4RP5A

Crystal structure of the l27 domain of discs large 1 (target id nysgrc-010766) from drosophila melanogaster (space group p21)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
94
structure length
94
Chain Sequence
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALLDIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antitumor protein
molecule keywords Disks large 1 tumor suppressor protein
publication title Structures of the L27 Domain of Disc Large Homologue 1 Protein Illustrate a Self-Assembly Module.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 34
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09058 L27_1 L27_1
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...