4S2XA

Structure of e. coli rpph bound to rna and two magnesium ions
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
161
structure length
158
Chain Sequence
b'SMIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA pyrophosphohydrolase
publication title Structures of RNA Complexes with the Escherichia coli RNA Pyrophosphohydrolase RppH Unveil the Basis for Specific 5'-End-dependent mRNA Decay.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/rna
total genus 42
structure length 158
sequence length 161
ec nomenclature ec 3.6.1.-:
pdb deposition date 2015-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 4s2xA00
5GHQA 5GHPA 5ANVA 3BM4A 3X0KA 1VIUA 2DSCA 3QSJA 3ZR1A 3OGAA 5FSOA 1SOIA 1X51A 1NFSA 2B0VA 3WHWA 2B2KA 2G74A 5IW4A 4YOQA 1V8UA 1VC9A 2B06A 4K6EA 5BS6A 5BONA 1V8MA 1XSBA 3Q91A 3X0OA 4ZG0A 2A8SA 1V8SA 3O61A 1K26A 2R5WA 1PPVA 3A6TA 4JZVA 1XSCA 1VK6A 2J8QA 5ANWA 2FMLA 5ANUA 4ILQA 1PUNA 1JRKA 2I6KA 3X0PA 5FSKA 1Q33A 1V8NA 2FVVA 3A6UA 4HVYA 4JZUA 2GT4A 1U20A 2CL3A 2DSBA 5DPKA 1IRYA 5FSNA 5ISYA 1K2EA 1KTGA 2GT2A 2QKMB 3MDGA 3HYQA 3EF5A 1OW2A 1KHZA 3RH7A 3R03A 1V8WA 1VC8A 1V8RA 3J7Ye 5ANSA 3EXQA 2O1CA 4ICKA 5ANTA 3Q2SA 2QJOA 3MCFA 3SONA 5HZXA 4YPRA 1PPXA 3X0RA 3DUPA 1V8YA 1MUTA 4N1TA 2A6TA 3X0MA 4KYXA 3FSPA 1G9QA 3X0LA 3GZ6A 1V8LA 3BHOA 3P5TA 5I8UA 4S2WA 5FSMA 2A8PA 4S2YA 3MDIA 5GHMA 1V8IA 4MPOA 1NQYA 4C9XA 5DEQA 3SMDA 1MP2A 3I7UA 3Q2TA 1F3YA 4KG4A 3I9XA 3ACAA 3CNGA 3FCMA 5DD4A 5GHJA 2A8QA 3L85A 1V8TA 2I8TA 4DYWA 1VHGA 3X0IA 1MR2A 1GA7A 1VHZA 3A6VA 2YVOA 2PQVA 3O6ZA 1KT9A 2I8UA 1HZTA 1NQZA 3AC9A 3GZ5A 4KTBA 2RRKA 2VNPA 4C9WA 3GZ8A 1QVJA 3P6YA 3ID9A 1NFZA 1G0SA 4S2XA 1X84A 1SU2A 2ICKA 3O69A 1PUQA 3KVHA 3MGMA 4HFQA 1RRSA 4IJXA 1JKNA 2DSDA 2KDWA 4NFXA 2XSQA 1Q54A 2YVPA 4JZSA 3SHDA 5FSIA 3X0QA 2YYHA 2Q9PA 2GB5A 5GHOA 5C8LA 3X0JA 3G0QA 1X83A 3FK9A 1MQWA 4V14A 5C7TA 2G73A 1MK1A 2VNQA 3EEUA 3O8SA 1VIQA 2W4EA 5CFJA 3EESA 2JVBA 2YVMA 4JZTA 3U53A 1RRQA 5FSLA 2ICJA 3E57A 2FKBA 5CFIA 3Q4IA 4N1UA 2A8RA 5C7QA 1PVFA 4YPHA 3X0SA 2YVNA 3DKUA 3HHJA 5GHIA 2QJTA 3GWYA 2A8TA 1R67A 4NFWA 5DDGA 2O5WA 3Q93A 5IW5A 2DHOA 1V8VA 3N9UA 2O5FA 4KG3A 2DUKA 1PPWA 3BAPA 4S2VA 1SJYA 3COUA 1Q27A 1RYAA 3A6SA 2PNYA 3Q1PA 1VRLA 5LPGA 1XSAA 3F13A 1VCDA 3I7VA 1PUSA 1SZ3A 3N77A 1HX3A 5GHNA 3O52A 3GRNA 3ZR0A 1TUMA 3F6AA 2KDVA 1MQEA 3FFUA 1I9AA 3H95A 3X0NA 3FJYA 3GG6A 2AZWA
chains in the Genus database with same CATH superfamily
5GHQA 5GHPA 5ANVA 3BM4A 3X0KA 1VIUA 2DSCA 3QSJA 3ZR1A 3OGAA 5FSOA 1SOIA 1X51A 1NFSA 2B0VA 3WHWA 2B2KA 2G74A 5IW4A 4YOQA 1V8UA 1VC9A 2B06A 4K6EA 5BS6A 5BONA 1V8MA 1XSBA 3Q91A 3X0OA 4ZG0A 2A8SA 1V8SA 3O61A 1K26A 4J7HA 2R5WA 1PPVA 3A6TA 4JZVA 1XSCA 1VK6A 2J8QA 5ANWA 2FMLA 5ANUA 4ILQA 1PUNA 1JRKA 2I6KA 3X0PA 5FSKA 1Q33A 1V8NA 2FVVA 3A6UA 4HVYA 4JZUA 2GT4A 1U20A 2CL3A 2DSBA 5DPKA 1IRYA 5FSNA 5ISYA 1K2EA 1KTGA 2GT2A 2QKMB 3MDGA 3HYQA 3EF5A 1OW2A 1KHZA 3RH7A 3R03A 1V8WA 1VC8A 1V8RA 3J7Ye 5ANSA 3EXQA 2O1CA 4ICKA 5ANTA 3Q2SA 2QJOA 3MCFA 3SONA 5HZXA 4YPRA 1PPXA 3X0RA 3DUPA 1V8YA 1MUTA 4N1TA 2A6TA 3X0MA 4KYXA 3FSPA 1G9QA 3X0LA 3GZ6A 1V8LA 3BHOA 3P5TA 5I8UA 4S2WA 5FSMA 2A8PA 4S2YA 3MDIA 5GHMA 1V8IA 4MPOA 1NQYA 4C9XA 5DEQA 3SMDA 1MP2A 3I7UA 3Q2TA 1F3YA 4KG4A 3I9XA 3ACAA 3CNGA 3FCMA 5DD4A 5GHJA 2A8QA 2CZRA 1V8TA 2I8TA 3L85A 4DYWA 4J7GA 1VHGA 3X0IA 1MR2A 1GA7A 1VHZA 3A6VA 2YVOA 2PQVA 3O6ZA 1KT9A 2I8UA 1HZTA 1NQZA 3AC9A 3GZ5A 4KTBA 2RRKA 2VNPA 4C9WA 3GZ8A 1QVJA 3P6YA 3ID9A 1NFZA 1G0SA 4S2XA 1X84A 1SU2A 2ICKA 3O69A 1PUQA 3KVHA 3MGMA 4HFQA 1RRSA 4IJXA 1JKNA 2DSDA 2KDWA 4NFXA 2XSQA 1Q54A 2YVPA 4JZSA 3SHDA 5FSIA 3X0QA 2YYHA 2Q9PA 2GB5A 5GHOA 5C8LA 3X0JA 3G0QA 1X83A 3FK9A 1MQWA 4V14A 5C7TA 2G73A 1MK1A 2VNQA 3EEUA 3O8SA 1VIQA 2W4EA 5CFJA 3EESA 2JVBA 2YVMA 4JZTA 3U53A 1RRQA 5FSLA 2ICJA 3E57A 2FKBA 5CFIA 3Q4IA 4N1UA 2A8RA 5C7QA 1PVFA 4YPHA 3X0SA 2YVNA 3DKUA 3HHJA 5GHIA 2QJTA 3GWYA 2A8TA 1R67A 4NFWA 5DDGA 2O5WA 3Q93A 5IW5A 2DHOA 1V8VA 3N9UA 2O5FA 4KG3A 2DUKA 1PPWA 3BAPA 4S2VA 1SJYA 3COUA 1Q27A 1RYAA 3A6SA 2PNYA 3Q1PA 1VRLA 5LPGA 1XSAA 3F13A 1VCDA 3I7VA 1PUSA 1SZ3A 3N77A 1HX3A 5GHNA 3O52A 3GRNA 3ZR0A 1TUMA 3F6AA 2KDVA 1MQEA 3FFUA 1I9AA 3H95A 3X0NA 3FJYA 3GG6A 2AZWA
chains in the Genus database with same CATH topology
5GHQA 5GHPA 5ANVA 3BM4A 3X0KA 1VIUA 2DSCA 3QSJA 3ZR1A 3OGAA 5FSOA 1SOIA 1X51A 1NFSA 2B0VA 3WHWA 2B2KA 2G74A 5IW4A 4YOQA 1V8UA 1VC9A 2B06A 4K6EA 5BS6A 5BONA 1V8MA 1XSBA 3Q91A 3X0OA 4ZG0A 2A8SA 1V8SA 3O61A 1K26A 4J7HA 2R5WA 1PPVA 3A6TA 4JZVA 1XSCA 1VK6A 2J8QA 5ANWA 2FMLA 5ANUA 4ILQA 1PUNA 1JRKA 2I6KA 3X0PA 5FSKA 1Q33A 1V8NA 2FVVA 3A6UA 4HVYA 4JZUA 2GT4A 1U20A 2CL3A 2DSBA 5DPKA 1IRYA 5FSNA 5ISYA 1K2EA 1KTGA 2GT2A 2QKMB 3MDGA 3HYQA 3EF5A 1OW2A 1KHZA 3RH7A 3R03A 1V8WA 1VC8A 1V8RA 3J7Ye 5ANSA 3EXQA 2O1CA 4ICKA 5ANTA 3Q2SA 2QJOA 3MCFA 3SONA 5HZXA 4YPRA 1PPXA 3X0RA 3DUPA 1V8YA 1MUTA 4N1TA 2A6TA 3X0MA 4KYXA 3FSPA 1G9QA 3X0LA 3GZ6A 1V8LA 3BHOA 3P5TA 5I8UA 4S2WA 5FSMA 2A8PA 4S2YA 3MDIA 5GHMA 1V8IA 4MPOA 1NQYA 4C9XA 5DEQA 3SMDA 1MP2A 3I7UA 3Q2TA 1F3YA 4KG4A 3I9XA 3ACAA 3CNGA 3FCMA 5DD4A 5GHJA 2A8QA 2CZRA 1V8TA 2I8TA 3L85A 4DYWA 4J7GA 1VHGA 3X0IA 1MR2A 1GA7A 1VHZA 3A6VA 2YVOA 2PQVA 3O6ZA 1KT9A 2I8UA 1HZTA 1NQZA 3AC9A 3GZ5A 4KTBA 2RRKA 2VNPA 4C9WA 3GZ8A 1QVJA 3P6YA 3ID9A 1NFZA 1G0SA 4S2XA 1X84A 1SU2A 2ICKA 3O69A 1PUQA 3KVHA 3MGMA 4HFQA 1RRSA 4IJXA 1JKNA 2DSDA 2KDWA 4NFXA 2XSQA 1Q54A 2YVPA 4JZSA 3SHDA 5FSIA 3X0QA 2YYHA 2Q9PA 2GB5A 5GHOA 5C8LA 3X0JA 3G0QA 1X83A 3FK9A 1MQWA 4V14A 5C7TA 2G73A 1MK1A 2VNQA 3EEUA 3O8SA 1VIQA 2W4EA 5CFJA 3EESA 2JVBA 2YVMA 4JZTA 3U53A 1RRQA 5FSLA 2ICJA 3E57A 2FKBA 5CFIA 3Q4IA 4N1UA 2A8RA 5C7QA 1PVFA 4YPHA 3X0SA 2YVNA 3DKUA 3HHJA 5GHIA 2QJTA 3GWYA 2A8TA 1R67A 4NFWA 5DDGA 2O5WA 3Q93A 5IW5A 2DHOA 1V8VA 3N9UA 2O5FA 4KG3A 2DUKA 1PPWA 3BAPA 4S2VA 1SJYA 3COUA 1Q27A 1RYAA 3A6SA 2PNYA 3Q1PA 1VRLA 5LPGA 1XSAA 3F13A 1VCDA 3I7VA 1PUSA 1SZ3A 3N77A 1HX3A 5GHNA 3O52A 3GRNA 3ZR0A 1TUMA 3F6AA 2KDVA 1MQEA 3FFUA 1I9AA 3H95A 3X0NA 3FJYA 3GG6A 2AZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GHQ A;  5GHP A;  5ANV A;  3BM4 A;  3X0K A;  1VIU A;  2DSC A;  3QSJ A;  3ZR1 A;  3OGA A;  5FSO A;  1SOI A;  1X51 A;  1NFS A;  2B0V A;  3WHW A;  2B2K A;  2G74 A;  5IW4 A;  4YOQ A;  1V8U A;  1VC9 A;  2B06 A;  4K6E A;  5BS6 A;  5BON A;  1V8M A;  1XSB A;  3Q91 A;  3X0O A;  4ZG0 A;  2A8S A;  1V8S A;  3O61 A;  1K26 A;  2R5W A;  1PPV A;  3A6T A;  4JZV A;  1XSC A;  1VK6 A;  2J8Q A;  5ANW A;  2FML A;  5ANU A;  4ILQ A;  1PUN A;  1JRK A;  2I6K A;  3X0P A;  5FSK A;  1Q33 A;  1V8N A;  2FVV A;  3A6U A;  4HVY A;  4JZU A;  2GT4 A;  1U20 A;  2CL3 A;  2DSB A;  5DPK A;  1IRY A;  5FSN A;  5ISY A;  1K2E A;  1KTG A;  2GT2 A;  2QKM B;  3MDG A;  3HYQ A;  3EF5 A;  1OW2 A;  1KHZ A;  3RH7 A;  3R03 A;  1V8W A;  1VC8 A;  1V8R A;  3J7Y e;  5ANS A;  3EXQ A;  2O1C A;  4ICK A;  5ANT A;  3Q2S A;  2QJO A;  3MCF A;  3SON A;  5HZX A;  4YPR A;  1PPX A;  3X0R A;  3DUP A;  1V8Y A;  1MUT A;  4N1T A;  2A6T A;  3X0M A;  4KYX A;  3FSP A;  1G9Q A;  3X0L A;  3GZ6 A;  1V8L A;  3BHO A;  3P5T A;  5I8U A;  4S2W A;  5FSM A;  2A8P A;  4S2Y A;  3MDI A;  5GHM A;  1V8I A;  4MPO A;  1NQY A;  4C9X A;  5DEQ A;  3SMD A;  1MP2 A;  3I7U A;  3Q2T A;  1F3Y A;  4KG4 A;  3I9X A;  3ACA A;  3CNG A;  3FCM A;  5DD4 A;  5GHJ A;  2A8Q A;  3L85 A;  1V8T A;  2I8T A;  4DYW A;  1VHG A;  3X0I A;  1MR2 A;  1GA7 A;  1VHZ A;  3A6V A;  2YVO A;  2PQV A;  3O6Z A;  1KT9 A;  2I8U A;  1HZT A;  1NQZ A;  3AC9 A;  3GZ5 A;  4KTB A;  2RRK A;  2VNP A;  4C9W A;  3GZ8 A;  1QVJ A;  3P6Y A;  3ID9 A;  1NFZ A;  1G0S A;  4S2X A;  1X84 A;  1SU2 A;  2ICK A;  3O69 A;  1PUQ A;  3KVH A;  3MGM A;  4HFQ A;  1RRS A;  4IJX A;  1JKN A;  2DSD A;  2KDW A;  4NFX A;  2XSQ A;  1Q54 A;  2YVP A;  4JZS A;  3SHD A;  5FSI A;  3X0Q A;  2YYH A;  2Q9P A;  2GB5 A;  5GHO A;  5C8L A;  3X0J A;  3G0Q A;  1X83 A;  3FK9 A;  1MQW A;  4V14 A;  5C7T A;  2G73 A;  1MK1 A;  2VNQ A;  3EEU A;  3O8S A;  1VIQ A;  2W4E A;  5CFJ A;  3EES A;  2JVB A;  2YVM A;  4JZT A;  3U53 A;  1RRQ A;  5FSL A;  2ICJ A;  3E57 A;  2FKB A;  5CFI A;  3Q4I A;  4N1U A;  2A8R A;  5C7Q A;  1PVF A;  4YPH A;  3X0S A;  2YVN A;  3DKU A;  3HHJ A;  5GHI A;  2QJT A;  3GWY A;  2A8T A;  1R67 A;  4NFW A;  5DDG A;  2O5W A;  3Q93 A;  5IW5 A;  2DHO A;  1V8V A;  3N9U A;  2O5F A;  4KG3 A;  2DUK A;  1PPW A;  3BAP A;  4S2V A;  1SJY A;  3COU A;  1Q27 A;  1RYA A;  3A6S A;  2PNY A;  3Q1P A;  1VRL A;  5LPG A;  1XSA A;  3F13 A;  1VCD A;  3I7V A;  1PUS A;  1SZ3 A;  3N77 A;  1HX3 A;  5GHN A;  3O52 A;  3GRN A;  3ZR0 A;  1TUM A;  3F6A A;  2KDV A;  1MQE A;  3FFU A;  1I9A A;  3H95 A;  3X0N A;  3FJY A;  3GG6 A;  2AZW A; 
#chains in the Genus database with same CATH topology
 5GHQ A;  5GHP A;  5ANV A;  3BM4 A;  3X0K A;  1VIU A;  2DSC A;  3QSJ A;  3ZR1 A;  3OGA A;  5FSO A;  1SOI A;  1X51 A;  1NFS A;  2B0V A;  3WHW A;  2B2K A;  2G74 A;  5IW4 A;  4YOQ A;  1V8U A;  1VC9 A;  2B06 A;  4K6E A;  5BS6 A;  5BON A;  1V8M A;  1XSB A;  3Q91 A;  3X0O A;  4ZG0 A;  2A8S A;  1V8S A;  3O61 A;  1K26 A;  4J7H A;  2R5W A;  1PPV A;  3A6T A;  4JZV A;  1XSC A;  1VK6 A;  2J8Q A;  5ANW A;  2FML A;  5ANU A;  4ILQ A;  1PUN A;  1JRK A;  2I6K A;  3X0P A;  5FSK A;  1Q33 A;  1V8N A;  2FVV A;  3A6U A;  4HVY A;  4JZU A;  2GT4 A;  1U20 A;  2CL3 A;  2DSB A;  5DPK A;  1IRY A;  5FSN A;  5ISY A;  1K2E A;  1KTG A;  2GT2 A;  2QKM B;  3MDG A;  3HYQ A;  3EF5 A;  1OW2 A;  1KHZ A;  3RH7 A;  3R03 A;  1V8W A;  1VC8 A;  1V8R A;  3J7Y e;  5ANS A;  3EXQ A;  2O1C A;  4ICK A;  5ANT A;  3Q2S A;  2QJO A;  3MCF A;  3SON A;  5HZX A;  4YPR A;  1PPX A;  3X0R A;  3DUP A;  1V8Y A;  1MUT A;  4N1T A;  2A6T A;  3X0M A;  4KYX A;  3FSP A;  1G9Q A;  3X0L A;  3GZ6 A;  1V8L A;  3BHO A;  3P5T A;  5I8U A;  4S2W A;  5FSM A;  2A8P A;  4S2Y A;  3MDI A;  5GHM A;  1V8I A;  4MPO A;  1NQY A;  4C9X A;  5DEQ A;  3SMD A;  1MP2 A;  3I7U A;  3Q2T A;  1F3Y A;  4KG4 A;  3I9X A;  3ACA A;  3CNG A;  3FCM A;  5DD4 A;  5GHJ A;  2A8Q A;  2CZR A;  1V8T A;  2I8T A;  3L85 A;  4DYW A;  4J7G A;  1VHG A;  3X0I A;  1MR2 A;  1GA7 A;  1VHZ A;  3A6V A;  2YVO A;  2PQV A;  3O6Z A;  1KT9 A;  2I8U A;  1HZT A;  1NQZ A;  3AC9 A;  3GZ5 A;  4KTB A;  2RRK A;  2VNP A;  4C9W A;  3GZ8 A;  1QVJ A;  3P6Y A;  3ID9 A;  1NFZ A;  1G0S A;  4S2X A;  1X84 A;  1SU2 A;  2ICK A;  3O69 A;  1PUQ A;  3KVH A;  3MGM A;  4HFQ A;  1RRS A;  4IJX A;  1JKN A;  2DSD A;  2KDW A;  4NFX A;  2XSQ A;  1Q54 A;  2YVP A;  4JZS A;  3SHD A;  5FSI A;  3X0Q A;  2YYH A;  2Q9P A;  2GB5 A;  5GHO A;  5C8L A;  3X0J A;  3G0Q A;  1X83 A;  3FK9 A;  1MQW A;  4V14 A;  5C7T A;  2G73 A;  1MK1 A;  2VNQ A;  3EEU A;  3O8S A;  1VIQ A;  2W4E A;  5CFJ A;  3EES A;  2JVB A;  2YVM A;  4JZT A;  3U53 A;  1RRQ A;  5FSL A;  2ICJ A;  3E57 A;  2FKB A;  5CFI A;  3Q4I A;  4N1U A;  2A8R A;  5C7Q A;  1PVF A;  4YPH A;  3X0S A;  2YVN A;  3DKU A;  3HHJ A;  5GHI A;  2QJT A;  3GWY A;  2A8T A;  1R67 A;  4NFW A;  5DDG A;  2O5W A;  3Q93 A;  5IW5 A;  2DHO A;  1V8V A;  3N9U A;  2O5F A;  4KG3 A;  2DUK A;  1PPW A;  3BAP A;  4S2V A;  1SJY A;  3COU A;  1Q27 A;  1RYA A;  3A6S A;  2PNY A;  3Q1P A;  1VRL A;  5LPG A;  1XSA A;  3F13 A;  1VCD A;  3I7V A;  1PUS A;  1SZ3 A;  3N77 A;  1HX3 A;  5GHN A;  3O52 A;  3GRN A;  3ZR0 A;  1TUM A;  3F6A A;  2KDV A;  1MQE A;  3FFU A;  1I9A A;  3H95 A;  3X0N A;  3FJY A;  3GG6 A;  2AZW A; 
#chains in the Genus database with same CATH homology
 5GHQ A;  5GHP A;  5ANV A;  3BM4 A;  3X0K A;  1VIU A;  2DSC A;  3QSJ A;  3ZR1 A;  3OGA A;  5FSO A;  1SOI A;  1X51 A;  1NFS A;  2B0V A;  3WHW A;  2B2K A;  2G74 A;  5IW4 A;  4YOQ A;  1V8U A;  1VC9 A;  2B06 A;  4K6E A;  5BS6 A;  5BON A;  1V8M A;  1XSB A;  3Q91 A;  3X0O A;  4ZG0 A;  2A8S A;  1V8S A;  3O61 A;  1K26 A;  4J7H A;  2R5W A;  1PPV A;  3A6T A;  4JZV A;  1XSC A;  1VK6 A;  2J8Q A;  5ANW A;  2FML A;  5ANU A;  4ILQ A;  1PUN A;  1JRK A;  2I6K A;  3X0P A;  5FSK A;  1Q33 A;  1V8N A;  2FVV A;  3A6U A;  4HVY A;  4JZU A;  2GT4 A;  1U20 A;  2CL3 A;  2DSB A;  5DPK A;  1IRY A;  5FSN A;  5ISY A;  1K2E A;  1KTG A;  2GT2 A;  2QKM B;  3MDG A;  3HYQ A;  3EF5 A;  1OW2 A;  1KHZ A;  3RH7 A;  3R03 A;  1V8W A;  1VC8 A;  1V8R A;  3J7Y e;  5ANS A;  3EXQ A;  2O1C A;  4ICK A;  5ANT A;  3Q2S A;  2QJO A;  3MCF A;  3SON A;  5HZX A;  4YPR A;  1PPX A;  3X0R A;  3DUP A;  1V8Y A;  1MUT A;  4N1T A;  2A6T A;  3X0M A;  4KYX A;  3FSP A;  1G9Q A;  3X0L A;  3GZ6 A;  1V8L A;  3BHO A;  3P5T A;  5I8U A;  4S2W A;  5FSM A;  2A8P A;  4S2Y A;  3MDI A;  5GHM A;  1V8I A;  4MPO A;  1NQY A;  4C9X A;  5DEQ A;  3SMD A;  1MP2 A;  3I7U A;  3Q2T A;  1F3Y A;  4KG4 A;  3I9X A;  3ACA A;  3CNG A;  3FCM A;  5DD4 A;  5GHJ A;  2A8Q A;  2CZR A;  1V8T A;  2I8T A;  3L85 A;  4DYW A;  4J7G A;  1VHG A;  3X0I A;  1MR2 A;  1GA7 A;  1VHZ A;  3A6V A;  2YVO A;  2PQV A;  3O6Z A;  1KT9 A;  2I8U A;  1HZT A;  1NQZ A;  3AC9 A;  3GZ5 A;  4KTB A;  2RRK A;  2VNP A;  4C9W A;  3GZ8 A;  1QVJ A;  3P6Y A;  3ID9 A;  1NFZ A;  1G0S A;  4S2X A;  1X84 A;  1SU2 A;  2ICK A;  3O69 A;  1PUQ A;  3KVH A;  3MGM A;  4HFQ A;  1RRS A;  4IJX A;  1JKN A;  2DSD A;  2KDW A;  4NFX A;  2XSQ A;  1Q54 A;  2YVP A;  4JZS A;  3SHD A;  5FSI A;  3X0Q A;  2YYH A;  2Q9P A;  2GB5 A;  5GHO A;  5C8L A;  3X0J A;  3G0Q A;  1X83 A;  3FK9 A;  1MQW A;  4V14 A;  5C7T A;  2G73 A;  1MK1 A;  2VNQ A;  3EEU A;  3O8S A;  1VIQ A;  2W4E A;  5CFJ A;  3EES A;  2JVB A;  2YVM A;  4JZT A;  3U53 A;  1RRQ A;  5FSL A;  2ICJ A;  3E57 A;  2FKB A;  5CFI A;  3Q4I A;  4N1U A;  2A8R A;  5C7Q A;  1PVF A;  4YPH A;  3X0S A;  2YVN A;  3DKU A;  3HHJ A;  5GHI A;  2QJT A;  3GWY A;  2A8T A;  1R67 A;  4NFW A;  5DDG A;  2O5W A;  3Q93 A;  5IW5 A;  2DHO A;  1V8V A;  3N9U A;  2O5F A;  4KG3 A;  2DUK A;  1PPW A;  3BAP A;  4S2V A;  1SJY A;  3COU A;  1Q27 A;  1RYA A;  3A6S A;  2PNY A;  3Q1P A;  1VRL A;  5LPG A;  1XSA A;  3F13 A;  1VCD A;  3I7V A;  1PUS A;  1SZ3 A;  3N77 A;  1HX3 A;  5GHN A;  3O52 A;  3GRN A;  3ZR0 A;  1TUM A;  3F6A A;  2KDV A;  1MQE A;  3FFU A;  1I9A A;  3H95 A;  3X0N A;  3FJY A;  3GG6 A;  2AZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...