4TKPB

Complex of ubc13 with the ring domain of the trim5alpha retroviral restriction factor
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
78
structure length
63
Chain Sequence
ILLNVKEEVTCPICLELLTEPLSLHCGHSFCQACISCPVCRISYQPENIQPNRHVANIVEKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activation of the Ubc13-Ub adduct by the RING domain of the TRIM5alpha retroviral restriction factor offers insight into the mechanism of molecular pattern recognition by TRIM proteins
rcsb
molecule keywords Ubiquitin-conjugating enzyme E2 N
molecule tags Ligase
source organism Homo sapiens
total genus 18
structure length 63
sequence length 78
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13445 zf-RING_UBOX RING-type zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4tkpB00
3KNVA 2C2VS 4P5OB 5B79A 5TBNA 2KYUA 4L7XA 3O34A 4A4BA 2YHNA 4QF3A 4FO9A 2LGVA 2VNFA 3HTKC 4YAXA 3EB5A 5LCWB 4AYCA 5H9MA 2HDPA 3ZVYA 2QIZA 1JM7A 4YBTA 2FSAA 3ZPVE 2QICA 2AN6A 2L0BA 2D8SA 4A4CA 1X4IA 5EYAF 1VYXA 3N9OA 3SHBA 4ZQLA 2XEUA 2H0DA 2KWOA 2LDRA 4QF2A 2G43A 4AYCB 5DINA 3M99A 2EGPA 2F6NA 2K4DA 2UZGA 5G05B 2G6QA 4AVXA 2FUUA 2VP7A 5JG6A 1CHCA 5FERA 1DVPA 2VJFA 4R2YA 2MNYA 2PNXA 2Y1MA 3N9NA 3DQVR 2LGKA 4WZ3B 2KE1A 3IHPA 4XI1A 4I7DA 4UP5A 2LGLA 2KGIA 4LADB 2C2LA 2YT5A 1F62A 2YREA 2ECNA 1T1HA 5KH9A 1WEMA 3ASLA 4LLBA 3HCTA 2CKLB 5AITA 2JMJA 3NG2A 5TDWA 4CCGX 3RTRB 3KV6A 4FIPA 2QJ0A 2CSYA 2EODA 3O35A 3U5PA 3O37A 1WILA 4O64A 3O36A 3KQIA 2IDAA 3SOWA 4UP0A 2KR4A 1WGMA 2G45A 4I7CA 3LQHA 2RSDA 3HCSA 2HYED 1VFYA 3DPLR 2RI7A 1E4UA 4LKAA 4N3WA 2ECJA 2ECTA 3PURA 2ECIA 3MHSA 4IC3A 2YSMA 5AIUA 5H1TA 2LQ6A 4BHWA 5KH7A 2I50A 3SOXA 3N9LA 3C6WA 5G0FA 1WEEA 4NN2A 4N4FA 2YQLA 4B86C 1WEUA 4YADA 2YW8A 3C5KA 2KREA 4AUQB 2LXPC 1WESA 5B78A 2DX8A 5B75A 2L75A 1JM7B 2MUMA 1FBVA 5B8DA 5KH3A 3RPGB 1V87A 5LKUA 1WEWA 2VPGA 2Y43A 5LKTA 2H0DB 1XWHA 2LV9A 3U5NA 4WA6A 1WENA 3M63A 1WEOA 3GV4A 3ZYQA 2BAYA 1IYMA 1X4JA 3U5MA 2E6RA 3GL6A 1LDJB 3N9PA 2L80A 4S3OC 2JMIA 1HYIA 2F42A 1K2FA 3L1XA 2E6SA 2NAAA 3HCUA 1RMDA 4W4UA 2K16A 2OXQC 2VJFB 3PUQA 4YBMA 2Y1NA 3N9MA 5DKAA 2LN0A 2ECVA 2YSJA 4YATA 5FB0A 2CSZA 2M1RA 2MD8C 2YYRA 4PTBA 4ZUXU 5C11A 1HYJA 2YQMA 2MA5A 2JRJA 1MM2A 1Z6UA 2YHOA 4TKPB 2M85A 5FB1A 3I2DA 4PPEA 2ZETC 1Z2QA 3L1ZB 3ZVZB 4F52B 4V3KC 4ZDTA 2XB1A 3LQIA 5C13A 4R7EA 2YUCA 3T6RA 2MT5A 3T7LA 5H1VA 1X4UA 3PHDA 5FEYA 4A49A 1WEVA 3L11A 2YU4A 4V3LC 2KWJA 5TABA 2K17A 2K1JA 3MHHA 4GNGA 5B76A 4FJCA 2MA6A 4BBQA 2M3HA 2L5UA 5D1KB 3M62A 3ZTGA 4IC2A 4A0CD 1LDKC 1VD4A 1Z60A 2VJEA 5J3XA 3QZVA 1WFKA 2ECWA 5D1LB 2L43A 3RPGC 1WE9A 3V43A 3ZNIA 2PUYA 2LGGA 3FL2A 4YABA 3O7AA 5H1UA 3N9QA 4WZ2A 2JMDA 2VJEB 4YC9A 4MVTA 1FP0A 2VPEA 2LRIC 5TDRA 5TRBA 4FK5A 5LKXA 3VK6A 5LKZA 4UI9B 4LK9A 1ZBDB 2VPDA 4LJNA 1JOCA 3ZPV1 2KFTA 2EA6A 2MIQA 4GNEA 2VPBA 1N87A 3O33A 4AP4A 4Q6FA 2CKLA 2LXHC 2KWKA 4I7BA 3SOUA 4S3OB 4X3GA 1WEQA 2FUIA 2CT2A 1BORA 3LRQA 1WEPA 4C9ZA 3KV5A 3O70A 4GNDA 4WZ0A 5G04B 5I3LA 1WIMA 4GB0A 4MSXA 2KGGA 2M6MA 2MNZA 4L58A 2KIZA 5D1MB 4R8PK 2ECGA 2YURA 4YBSA 2KU3A 4GNFA 3U5OA 4CA1A 3EB6A 2KWNA 3LQJA 2F6JA 1U6GB 1MM3A 4B7YC 1G25A 2MD7B 5B77A
chains in the Genus database with same CATH superfamily
3KNVA 2C2VS 4P5OB 5B79A 4O62A 5TBNA 2KYUA 4L7XA 3FJUB 3O34A 4A4BA 2YHNA 4QF3A 4FO9A 2LGVA 2VNFA 3HTKC 4YAXA 3EB5A 5LCWB 4AYCA 5H9MA 2HDPA 3ZVYA 2QIZA 1JM7A 4YBTA 2FSAA 3FAOA 3ZPVE 2QICA 2AN6A 2L0BA 2D8SA 4A4CA 1X4IA 5EYAF 1VYXA 3N9OA 3SHBA 3MDBC 4ZQLA 2XEUA 2H0DA 2KWOA 2LDRA 4QF2A 2G43A 4AYCB 2OWAA 5DINA 4Z0RA 3M99A 2EGPA 2FFWA 2F6NA 2K4DA 2UZGA 2YVRA 5G05B 2G6QA 4AVXA 2FUUA 2VP7A 5JG6A 4H9DA 1CHCA 5FERA 1DVPA 2VJFA 1MBMA 4R2YA 2MNYA 2PNXA 2Y1MA 3N9NA 3DQVR 2LGKA 4WZ3B 3KDEC 2CSVA 2KE1A 3IHPA 4XI1A 4I7DA 4UP5A 2LGLA 2KGIA 4LADB 2C2LA 2YT5A 1F62A 2YREA 2ECNA 2CONA 1T1HA 5KH9A 1WEMA 3SUBA 3ASLA 3LJUX 4LLBA 3HCTA 2CKLB 5AITA 3T9KA 2JMJA 3NG2A 5TDWA 4CCGX 3RTRB 3KV6A 4FIPA 2QJ0A 2CSYA 2EODA 3FANA 1DCQA 2XOYA 3O35A 3U5PA 3E2DA 3O37A 1WILA 4O64A 3O36A 3KQIA 2IDAA 3SOWA 4UP0A 2KR4A 1WGMA 2G45A 4I7CA 3LQHA 2RSDA 3HCSA 2HYED 1VFYA 3DPLR 2RI7A 4OGEA 3O47A 4LKAA 1E4UA 3PLWA 2ECJA 4N3WA 2ECTA 3PURA 2ECIA 3MHSA 5SVXA 3DWDA 5SVIB 4IC3A 2YSMA 5AIUA 5H1TA 2LQ6A 4BHWA 3Q1DA 5KH7A 2I50A 3SOXA 3N9LA 3C6WA 5G0FA 1WEEA 4NN2A 4N4FA 2YQLA 4B86C 1WEUA 4YADA 2YW8A 3C5KA 2KREA 4AUQB 2LXPC 1WESA 5B78A 3LDYA 2DX8A 5B75A 2M13A 2L75A 1JM7B 2L7PA 2MUMA 1FBVA 5B8DA 5KH3A 2XP0A 3RPGB 1V87A 5LKUA 1WEWA 2EGMA 2VPGA 2Y43A 5K3QA 5LKTA 2CRRA 2H0DB 1XWHA 2IQJA 3JUEA 2E61A 2LV9A 3U5NA 4WA6A 1WENA 3M63A 1WEOA 3GV4A 3ZYQA 2BAYA 1IYMA 1X4JA 3U5MA 2E6RA 3GL6A 1LDJB 3N9PA 2L80A 4S3OC 2JMIA 1HYIA 2F42A 1K2FA 3L1XA 2E6SA 2NAAA 3HCUA 1RMDA 4W4UA 2K16A 2OXQC 2VJFB 3PUQA 4YBMA 2Y1NA 2D8UA 2JUNA 3N9MA 5DKAA 2LN0A 2ECVA 2YSJA 4YATA 5FB0A 2CSZA 3LVQE 2M1RA 2YYRA 4QQ4A 2MD8C 4PTBA 4ZUXU 5C11A 1HYJA 2YQMA 2MA5A 2JRJA 1MM2A 1Z6UA 2YHOA 4TKPB 2M85A 2P57A 2LAUA 5FB1A 3H7HA 3I2DA 4PPEA 2ZETC 1Z2QA 3L1ZB 3ZVZB 4F52B 4V3KC 4ZDTA 2XB1A 3LQIA 5C13A 4R7EA 2YUCA 3T6RA 2MT5A 3T7LA 5H1VA 1X4UA 3PHDA 5FEYA 4A49A 1WEVA 3L11A 2YU4A 4V3LC 2KWJA 5TABA 3DDTA 2K17A 2K1JA 3MHHA 4GNGA 5B76A 4FJCA 2MA6A 4BBQA 2M3HA 2L5UA 5D1KB 3M62A 3ZTGA 4IC2A 4A0CD 1LDKC 1VD4A 1Z60A 2VJEA 5J3XA 3QZVA 2XOCA 1WFKA 2ECWA 2DJAA 2JM3A 5D1LB 2L43A 3RPGC 1WE9A 3V43A 3ZNIA 2PUYA 2LGGA 3FL2A 4YABA 3O7AA 5H1UA 3N9QA 4WZ2A 2JMDA 2VJEB 4YC9A 4MVTA 1FP0A 2VPEA 3M7KA 2LRIC 5TDRA 5TRBA 2DSMA 4FK5A 5LKXA 3VK6A 5LKZA 2FD4A 2MKEA 4UI9B 4LK9A 1ZBDB 2VPDA 4LJNA 1JOCA 3ZPV1 2KFTA 2EA6A 2MIQA 4GNEA 2VPBA 2KKXA 1N87A 3O33A 2XOZA 4AP4A 4Q6FA 4OGCA 3FEHA 2CKLA 2LXHC 2B0OE 2KWKA 2RR4A 4I7BA 3SOUA 4S3OB 3FM8C 4X3GA 1WEQA 2FUIA 2CT2A 4Z0OA 1BORA 3LRQA 1WEPA 4C9ZA 3KV5A 3O70A 4GNDA 2EXUA 4WZ0A 5G04B 5I3LA 1WIMA 4GB0A 4MSXA 2KGGA 2M6MA 2MNZA 4L58A 2KIZA 5D1MB 4R8PK 2ECGA 3LVRE 5SVIA 2KKYA 2YURA 4YBSA 2KU3A 4F1PA 4GNFA 2CRWA 3U5OA 4CA1A 3EB6A 2KWNA 3LQJA 2F6JA 5SVYA 1U6GB 1MM3A 4B7YC 1G25A 2MD7B 5B77A
chains in the Genus database with same CATH topology
3KNVA 2C2VS 4P5OB 5B79A 5TBNA 2KYUA 4L7XA 3O34A 4A4BA 2YHNA 4QF3A 4FO9A 2LGVA 2VNFA 3HTKC 4YAXA 3EB5A 5LCWB 4AYCA 5H9MA 2HDPA 3ZVYA 2QIZA 1JM7A 4YBTA 2FSAA 3ZPVE 2QICA 2AN6A 2L0BA 2D8SA 4A4CA 1X4IA 5EYAF 1VYXA 3N9OA 3SHBA 4ZQLA 2XEUA 2H0DA 2KWOA 2LDRA 4QF2A 2G43A 4AYCB 5DINA 3M99A 2EGPA 2F6NA 2K4DA 2UZGA 5G05B 2G6QA 4AVXA 2FUUA 2VP7A 5JG6A 1CHCA 5FERA 1DVPA 2VJFA 4R2YA 2MNYA 2PNXA 2Y1MA 3N9NA 3DQVR 2LGKA 4WZ3B 2KE1A 3IHPA 4XI1A 4I7DA 4UP5A 2LGLA 2KGIA 4LADB 2C2LA 2YT5A 1F62A 2YREA 2ECNA 1T1HA 5KH9A 1WEMA 3ASLA 4LLBA 3HCTA 2CKLB 5AITA 2JMJA 3NG2A 5TDWA 4CCGX 3RTRB 3KV6A 4FIPA 2QJ0A 2CSYA 2EODA 3O35A 3U5PA 3O37A 1WILA 4O64A 3O36A 3KQIA 2IDAA 3SOWA 4UP0A 2KR4A 1WGMA 2G45A 4I7CA 3LQHA 2RSDA 3HCSA 2HYED 1VFYA 3DPLR 2RI7A 1E4UA 4LKAA 4N3WA 2ECJA 2ECTA 3PURA 2ECIA 3MHSA 4IC3A 2YSMA 5AIUA 5H1TA 2LQ6A 4BHWA 5KH7A 2I50A 3SOXA 3N9LA 3C6WA 5G0FA 1WEEA 4NN2A 4N4FA 2YQLA 4B86C 1WEUA 4YADA 2YW8A 3C5KA 2KREA 4AUQB 2LXPC 1WESA 5B78A 2DX8A 5B75A 2L75A 1JM7B 2MUMA 1FBVA 5B8DA 5KH3A 3RPGB 1V87A 5LKUA 1WEWA 2VPGA 2Y43A 5LKTA 2H0DB 1XWHA 2LV9A 3U5NA 4WA6A 1WENA 3M63A 1WEOA 3GV4A 3ZYQA 2BAYA 1IYMA 1X4JA 3U5MA 2E6RA 3GL6A 1LDJB 3N9PA 2L80A 4S3OC 2JMIA 1HYIA 2F42A 1K2FA 3L1XA 2E6SA 2NAAA 3HCUA 1RMDA 4W4UA 2K16A 2OXQC 2VJFB 3PUQA 4YBMA 2Y1NA 3N9MA 5DKAA 2LN0A 2ECVA 2YSJA 4YATA 5FB0A 2CSZA 2M1RA 2MD8C 2YYRA 4PTBA 4ZUXU 5C11A 1HYJA 2YQMA 2MA5A 2JRJA 1MM2A 1Z6UA 2YHOA 4TKPB 2M85A 5FB1A 3I2DA 4PPEA 2ZETC 1Z2QA 3L1ZB 3ZVZB 4F52B 4V3KC 4ZDTA 2XB1A 3LQIA 5C13A 4R7EA 2YUCA 3T6RA 2MT5A 3T7LA 5H1VA 1X4UA 3PHDA 5FEYA 4A49A 1WEVA 3L11A 2YU4A 4V3LC 2KWJA 5TABA 2K17A 2K1JA 3MHHA 4GNGA 5B76A 4FJCA 2MA6A 4BBQA 2M3HA 2L5UA 5D1KB 3M62A 3ZTGA 4IC2A 4A0CD 1LDKC 1VD4A 1Z60A 2VJEA 5J3XA 3QZVA 1WFKA 2ECWA 5D1LB 2L43A 3RPGC 1WE9A 3V43A 3ZNIA 2PUYA 2LGGA 3FL2A 4YABA 3O7AA 5H1UA 3N9QA 4WZ2A 2JMDA 2VJEB 4YC9A 4MVTA 1FP0A 2VPEA 2LRIC 5TDRA 5TRBA 4FK5A 5LKXA 3VK6A 5LKZA 4UI9B 4LK9A 1ZBDB 2VPDA 4LJNA 1JOCA 3ZPV1 2KFTA 2EA6A 2MIQA 4GNEA 2VPBA 1N87A 3O33A 4AP4A 4Q6FA 2CKLA 2LXHC 2KWKA 4I7BA 3SOUA 4S3OB 4X3GA 1WEQA 2FUIA 2CT2A 1BORA 3LRQA 1WEPA 4C9ZA 3KV5A 3O70A 4GNDA 4WZ0A 5G04B 5I3LA 1WIMA 4GB0A 4MSXA 2KGGA 2M6MA 2MNZA 4L58A 2KIZA 5D1MB 4R8PK 2ECGA 2YURA 4YBSA 2KU3A 4GNFA 3U5OA 4CA1A 3EB6A 2KWNA 3LQJA 2F6JA 1U6GB 1MM3A 4B7YC 1G25A 2MD7B 5B77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KNV A;  2C2V S;  4P5O B;  5B79 A;  5TBN A;  2KYU A;  4L7X A;  3O34 A;  4A4B A;  2YHN A;  4QF3 A;  4FO9 A;  2LGV A;  2VNF A;  3HTK C;  4YAX A;  3EB5 A;  5LCW B;  4AYC A;  5H9M A;  2HDP A;  3ZVY A;  2QIZ A;  1JM7 A;  4YBT A;  2FSA A;  3ZPV E;  2QIC A;  2AN6 A;  2L0B A;  2D8S A;  4A4C A;  1X4I A;  5EYA F;  1VYX A;  3N9O A;  3SHB A;  4ZQL A;  2XEU A;  2H0D A;  2KWO A;  2LDR A;  4QF2 A;  2G43 A;  4AYC B;  5DIN A;  3M99 A;  2EGP A;  2F6N A;  2K4D A;  2UZG A;  5G05 B;  2G6Q A;  4AVX A;  2FUU A;  2VP7 A;  5JG6 A;  1CHC A;  5FER A;  1DVP A;  2VJF A;  4R2Y A;  2MNY A;  2PNX A;  2Y1M A;  3N9N A;  3DQV R;  2LGK A;  4WZ3 B;  2KE1 A;  3IHP A;  4XI1 A;  4I7D A;  4UP5 A;  2LGL A;  2KGI A;  4LAD B;  2C2L A;  2YT5 A;  1F62 A;  2YRE A;  2ECN A;  1T1H A;  5KH9 A;  1WEM A;  3ASL A;  4LLB A;  3HCT A;  2CKL B;  5AIT A;  2JMJ A;  3NG2 A;  5TDW A;  4CCG X;  3RTR B;  3KV6 A;  4FIP A;  2QJ0 A;  2CSY A;  2EOD A;  3O35 A;  3U5P A;  3O37 A;  1WIL A;  4O64 A;  3O36 A;  3KQI A;  2IDA A;  3SOW A;  4UP0 A;  2KR4 A;  1WGM A;  2G45 A;  4I7C A;  3LQH A;  2RSD A;  3HCS A;  2HYE D;  1VFY A;  3DPL R;  2RI7 A;  1E4U A;  4LKA A;  4N3W A;  2ECJ A;  2ECT A;  3PUR A;  2ECI A;  3MHS A;  4IC3 A;  2YSM A;  5AIU A;  5H1T A;  2LQ6 A;  4BHW A;  5KH7 A;  2I50 A;  3SOX A;  3N9L A;  3C6W A;  5G0F A;  1WEE A;  4NN2 A;  4N4F A;  2YQL A;  4B86 C;  1WEU A;  4YAD A;  2YW8 A;  3C5K A;  2KRE A;  4AUQ B;  2LXP C;  1WES A;  5B78 A;  2DX8 A;  5B75 A;  2L75 A;  1JM7 B;  2MUM A;  1FBV A;  5B8D A;  5KH3 A;  3RPG B;  1V87 A;  5LKU A;  1WEW A;  2VPG A;  2Y43 A;  5LKT A;  2H0D B;  1XWH A;  2LV9 A;  3U5N A;  4WA6 A;  1WEN A;  3M63 A;  1WEO A;  3GV4 A;  3ZYQ A;  2BAY A;  1IYM A;  1X4J A;  3U5M A;  2E6R A;  3GL6 A;  1LDJ B;  3N9P A;  2L80 A;  4S3O C;  2JMI A;  1HYI A;  2F42 A;  1K2F A;  3L1X A;  2E6S A;  2NAA A;  3HCU A;  1RMD A;  4W4U A;  2K16 A;  2OXQ C;  2VJF B;  3PUQ A;  4YBM A;  2Y1N A;  3N9M A;  5DKA A;  2LN0 A;  2ECV A;  2YSJ A;  4YAT A;  5FB0 A;  2CSZ A;  2M1R A;  2MD8 C;  2YYR A;  4PTB A;  4ZUX U;  5C11 A;  1HYJ A;  2YQM A;  2MA5 A;  2JRJ A;  1MM2 A;  1Z6U A;  2YHO A;  4TKP B;  2M85 A;  5FB1 A;  3I2D A;  4PPE A;  2ZET C;  1Z2Q A;  3L1Z B;  3ZVZ B;  4F52 B;  4V3K C;  4ZDT A;  2XB1 A;  3LQI A;  5C13 A;  4R7E A;  2YUC A;  3T6R A;  2MT5 A;  3T7L A;  5H1V A;  1X4U A;  3PHD A;  5FEY A;  4A49 A;  1WEV A;  3L11 A;  2YU4 A;  4V3L C;  2KWJ A;  5TAB A;  2K17 A;  2K1J A;  3MHH A;  4GNG A;  5B76 A;  4FJC A;  2MA6 A;  4BBQ A;  2M3H A;  2L5U A;  5D1K B;  3M62 A;  3ZTG A;  4IC2 A;  4A0C D;  1LDK C;  1VD4 A;  1Z60 A;  2VJE A;  5J3X A;  3QZV A;  1WFK A;  2ECW A;  5D1L B;  2L43 A;  3RPG C;  1WE9 A;  3V43 A;  3ZNI A;  2PUY A;  2LGG A;  3FL2 A;  4YAB A;  3O7A A;  5H1U A;  3N9Q A;  4WZ2 A;  2JMD A;  2VJE B;  4YC9 A;  4MVT A;  1FP0 A;  2VPE A;  2LRI C;  5TDR A;  5TRB A;  4FK5 A;  5LKX A;  3VK6 A;  5LKZ A;  4UI9 B;  4LK9 A;  1ZBD B;  2VPD A;  4LJN A;  1JOC A;  3ZPV 1;  2KFT A;  2EA6 A;  2MIQ A;  4GNE A;  2VPB A;  1N87 A;  3O33 A;  4AP4 A;  4Q6F A;  2CKL A;  2LXH C;  2KWK A;  4I7B A;  3SOU A;  4S3O B;  4X3G A;  1WEQ A;  2FUI A;  2CT2 A;  1BOR A;  3LRQ A;  1WEP A;  4C9Z A;  3KV5 A;  3O70 A;  4GND A;  4WZ0 A;  5G04 B;  5I3L A;  1WIM A;  4GB0 A;  4MSX A;  2KGG A;  2M6M A;  2MNZ A;  4L58 A;  2KIZ A;  5D1M B;  4R8P K;  2ECG A;  2YUR A;  4YBS A;  2KU3 A;  4GNF A;  3U5O A;  4CA1 A;  3EB6 A;  2KWN A;  3LQJ A;  2F6J A;  1U6G B;  1MM3 A;  4B7Y C;  1G25 A;  2MD7 B;  5B77 A; 
#chains in the Genus database with same CATH topology
 3KNV A;  2C2V S;  4P5O B;  5B79 A;  4O62 A;  5TBN A;  2KYU A;  4L7X A;  3FJU B;  3O34 A;  4A4B A;  2YHN A;  4QF3 A;  4FO9 A;  2LGV A;  2VNF A;  3HTK C;  4YAX A;  3EB5 A;  5LCW B;  4AYC A;  5H9M A;  2HDP A;  3ZVY A;  2QIZ A;  1JM7 A;  4YBT A;  2FSA A;  3FAO A;  3ZPV E;  2QIC A;  2AN6 A;  2L0B A;  2D8S A;  4A4C A;  1X4I A;  5EYA F;  1VYX A;  3N9O A;  3SHB A;  3MDB C;  4ZQL A;  2XEU A;  2H0D A;  2KWO A;  2LDR A;  4QF2 A;  2G43 A;  4AYC B;  2OWA A;  5DIN A;  4Z0R A;  3M99 A;  2EGP A;  2FFW A;  2F6N A;  2K4D A;  2UZG A;  2YVR A;  5G05 B;  2G6Q A;  4AVX A;  2FUU A;  2VP7 A;  5JG6 A;  4H9D A;  1CHC A;  5FER A;  1DVP A;  2VJF A;  1MBM A;  4R2Y A;  2MNY A;  2PNX A;  2Y1M A;  3N9N A;  3DQV R;  2LGK A;  4WZ3 B;  3KDE C;  2CSV A;  2KE1 A;  3IHP A;  4XI1 A;  4I7D A;  4UP5 A;  2LGL A;  2KGI A;  4LAD B;  2C2L A;  2YT5 A;  1F62 A;  2YRE A;  2ECN A;  2CON A;  1T1H A;  5KH9 A;  1WEM A;  3SUB A;  3ASL A;  3LJU X;  4LLB A;  3HCT A;  2CKL B;  5AIT A;  3T9K A;  2JMJ A;  3NG2 A;  5TDW A;  4CCG X;  3RTR B;  3KV6 A;  4FIP A;  2QJ0 A;  2CSY A;  2EOD A;  3FAN A;  1DCQ A;  2XOY A;  3O35 A;  3U5P A;  3E2D A;  3O37 A;  1WIL A;  4O64 A;  3O36 A;  3KQI A;  2IDA A;  3SOW A;  4UP0 A;  2KR4 A;  1WGM A;  2G45 A;  4I7C A;  3LQH A;  2RSD A;  3HCS A;  2HYE D;  1VFY A;  3DPL R;  2RI7 A;  4OGE A;  3O47 A;  4LKA A;  1E4U A;  3PLW A;  2ECJ A;  4N3W A;  2ECT A;  3PUR A;  2ECI A;  3MHS A;  5SVX A;  3DWD A;  5SVI B;  4IC3 A;  2YSM A;  5AIU A;  5H1T A;  2LQ6 A;  4BHW A;  3Q1D A;  5KH7 A;  2I50 A;  3SOX A;  3N9L A;  3C6W A;  5G0F A;  1WEE A;  4NN2 A;  4N4F A;  2YQL A;  4B86 C;  1WEU A;  4YAD A;  2YW8 A;  3C5K A;  2KRE A;  4AUQ B;  2LXP C;  1WES A;  5B78 A;  3LDY A;  2DX8 A;  5B75 A;  2M13 A;  2L75 A;  1JM7 B;  2L7P A;  2MUM A;  1FBV A;  5B8D A;  5KH3 A;  2XP0 A;  3RPG B;  1V87 A;  5LKU A;  1WEW A;  2EGM A;  2VPG A;  2Y43 A;  5K3Q A;  5LKT A;  2CRR A;  2H0D B;  1XWH A;  2IQJ A;  3JUE A;  2E61 A;  2LV9 A;  3U5N A;  4WA6 A;  1WEN A;  3M63 A;  1WEO A;  3GV4 A;  3ZYQ A;  2BAY A;  1IYM A;  1X4J A;  3U5M A;  2E6R A;  3GL6 A;  1LDJ B;  3N9P A;  2L80 A;  4S3O C;  2JMI A;  1HYI A;  2F42 A;  1K2F A;  3L1X A;  2E6S A;  2NAA A;  3HCU A;  1RMD A;  4W4U A;  2K16 A;  2OXQ C;  2VJF B;  3PUQ A;  4YBM A;  2Y1N A;  2D8U A;  2JUN A;  3N9M A;  5DKA A;  2LN0 A;  2ECV A;  2YSJ A;  4YAT A;  5FB0 A;  2CSZ A;  3LVQ E;  2M1R A;  2YYR A;  4QQ4 A;  2MD8 C;  4PTB A;  4ZUX U;  5C11 A;  1HYJ A;  2YQM A;  2MA5 A;  2JRJ A;  1MM2 A;  1Z6U A;  2YHO A;  4TKP B;  2M85 A;  2P57 A;  2LAU A;  5FB1 A;  3H7H A;  3I2D A;  4PPE A;  2ZET C;  1Z2Q A;  3L1Z B;  3ZVZ B;  4F52 B;  4V3K C;  4ZDT A;  2XB1 A;  3LQI A;  5C13 A;  4R7E A;  2YUC A;  3T6R A;  2MT5 A;  3T7L A;  5H1V A;  1X4U A;  3PHD A;  5FEY A;  4A49 A;  1WEV A;  3L11 A;  2YU4 A;  4V3L C;  2KWJ A;  5TAB A;  3DDT A;  2K17 A;  2K1J A;  3MHH A;  4GNG A;  5B76 A;  4FJC A;  2MA6 A;  4BBQ A;  2M3H A;  2L5U A;  5D1K B;  3M62 A;  3ZTG A;  4IC2 A;  4A0C D;  1LDK C;  1VD4 A;  1Z60 A;  2VJE A;  5J3X A;  3QZV A;  2XOC A;  1WFK A;  2ECW A;  2DJA A;  2JM3 A;  5D1L B;  2L43 A;  3RPG C;  1WE9 A;  3V43 A;  3ZNI A;  2PUY A;  2LGG A;  3FL2 A;  4YAB A;  3O7A A;  5H1U A;  3N9Q A;  4WZ2 A;  2JMD A;  2VJE B;  4YC9 A;  4MVT A;  1FP0 A;  2VPE A;  3M7K A;  2LRI C;  5TDR A;  5TRB A;  2DSM A;  4FK5 A;  5LKX A;  3VK6 A;  5LKZ A;  2FD4 A;  2MKE A;  4UI9 B;  4LK9 A;  1ZBD B;  2VPD A;  4LJN A;  1JOC A;  3ZPV 1;  2KFT A;  2EA6 A;  2MIQ A;  4GNE A;  2VPB A;  2KKX A;  1N87 A;  3O33 A;  2XOZ A;  4AP4 A;  4Q6F A;  4OGC A;  3FEH A;  2CKL A;  2LXH C;  2B0O E;  2KWK A;  2RR4 A;  4I7B A;  3SOU A;  4S3O B;  3FM8 C;  4X3G A;  1WEQ A;  2FUI A;  2CT2 A;  4Z0O A;  1BOR A;  3LRQ A;  1WEP A;  4C9Z A;  3KV5 A;  3O70 A;  4GND A;  2EXU A;  4WZ0 A;  5G04 B;  5I3L A;  1WIM A;  4GB0 A;  4MSX A;  2KGG A;  2M6M A;  2MNZ A;  4L58 A;  2KIZ A;  5D1M B;  4R8P K;  2ECG A;  3LVR E;  5SVI A;  2KKY A;  2YUR A;  4YBS A;  2KU3 A;  4F1P A;  4GNF A;  2CRW A;  3U5O A;  4CA1 A;  3EB6 A;  2KWN A;  3LQJ A;  2F6J A;  5SVY A;  1U6G B;  1MM3 A;  4B7Y C;  1G25 A;  2MD7 B;  5B77 A; 
#chains in the Genus database with same CATH homology
 3KNV A;  2C2V S;  4P5O B;  5B79 A;  5TBN A;  2KYU A;  4L7X A;  3O34 A;  4A4B A;  2YHN A;  4QF3 A;  4FO9 A;  2LGV A;  2VNF A;  3HTK C;  4YAX A;  3EB5 A;  5LCW B;  4AYC A;  5H9M A;  2HDP A;  3ZVY A;  2QIZ A;  1JM7 A;  4YBT A;  2FSA A;  3ZPV E;  2QIC A;  2AN6 A;  2L0B A;  2D8S A;  4A4C A;  1X4I A;  5EYA F;  1VYX A;  3N9O A;  3SHB A;  4ZQL A;  2XEU A;  2H0D A;  2KWO A;  2LDR A;  4QF2 A;  2G43 A;  4AYC B;  5DIN A;  3M99 A;  2EGP A;  2F6N A;  2K4D A;  2UZG A;  5G05 B;  2G6Q A;  4AVX A;  2FUU A;  2VP7 A;  5JG6 A;  1CHC A;  5FER A;  1DVP A;  2VJF A;  4R2Y A;  2MNY A;  2PNX A;  2Y1M A;  3N9N A;  3DQV R;  2LGK A;  4WZ3 B;  2KE1 A;  3IHP A;  4XI1 A;  4I7D A;  4UP5 A;  2LGL A;  2KGI A;  4LAD B;  2C2L A;  2YT5 A;  1F62 A;  2YRE A;  2ECN A;  1T1H A;  5KH9 A;  1WEM A;  3ASL A;  4LLB A;  3HCT A;  2CKL B;  5AIT A;  2JMJ A;  3NG2 A;  5TDW A;  4CCG X;  3RTR B;  3KV6 A;  4FIP A;  2QJ0 A;  2CSY A;  2EOD A;  3O35 A;  3U5P A;  3O37 A;  1WIL A;  4O64 A;  3O36 A;  3KQI A;  2IDA A;  3SOW A;  4UP0 A;  2KR4 A;  1WGM A;  2G45 A;  4I7C A;  3LQH A;  2RSD A;  3HCS A;  2HYE D;  1VFY A;  3DPL R;  2RI7 A;  1E4U A;  4LKA A;  4N3W A;  2ECJ A;  2ECT A;  3PUR A;  2ECI A;  3MHS A;  4IC3 A;  2YSM A;  5AIU A;  5H1T A;  2LQ6 A;  4BHW A;  5KH7 A;  2I50 A;  3SOX A;  3N9L A;  3C6W A;  5G0F A;  1WEE A;  4NN2 A;  4N4F A;  2YQL A;  4B86 C;  1WEU A;  4YAD A;  2YW8 A;  3C5K A;  2KRE A;  4AUQ B;  2LXP C;  1WES A;  5B78 A;  2DX8 A;  5B75 A;  2L75 A;  1JM7 B;  2MUM A;  1FBV A;  5B8D A;  5KH3 A;  3RPG B;  1V87 A;  5LKU A;  1WEW A;  2VPG A;  2Y43 A;  5LKT A;  2H0D B;  1XWH A;  2LV9 A;  3U5N A;  4WA6 A;  1WEN A;  3M63 A;  1WEO A;  3GV4 A;  3ZYQ A;  2BAY A;  1IYM A;  1X4J A;  3U5M A;  2E6R A;  3GL6 A;  1LDJ B;  3N9P A;  2L80 A;  4S3O C;  2JMI A;  1HYI A;  2F42 A;  1K2F A;  3L1X A;  2E6S A;  2NAA A;  3HCU A;  1RMD A;  4W4U A;  2K16 A;  2OXQ C;  2VJF B;  3PUQ A;  4YBM A;  2Y1N A;  3N9M A;  5DKA A;  2LN0 A;  2ECV A;  2YSJ A;  4YAT A;  5FB0 A;  2CSZ A;  2M1R A;  2MD8 C;  2YYR A;  4PTB A;  4ZUX U;  5C11 A;  1HYJ A;  2YQM A;  2MA5 A;  2JRJ A;  1MM2 A;  1Z6U A;  2YHO A;  4TKP B;  2M85 A;  5FB1 A;  3I2D A;  4PPE A;  2ZET C;  1Z2Q A;  3L1Z B;  3ZVZ B;  4F52 B;  4V3K C;  4ZDT A;  2XB1 A;  3LQI A;  5C13 A;  4R7E A;  2YUC A;  3T6R A;  2MT5 A;  3T7L A;  5H1V A;  1X4U A;  3PHD A;  5FEY A;  4A49 A;  1WEV A;  3L11 A;  2YU4 A;  4V3L C;  2KWJ A;  5TAB A;  2K17 A;  2K1J A;  3MHH A;  4GNG A;  5B76 A;  4FJC A;  2MA6 A;  4BBQ A;  2M3H A;  2L5U A;  5D1K B;  3M62 A;  3ZTG A;  4IC2 A;  4A0C D;  1LDK C;  1VD4 A;  1Z60 A;  2VJE A;  5J3X A;  3QZV A;  1WFK A;  2ECW A;  5D1L B;  2L43 A;  3RPG C;  1WE9 A;  3V43 A;  3ZNI A;  2PUY A;  2LGG A;  3FL2 A;  4YAB A;  3O7A A;  5H1U A;  3N9Q A;  4WZ2 A;  2JMD A;  2VJE B;  4YC9 A;  4MVT A;  1FP0 A;  2VPE A;  2LRI C;  5TDR A;  5TRB A;  4FK5 A;  5LKX A;  3VK6 A;  5LKZ A;  4UI9 B;  4LK9 A;  1ZBD B;  2VPD A;  4LJN A;  1JOC A;  3ZPV 1;  2KFT A;  2EA6 A;  2MIQ A;  4GNE A;  2VPB A;  1N87 A;  3O33 A;  4AP4 A;  4Q6F A;  2CKL A;  2LXH C;  2KWK A;  4I7B A;  3SOU A;  4S3O B;  4X3G A;  1WEQ A;  2FUI A;  2CT2 A;  1BOR A;  3LRQ A;  1WEP A;  4C9Z A;  3KV5 A;  3O70 A;  4GND A;  4WZ0 A;  5G04 B;  5I3L A;  1WIM A;  4GB0 A;  4MSX A;  2KGG A;  2M6M A;  2MNZ A;  4L58 A;  2KIZ A;  5D1M B;  4R8P K;  2ECG A;  2YUR A;  4YBS A;  2KU3 A;  4GNF A;  3U5O A;  4CA1 A;  3EB6 A;  2KWN A;  3LQJ A;  2F6J A;  1U6G B;  1MM3 A;  4B7Y C;  1G25 A;  2MD7 B;  5B77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...