A;  4IXV A;  5THT A;  2VQJ A;  3THJ A;  5LI3 A;  1WOG A;  1W22 A;  5D1C A;  3EZP A;  1P8N A;  4Q3P A;  1TBJ A;  1P8R A;  5EF7 A;  5THV A;  4QA2 A;  4Q3S A;  4MXR A;  1ZZ0 A;  5THS A;  3MFW A;  3C0Z A;  3SL0 A;  2V5X A;  1T4T A;  4Q41 A;  2EF5 A;  4CBT A;  4MYL A;  1P8S A;  3MZ7 A;  4Q3R A;  4QA6 A;  5EEM A;  3THE A;  3F80 A;  3GMZ A;  1T4P A;  1P8O A;  3M1R A;  5EFB D;  4GWC A;  4ITY A;  4QA4 A;  3THH A;  3KV2 A;  1GQ7 A;  3Q9E A;  4GWD A;  5FUE A;  5IX0 A;  3MEN A;  3ZNR A;  2EF4 A;  4ZUO A;  2VCG A;  2A0M A;  3GN0 A;  4QA7 A;  4BZ7 A;  3PZL A;  4HZE A;  5G11 A;  5G0H A;  1C3P A;  4Q3V A;  3E8Q A;  3LP4 A;  4BZ6 A;  5CEV A;  2VQO A;  4ZUP A;  3SFH A;  3F07 A;  2EIV A;  5G1A A;  4BKX B;  5G17 A;  3LP7 A;  5RLA A;  5G0J A;  2PLL A;  1T4R A;  4HWW A;  5G0I A;  4I06 A;  5BWZ A;  3C10 A;  1ZZ1 A;  4ZUR A;  3RLA A;  3Q9C A;  2VQM A;  3NIO A;  4MYF A;  3E8Z A;  4LXZ A;  3Q9F A;  5DC8 A;  5G1C A;  3EW8 A;  4Q3T A;  3MMR A;  1CEV A;  5HJ9 A;  4MYN A;  2VQW G;  4IU1 A;  5HJA A;  4FCK A;  1T5F A;  5G1B A;  4BZ5 A;  2RLA A;  1VKG A;  5THU A;  3F06 A;  5DC6 A;  4BZ9 A;  4IU5 A;  2VQQ A;  3MAX A; 
#chains in the Genus database with same CATH homology
 1PQ3 A;  3NIQ A;  1HQF A;  4GSV A;  1XFK A;  4DZ4 A;  4G3H A;  1RLA A;  1WOI A;  2PHA A;  4Q3Q A;  1ZPE A;  4RHM A;  1HQH A;  4MYK A;  3TF3 A;  1T4S A;  4RHK A;  1R1O A;  2AEB A;  1D3V A;  3CEV A;  3MJL A;  2PHO A;  1GQ6 A;  4FCI A;  4IU4 A;  4IXU A;  4IE2 A;  4RHQ A;  3E6K A;  3TH7 A;  3SJT A;  2CEV A;  3LHL A;  4Q3R C;  4RHJ A;  1WOH A;  4Q40 A;  4RHL A;  4GSZ A;  1TA1 A;  4IU0 A;  4Q42 A;  1P8M A;  1HQX A;  3SKK A;  3SL1 A;  1HQG A;  4RLA A;  1T5G A;  1WVB A;  2ZAV A;  1ZPG A;  4IE3 A;  4IE1 A;  4GSM A;  4RHI A;  1P8P A;  4CEV A;  1WVA A;  4Q3U A;  3E6V A;  3MFV A;  3E9B A;  1TBH A;  1P8Q A;  1TBL A;  3NIP A;  4HXQ A;  1HQ5 A;  3DJ8 A;  4IXV A;  3THJ A;  1WOG A;  1P8N A;  4Q3P A;  1TBJ A;  1P8R A;  4Q3S A;  4MXR A;  3MFW A;  3SL0 A;  1T4T A;  4Q41 A;  2EF5 A;  4MYL A;  1P8S A;  4Q3R A;  3THE A;  3F80 A;  3GMZ A;  1T4P A;  1P8O A;  3M1R A;  4GWC A;  4ITY A;  3THH A;  3KV2 A;  1GQ7 A;  4GWD A;  2EF4 A;  2A0M A;  3GN0 A;  3PZL A;  4HZE A;  4Q3V A;  3E8Q A;  3LP4 A;  5CEV A;  2EIV A;  3LP7 A;  5RLA A;  2PLL A;  1T4R A;  4HWW A;  4I06 A;  3RLA A;  3NIO A;  4MYF A;  3E8Z A;  4Q3T A;  3MMR A;  1CEV A;  5HJ9 A;  4MYN A;  4IU1 A;  5HJA A;  4FCK A;  1T5F A;  2RLA A;  4IU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...