4U3FE

Cytochrome bc1 complex from chicken with designed inhibitor bound
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design of Highly Potent and Slow-Binding Cytochrome bc1 Inhibitor as Fungicide by Computational Substitution Optimization
doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 39
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2014-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 4u3fE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4u3fE02
2QJKC 4HM6A 3H1LE 4NBGD 3GOBA 4HM7A 3L75E 2NUMA 3H1KE 4QURA 2BMQA 4QDFA 3L71E 3VMGD 4QDFB 4PV1D 3GB4A 4NBBD 4NB8D 4HJLA 1L0NE 2B1XA 2HMKA 5AEWA 3GZYA 5KKZC 3L73E 1BCCE 3VMID 4HKVA 2E76D 2NVEA 2QJPC 3GL0A 2YIUC 4HM8A 3VMHD 4PD4E 1BE3E 1KYOE 1Q90C 1VM9A 3L72E 2BMOA 4H44D 2B24A 4NBCD 2QPZA 1UUVA 2DE6D 3GKEA 1RIEA 2BCCE 3L74E 2YVJB 1L0LE 4AIVA 3AZCA 4QUPA 3VCPA 4NBAD 3H1HE 1PP9E 3EQQA 1SQVE 1SQQE 3EN1A 4AAYB 2CKFA 3GTSA 1P84E 2IBZE 1SQBE 4NBED 5KLVE 2E75D 2NWFA 2E74D 4HM2A 1NDOA 4NBFD 1O7NA 4OGQD 1UUWA 1NTME 3CWBE 1NU1E 1JM1A 2NUKA 3H1JE 2A06E 1SJGA 2XSHA 2YFJA 4HM4A 1O7WA 4QDDA 1FQTA 1NTZE 1ULIA 2NVGA 4QDCA 3L70E 2NVFA 3D89A 2GBXA 4P1BH 4H0LD 2XSOA 2ZYLA 4HM3A 1WQLA 3BCCE 3TGUE 2JZAA 1O7HA 4QCKA 5BOKA 3VCAA 1KB9E 2YFIA 1O7PA 4NB9D 1G8JB 2I7FA 3N0QA 2ZT9D 4EMJB 5AEUA 3GZXA 1ZRTE 2BMRA 4U3FE 4D6TE 2HMLA 2YFLA 3DQYA 1BGYE 3FOUA 4HM1A 2D2CD 3GL2A 1ULJA 2E4PA 2FYNC 1NYKA 1SQPE 3GTEA 2XR8A 5KLIC 1EZVE 1EG9A 1VF5D 2GBWA 2DE5D 2XRXA 1VCKA 2JO6A 4HM0A 1O7MA 5CXMA 1SQXE 3C0DA 2QJYC 1O7GA 3H1IE 3CXHE 4NBHD 4NBDD 3GCEA 3CX5E 4P1CH 2HMJA 1G8KB 4QUQA 2E4QA 2Q3WA 4H13D 1NTKE 1PPJE 2FYUE 2HMMA 2DE7D 5HL4A 1RFSA 2HMNA 2HMOA 4HM5A
chains in the Genus database with same CATH superfamily
2Z5IA 4BWNA 4C7NB 3FWLA 3Q3DA 1JY3N 3CCQP 5AW4B 2YKOA 4N78D 2W27A 1VQOP 3KPEA 5CCHD 1NTMJ 2QVAA 3PTZA 2E42A 4Y99C 5CJ0A 5B66H 2W6AA 4LGDE 2E76D 1VM9A 4GOEA 1M1JB 2PAJA 3HD7C 3P8CE 1M1JA 2IBZE 2GM4A 3RK3E 3MTUE 1UUWA 3AE3C 2NVGA 3B71A 1WT6A 1FE6A 2O01J 4RO0A 2PRRA 3AECC 1URQA 1PPJG 5KAIE 3AE9C 3L71D 4I1LA 3ZDMA 2YFIA 3P8MC 5KLVD 2MJZA 1URQB 3GZXA 1VQ6P 2K3RA 2NPSA 2XZRA 3AEDC 1SQPE 1W5CE 2JR8A 2NRGA 2YKQA 2L91A 2H89C 3TF5A 1L4AC 3FWNA 3M0DA 1JMMA 4EYYQ 1FZCB 3HD7D 3CXHE 3HE5B 2Q3WA 4K3AA 2FFDC 1S72P 3Q5PA 3AE4C 3H1LE 4WWIA 1K73Q 2HR3A 2W6JH 5AW5B 2NUMA 3VMGD 4JPZB 4GDOA 3T97A 3GB4A 1JM0A 1PPJD 2KK7A 1LP1A 5APYA 2QJYB 4Z1MH 2WT7B 5AVQB 3B5ND 3RL0B 4C7NA 3GL0A 4HM8A 3CCVP 1VQMP 3E7KA 1KORA 3L72E 1M57D 1NJIQ 2BEZF 3P8CD 1J1EB 3AZCA 4WY4C 4QUPA 3VCPA 2R5DA 2CPSA 3D70A 1SQPK 3CL3D 3G3ZA 1N7LA 1H88A 2NWFA 4UB8H 4NBFD 4WB4A 2IZ1A 2LXCB 1PL5A 4R4MA 1ULIA 1U57A 1L0LJ 1IFIA 3KDPB 5AVRB 3BCCE 4N78E 2B88A 3CX5H 5BOKA 3CXHI 2B89A 1Q2NA 3L72G 1EC5A 3P32A 3UIAA 5AEUA 4B86A 2BMRA 2KS1B 4U3FE 4D6TE 1LTJC 3NTNA 5AW2B 1EXJA 1GL2D 5KLIC 1LTJB 3L75D 2GBWA 2KUBA 2JO6A 4HM0A 3KZIH 3RK3D 2K88A 2HMJA 4H44B 5TISE 2HMNA 3H25A 3SFEC 5AW3B 3VMYA 2BMQA 3L71E 1G2CB 4TT3H 1SQBJ 3D6ZA 1S5LE 2O01H 1K8AQ 1KZUB 4IL6H 5AEWA 1IFNA 2QJPC 3RBXA 3FGAD 4LC1A 1RF1B 2H8PD 2QM8A 3L36A 3N7NA 3P7KA 1DD4A 3V2PA 2ZYDA 1PP9E 3S1KA 1HBWA 2OYIA 3RK2D 1KTMA 4N6JA 4QUQA 1X8YA 2NPSB 1CW5A 1FS0E 4HJGH 1M90Q 2FXPA 3CWBG 2GUVA 4C7RA 4CPGA 1OFCX 1PGPA 5CCHA 1X22A 1AV1A 1BSNA 3L72D 1FZAA 4HM1A 1E79H 1MFTA 1RF0C 3O6QB 1PV3A 2XV5A 4DZOA 5APUA 2FYUK 3MIWA 1GK6A 3GCEA 1X0TA 1ZOYC 2K9JB 2Q1KA 1S9KE 2RH0A 2E74B 5DJUB 4IL6X 4HM7A 3H1KE 1A02J 1OVVA 5CMZA 1LT1A 1QL1A 3IF4A 1SQQG 3EFFK 2V7QH 3MHVA 1HH0A 1T3UA 4U3FD 4D6TD 1FZGA 3HE4B 1ZW0A 3L37A 1IFDA 4H44D 3V2RA 4MN4C 3PLNA 4O9BA 2OQQA 2IBZI 1KILA 1X9VA 1SQXK 3RK3B 1RE4C 1S5LX 2K1AA 1GU5A 2KYVA 3AEBC 5APXA 1KMIZ 3PHLA 4HM2A 1NDOA 1LWUB 5CCGC 1LWUA 2WWWA 2G8YA 3CWBE 1HJ0A 2B9BA 3L70D 4PD4H 1KYOH 2J58A 4YPCA 1VQ8P 2QG4A 2E43A 1H8AA 4JYBA 1G8JB 1RF0A 2W83C 3N0QA 1TU3F 3IN6A 2WSCJ 2BASA 4OGQB 3WMM0 4NPFX 3L75G 1GL2B 1OXZA 1KB9H 5CCGD 5TISH 4PV1C 1S9KD 1NU1G 3L70G 1KQGB 3CX5I 3H1JD 2ZAEB 3V6IA 4H13C 1HGVA 1MUUA 4XFJA 2KSEA 2O01N 3GZYA 2OYHA 2RKLA 1JTHB 1LT9C 2D2CC 1HF9A 3F5HA 2HLOA 4U3FG 4D6TG 2KZIA 2N1TD 1IFMA 2ZT9C 3H1LG 1YJNP 3CXHH 1T2KC 2A45H 3CD6P 5KAIH 1QX8A 3HUSB 3CWBD 1SLQA 1NTME 4QDDA 3GF7A 2WSFH 3L70E 2HFED 3AEFC 1SQPG 2E76C 3A2AA 1RE3A 1J2JB 2XU6A 2JP3A 1SQXD 1RY3A 1YHQP 1G2CA 1FJPA 1FBMA 1SVFA 4EI2A 1DX7A 2YFLA 3H1IJ 5BU8B 4A7PA 1NOHA 1OZHA 5APWA 2XR8A 5GTHH 2XKMA 2LKMA 2QJYC 3B8EB 1P84I 2FFDA 1G8KB 3RK2C 2FYUE 2O1KA 1RFSA 1EDJA 3HUSA 3OW2O 1KQSO 4LLHA 2W6BA 1EZVI 3W68A 5C39A 2BCCG 1BGYG 4DT0A 1JY3O 3WUTA 4W7YA 1BCCE 1L0NK 2YO2A 1OX3A 2NVEA 2N1TA 3AEAC 3C8VA 3S9OA 3QH9A 1LGHB 4L76A 3L74E 1J1EC 4YTPC 2WTYA 2E75C 1OW7A 4AAYB 2R3SA 3N4XA 2P58A 1PZQA 5KLVJ 3M9QA 3H1JE 1SJGA 3M9HA 1O7WA 1X79B 1HJBA 2NVFA 2H88C 2KZJA 2L5GB 1L0LK 3NFQA 1BCCJ 2ZVNB 1KYOI 1LP1B 1P84D 1T3JA 4GODA 3U1CA 2JDIH 3VCAA 1PGJA 1NAFA 1YTZI 2B87A 1FAVA 3PRJA 1VQ9P 2P1JA 1IZNB 3IR9A 2Z4EA 2FYNC 1GTWA 1NKZB 2B87B 4U3FJ 1EZVE 4D6TJ 1YIJP 3PH0A 3R2PA 3V2QA 4QMAA 1N2DC 2E4QA 3LIEA 1NTMD 2R5BA 2FYUD 1NWQA 3K5BA 2C9LY 4H13B 3GW6A 3H1IG 3Q5SA 2FFDB 1JOCA 1EXIA 3JC22 1M56D 1Y47A 3O8ZA 1DIPA 4QDFB 5KAFE 3T97B 2IFMA 3L70J 2OYOA 1RE4A 1L0LG 2AXTH 4HJLA 2B1XA 5AW8B 1NTKD 5B5EH 2IBZD 1JCDA 1LT9A 3V4QA 1W2EA 1BE3E 1KB9I 1KYOE 1LTGC 4XE5B 1J1DC 4I7ZB 3L72J 1JMBA 4NBCD 1JY2N 1N8RQ 2BCCE 2FXOA 3HUSC 3GHGB 1GW4A 1SFCD 3H1HE 3KZIE 1VQLP 3EN1A 1QEXA 3CMAP 4HM4A 4IFDK 1FQTA 1NGMB 3WUVA 2Y9ZA 2ZYLA 1SQPD 2ZVOB 3JSVC 2E5TA 1T2KD 1GD2E 2Q6QA 2N1TC 4I7ZC 3L35A 3GMAA 3SWKA 4EMJB 1MFZA 1NYHA 4IL6E 4UB6E 4IFFA 3VYIA 1QGKB 3LW5H 1AA0A 1M1KQ 2I8DA 3CX5E 4P1CH 3CCMP 4H13D 1PPJE 1DEEG 2P7JA 2C0XA 1LJ2A 2Y9YA 2QJKC 5K5GB 5KLVK 4RKUJ 3D6YA 3LW5J 3H32B 3GOBA 2KNCA 2OTKE 5AVZB 2H43A 3I5CA 1ZR2A 3A0BH 2HMKA 2KB7P 3L73D 4XA4A 2HYNA 2WPQA 3RGUA 3CI9A 1LTAC 1Q90C 1KV4A 2BMOA 1EZVD 3M0AA 4BRYB 1JNMA 3G4SP 3VP8A 3L73J 4NBAD 1AJYA 1SQVE 2A45I 5AVXB 3II6A 3KXDA 3CPWO 2E74D 3GG2A 2HPCA 2J59M 3E1RA 4GT1A 1NU1E 4ZKUA 3L75J 2YFJA 3WU2E 2YMKA 2KP8A 2JZAA 2Q3EA 1VQKP 3AEGC 5APQA 1KB9E 1IFPA 4NB9D 1GL2A 1FDIA 1MZ9A 5AW7B 1N7SC 2KLVA 3H1KJ 3B4SA 2C0WA 1ZRTE 1KYOD 2WVRA 2OYHC 2ZFCA 1BGYD 5AW0B 3TGUG 2WITA 1VF5D 3HTKB 2OYHB 2C9NY 5EFWB 5AVUB 3NXSA 3MZWB 3CX5D 1CSBA 1R5LA 2FYUG 2HMOA 3RK2B 1RQVA 1AQTA 2AXCA 3V4WA 3W67A 4HM6A 2WSEJ 4JF7A 5KJ7D 1GZLA 5BVZA 3KYQA 2NPSC 3L73E 4H0LB 2OTLP 1Z56A 5AW9B 1URQD 2QPZA 1UUVA 3TYYA 1A02F 2YVJB 1SQVK 1QVFO 1YJ9P 3L4FA 2A06G 3PJSK 5KLVE 3CC7P 2XNXA 2XSHA 1CI6B 3HE5A 2M5AA 5KKZB 4QDCA 2RMZA 3RK3C 3L74J 2HPCB 1NAYA 4KHXA 1ZMEC 1EDKA 3EFGA 1SQQD 1KILD 1LTBC 1SQBG 4DJGA 1IO4A 1KB9D 4BRYA 3L71J 1BSHA 1SS1A 2SPZA 2HMLA 3TNUB 1BGYE 4WY4A 4IFMA 1DD3A 3B5NB 3H1LD 1BGYJ 1KD1Q 2JJLA 2GUSA 1H89A 1NTZG 3PP5A 2FYUJ 5H2FE 1FDOA 2WZ7A 1NU1D 2P2UA 5KTBA 2I1JA 4BXLA 2QE7H 1MKMA 1USEA 3ABVC 3KHUA 5GTHE 1VQPP 4ZKPA 1FZBA 3AE6C 1N73B 2E75B 1H0TA 5KLVG 4DOJA 2FYZA 1BE3G 1S2EA 5AVVB 3CXHD 1YI2P 1LTSC 5TJHA 3Q5RA 1LNQA 3MUDA 3AE5C 5M1BA 4IOIH 1RIEA 1LT9B 3FX0A 1L2PA 2WSFJ 1IC2A 2V4HA 4M3LA 1SQVJ 2A45G 2V7QJ 3AE1C 1JUNA 1IK7A 1N7SA 4K35A 1GMJA 1O7NA 1NTZK 2XDJA 5GTIE 2YNYA 4NPDA 2J5UA 1KFNA 1PP9J 1UIIA 1EDLA 2AEMA 4EDFA 3D89A 3Q1MA 4L74A 1YITP 4KT0J 1NVOA 1FJKA 1KILE 2KNCB 2AXTE 2Y0DA 5BU5A 2ZT9D 2YIUB 4L73A 1SQQK 2D2CD 3EQ2A 1ULJA 2ITAA 2Y0CA 3TSIA 2R44A 3H1KG 3A0BE 1L0NG 1JB0J 2IYPA 1YBKA 1OW6A 3TGUJ 3JCUH 1D7MA 5B5EE 3ITKA 3VP9A 4WY4B 3L75E 1ZV8A 3MP7B 4W80A 1XTCC 4PV1D 3AEEC 1NU1K 4NBBD 1L4AD 3RBZA 1OVRA 5AVTB 3HD7A 3WU2H 3BATA 4HKVA 3H32A 1LTTC 3VMHD 1SFCC 4ASVA 3CCEP 1HVVA 4H0LC 2IZ0A 2WPSA 3LIDA 3U1AA 3S4RA 2WT7A 3EQQA 3GTSA 2Q5UA 1FC2C 3FXEA 5APSA 3CCRP 3CCUP 2E5YA 3I55P 2D2CB 2Q9IA 2A06D 1KFMA 3OA7A 2YXQB 2IYOA 3AE2C 4H0LD 2FY8A 2XSOA 2IPPA 1PP9D 4QCKA 1BDCA 1O7PA 4HB1A 3A3YB 1PGQA 2GA1A 3A0HE 1M7LA 1VL2A 4RJTA 5E79E 1MV8A 4HKZH 1L0LD 5H2FH 2PP6A 4OGQC 4UB6H 1JY2O 5KLIB 5HL4A 2FYNB 2AEJA 4NPEA 1EDIA 2KXPB 2G3AA 1NTZJ 2JEEA 3VMXA 2Y0EA 4DCKA 3TDKA 2WSCH 1EQ7A 1SQQJ 1JCCA 3I56P 2RN0A 1HUCA 3H1HJ 2QM7A 2JKVA 1VQ5P 4OH8B 3IFMA 3H1KD 3BCCG 3QWOC 3B5NA 1OVUA 3O6QA 1S1CX 5KAFH 1P84E 4UB8E 5GTIH 4C46A 2QSIA 2A06E 4JYCA 3BRTB 1NTZD 1SQVG 1Q81Q 3M91A 4HM3A 1M1JC 1NTMG 2K9JA 1WQLA 4ZNCA 1YJWP 5CHXA 1HWTC 1KILC 1UIXA 2N9YB 1H0TB 1K05A 1CI6A 1JY3P 1N73C 2OGUA 2QRXA 2JWAA 5L8RJ 4ASWA 1EZVG 1E5WA 3WUUA 3R4YA 3GL2A 4AQRD 3RL0D 3L71G 3BCCD 1L4AB 4AYCA 2QIWA 4PJ0H 1NHLA 2ZJSE 1O7MA 2Q3IA 1AQ5A 1N7SB 3C0DA 2WPRA 1T8ZA 1SQXJ 2N9BA 1RHZB 4WVZA 1R8EA 3V5BA 1IJDB 1URQC 2DE7D 2WMMA 2YKPA 2OTJP 1U7JA 4HM5A 4KJMA 1YQ3C 2QEXP 1Q7YQ 1BE3D 3M0DC 4QDFA 2R3CA 3FXDA 4EIJA 2O1JA 3H1HG 3G71P 2XNDH 3U59A 1L0NE 2IDBA 2HG5D 3L74G 1DEBA 1HTLC 1SFCA 3VTPC 4PD4I 3CC2P 2KS1A 3GKEA 3CCSP 3H6PA 1VQ7P 1L0LE 1BCCG 3C1LA 1QLED 1G1JA 2Q7CA 1VF5C 3GF3A 3VMAA 5AVYB 2BCCJ 4OGQD 1ZXGA 1FZEA 4GKGA 1RE3C 1J1DB 1NTZE 1JO5A 2OYIC 1YYCA 1N7SD 2QJKB 1T6AA 4YXWH 1YTZT 3TGUD 1L0NJ 1OIPA 1RF1C 1AFOA 1USDA 3M9BA 1QL2A 2M0BA 1YQ4C 2HODA 3JCUE 2AEFA 4WY4D 4OWFA 3AE8C 1JY2P 1NH4A 5B66E 5KJ7C 3DQYA 3A7OA 2O3JA 3FOUA 1BDDA 2KI7B 2E76B 2FKWB 1NYKA 2KSJA 1N73A 1VQ4P 3SWYA 2UWJE 1S5LH 2IFNA 4JQ0D 1O7GA 1NTKK 3H1ID 3VN0A 4U7JA 1K9MQ 3A5TA 3H1JG 2ZT9B 4NBGD 3G9RA 2P67A 3HD7B 1KQLA 1W2BO 4N3YB 5AVSB 3OJAB 4NB8D 1L0ND 1FZCA 1NO4A 2ZYAA 1NU1J 3L73G 2HODB 4HYTB 3MUDC 1AVOA 4PD4D 2WSEH 2POHA 3C9IA 3H1JJ 3CWBJ 3USSA 1RH5B 1IFJA 1KILB 4R4LA 5AVWB 5KJ7A 2LXBA 3CMEP 2N1TB 1FU1A 2M5AB 1OW8A 5DJTB 1SQBE 1BCCD 4I2LC 3BVHA 2IBZG 2H7HA 3A0HH 3GLMA 2M3BA 3GHGC 5E79H 3D71A 3V2NA 1Q90D 4P1BH 3L74D 3VMZA 2M3EA 3TGUE 4WBAA 1ZP0C 2K37A 4Y99B 2I7FA 5APVA 5AW1B 1SQBK 2OARA 1FOSE 2IX7C 2E4PA 4GOFA 1HGZA 1OWAA 3GHGA 4PJ0E 3M06A 2DE5D 2XRXA 5CXMA 1VPCA 2WQYC 2YO3A 3EWKA 5CCHC 1M8OB 3H1IE 4NBDD 4H44C 1NTKE 2I1KA 3MGNA 3BASA 4EOTA 2ZXXA 5CJ4A 3CCJP 3OAKA 1GDTA 5AW6B 4QURA 3SSUA 2JWDA 3H1HD 1FDMA 1VDFA 2W90A 1WRGA 5KKZC 1LTJA 4RESB 2OYIB 4PD4E 3IAOA 2NZ2A 2DE6D 3BRVB 3RL0g 1KN7A 2PFXA 2YMYA 1LTIC 1G1IA 2LR2A 4AIVA 2FBWC 1CZQA 2DW3A 4W7ZA 1SP4A 1SQQE 1LWUC 5CCGA 2CKFA 1Q82Q 4NBED 1Y9BA 1ZN5A 1JM1A 1GW3A 2NUKA 3HRNA 1JEKA 2QA4P 3H1LJ 1NKNA 2QJPB 2GBXA 2BCCD 1O7HA 4Y28J 3RL0C 1N86A 2CK3H 2YXRB 1S3JA 2VRSA 1ZR4A 1L4AA 2WPVB 1Q86Q 2PGDA 2Z5HA 1NTMK 2CPBA 2W8ZA 1GL2C 1PGOA 3SWFA 1EG9A 1SQXE 3VOPA 1SQBD 1OMIA 4JBZA 3E1IA 3AE7C 2MKVA 3HE4A 2HMMA 1NTKG 4TLFA 1SQXG 5CBNA 1PP9G 3HTKA 1WMKA 1GK4A 2KOGA 3G6EP 2NPSD 5APTA 4YXDC 3MD0A 2P10A 3VMID 2YIUC 1Y8AA 4L75A 2B24A 1KC8Q 1K04A 1PFIA 1SFCB 1QVGO 3CLQA 4GIFA 3Q2YA 2JO1A 1GU4A 2E75D 2FXMA 1IK9A 1XTGB 2BEQD 2K9YA 1ZRTD 1U7MA 2ZXEB 5CBOA 4ZMDA 3CCLP 3SFDC 2M8RA 1BE3J 1SQVD 1P84H 1AVYA 1VF5B 1ZLLA 2WSSH 3TK1A 4HH2A 4AUWA 3F89A 1PIXA 1FZCC 1VQNP 3GTEA 4I6MC 1FZFA 1VCKA 1RF1A 2KLUA 1JTHA 1FOSF 2KIKA 4NBHD 4PV1B 1S4XA 1KQFB 1NTKJ 2E74C 1R5SA 3CC4P 2ZYGA 1RQUA 4OVNF 3BCCJ 3B5NC 3KQGA 1DH3A 1SQPJ 2R32A 3NMDA 3TNUA
chains in the Genus database with same CATH topology
2QJKC 4HM6A 3H1LE 4NBGD 3GOBA 4HM7A 3L75E 2NUMA 3H1KE 4QURA 2BMQA 4QDFA 3L71E 3VMGD 4QDFB 4PV1D 3GB4A 4NBBD 4NB8D 4HJLA 1L0NE 2B1XA 2HMKA 5AEWA 3GZYA 5KKZC 3L73E 1BCCE 3VMID 4HKVA 2E76D 2NVEA 2QJPC 3GL0A 2YIUC 4HM8A 3VMHD 4PD4E 1BE3E 1KYOE 1Q90C 1VM9A 3L72E 2BMOA 4H44D 2B24A 4NBCD 2QPZA 1UUVA 2DE6D 3GKEA 1RIEA 2BCCE 3L74E 2YVJB 1L0LE 4AIVA 3AZCA 4QUPA 3VCPA 4NBAD 3H1HE 1PP9E 3EQQA 1SQVE 1SQQE 3EN1A 4AAYB 2CKFA 3GTSA 1P84E 2IBZE 1SQBE 4NBED 5KLVE 2E75D 2NWFA 2E74D 4HM2A 1NDOA 4NBFD 1O7NA 4OGQD 1UUWA 1NTME 3CWBE 1NU1E 1JM1A 2NUKA 3H1JE 2A06E 1SJGA 2XSHA 2YFJA 4HM4A 1O7WA 4QDDA 1FQTA 1NTZE 1ULIA 2NVGA 4QDCA 3L70E 2NVFA 3D89A 2GBXA 4P1BH 4H0LD 2XSOA 2ZYLA 4HM3A 1WQLA 3BCCE 3TGUE 2JZAA 1O7HA 4QCKA 5BOKA 3VCAA 1KB9E 2YFIA 1O7PA 4NB9D 1G8JB 2I7FA 3N0QA 2ZT9D 4EMJB 5AEUA 3GZXA 1ZRTE 2BMRA 4U3FE 4D6TE 2HMLA 2YFLA 3DQYA 1BGYE 3FOUA 4HM1A 2D2CD 3GL2A 1ULJA 2E4PA 2FYNC 1NYKA 1SQPE 3GTEA 2XR8A 5KLIC 1EZVE 1EG9A 1VF5D 2GBWA 2DE5D 2XRXA 1VCKA 2JO6A 4HM0A 1O7MA 5CXMA 1SQXE 3C0DA 2QJYC 1O7GA 3H1IE 3CXHE 4NBHD 4NBDD 3GCEA 3CX5E 4P1CH 2HMJA 1G8KB 4QUQA 2E4QA 2Q3WA 4H13D 1NTKE 1PPJE 2FYUE 2HMMA 2DE7D 5HL4A 1RFSA 2HMNA 2HMOA 4HM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJK C;  4HM6 A;  3H1L E;  4NBG D;  3GOB A;  4HM7 A;  3L75 E;  2NUM A;  3H1K E;  4QUR A;  2BMQ A;  4QDF A;  3L71 E;  3VMG D;  4QDF B;  4PV1 D;  3GB4 A;  4NBB D;  4NB8 D;  4HJL A;  1L0N E;  2B1X A;  2HMK A;  5AEW A;  3GZY A;  5KKZ C;  3L73 E;  1BCC E;  3VMI D;  4HKV A;  2E76 D;  2NVE A;  2QJP C;  3GL0 A;  2YIU C;  4HM8 A;  3VMH D;  4PD4 E;  1BE3 E;  1KYO E;  1Q90 C;  1VM9 A;  3L72 E;  2BMO A;  4H44 D;  2B24 A;  4NBC D;  2QPZ A;  1UUV A;  2DE6 D;  3GKE A;  1RIE A;  2BCC E;  3L74 E;  2YVJ B;  1L0L E;  4AIV A;  3AZC A;  4QUP A;  3VCP A;  4NBA D;  3H1H E;  1PP9 E;  3EQQ A;  1SQV E;  1SQQ E;  3EN1 A;  4AAY B;  2CKF A;  3GTS A;  1P84 E;  2IBZ E;  1SQB E;  4NBE D;  5KLV E;  2E75 D;  2NWF A;  2E74 D;  4HM2 A;  1NDO A;  4NBF D;  1O7N A;  4OGQ D;  1UUW A;  1NTM E;  3CWB E;  1NU1 E;  1JM1 A;  2NUK A;  3H1J E;  2A06 E;  1SJG A;  2XSH A;  2YFJ A;  4HM4 A;  1O7W A;  4QDD A;  1FQT A;  1NTZ E;  1ULI A;  2NVG A;  4QDC A;  3L70 E;  2NVF A;  3D89 A;  2GBX A;  4P1B H;  4H0L D;  2XSO A;  2ZYL A;  4HM3 A;  1WQL A;  3BCC E;  3TGU E;  2JZA A;  1O7H A;  4QCK A;  5BOK A;  3VCA A;  1KB9 E;  2YFI A;  1O7P A;  4NB9 D;  1G8J B;  2I7F A;  3N0Q A;  2ZT9 D;  4EMJ B;  5AEU A;  3GZX A;  1ZRT E;  2BMR A;  4U3F E;  4D6T E;  2HML A;  2YFL A;  3DQY A;  1BGY E;  3FOU A;  4HM1 A;  2D2C D;  3GL2 A;  1ULJ A;  2E4P A;  2FYN C;  1NYK A;  1SQP E;  3GTE A;  2XR8 A;  5KLI C;  1EZV E;  1EG9 A;  1VF5 D;  2GBW A;  2DE5 D;  2XRX A;  1VCK A;  2JO6 A;  4HM0 A;  1O7M A;  5CXM A;  1SQX E;  3C0D A;  2QJY C;  1O7G A;  3H1I E;  3CXH E;  4NBH D;  4NBD D;  3GCE A;  3CX5 E;  4P1C H;  2HMJ A;  1G8K B;  4QUQ A;  2E4Q A;  2Q3W A;  4H13 D;  1NTK E;  1PPJ E;  2FYU E;  2HMM A;  2DE7 D;  5HL4 A;  1RFS A;  2HMN A;  2HMO A;  4HM5 A; 
#chains in the Genus database with same CATH topology
 2Z5I A;  4BWN A;  4C7N B;  3FWL A;  3Q3D A;  1JY3 N;  3CCQ P;  5AW4 B;  2YKO A;  4N78 D;  2W27 A;  1VQO P;  3KPE A;  5CCH D;  1NTM J;  2QVA A;  3PTZ A;  2E42 A;  4Y99 C;  5CJ0 A;  5B66 H;  2W6A A;  4LGD E;  2E76 D;  1VM9 A;  4GOE A;  1M1J B;  2PAJ A;  3HD7 C;  3P8C E;  1M1J A;  2IBZ E;  2GM4 A;  3RK3 E;  3MTU E;  1UUW A;  3AE3 C;  2NVG A;  3B71 A;  1WT6 A;  1FE6 A;  2O01 J;  4RO0 A;  2PRR A;  3AEC C;  1URQ A;  1PPJ G;  5KAI E;  3AE9 C;  3L71 D;  4I1L A;  3ZDM A;  2YFI A;  3P8M C;  5KLV D;  2MJZ A;  1URQ B;  3GZX A;  1VQ6 P;  2K3R A;  2NPS A;  2XZR A;  3AED C;  1SQP E;  1W5C E;  2JR8 A;  2NRG A;  2YKQ A;  2L91 A;  2H89 C;  3TF5 A;  1L4A C;  3FWN A;  3M0D A;  1JMM A;  4EYY Q;  1FZC B;  3HD7 D;  3CXH E;  3HE5 B;  2Q3W A;  4K3A A;  2FFD C;  1S72 P;  3Q5P A;  3AE4 C;  3H1L E;  4WWI A;  1K73 Q;  2HR3 A;  2W6J H;  5AW5 B;  2NUM A;  3VMG D;  4JPZ B;  4GDO A;  3T97 A;  3GB4 A;  1JM0 A;  1PPJ D;  2KK7 A;  1LP1 A;  5APY A;  2QJY B;  4Z1M H;  2WT7 B;  5AVQ B;  3B5N D;  3RL0 B;  4C7N A;  3GL0 A;  4HM8 A;  3CCV P;  1VQM P;  3E7K A;  1KOR A;  3L72 E;  1M57 D;  1NJI Q;  2BEZ F;  3P8C D;  1J1E B;  3AZC A;  4WY4 C;  4QUP A;  3VCP A;  2R5D A;  2CPS A;  3D70 A;  1SQP K;  3CL3 D;  3G3Z A;  1N7L A;  1H88 A;  2NWF A;  4UB8 H;  4NBF D;  4WB4 A;  2IZ1 A;  2LXC B;  1PL5 A;  4R4M A;  1ULI A;  1U57 A;  1L0L J;  1IFI A;  3KDP B;  5AVR B;  3BCC E;  4N78 E;  2B88 A;  3CX5 H;  5BOK A;  3CXH I;  2B89 A;  1Q2N A;  3L72 G;  1EC5 A;  3P32 A;  3UIA A;  5AEU A;  4B86 A;  2BMR A;  2KS1 B;  4U3F E;  4D6T E;  1LTJ C;  3NTN A;  5AW2 B;  1EXJ A;  1GL2 D;  5KLI C;  1LTJ B;  3L75 D;  2GBW A;  2KUB A;  2JO6 A;  4HM0 A;  3KZI H;  3RK3 D;  2K88 A;  2HMJ A;  4H44 B;  5TIS E;  2HMN A;  3H25 A;  3SFE C;  5AW3 B;  3VMY A;  2BMQ A;  3L71 E;  1G2C B;  4TT3 H;  1SQB J;  3D6Z A;  1S5L E;  2O01 H;  1K8A Q;  1KZU B;  4IL6 H;  5AEW A;  1IFN A;  2QJP C;  3RBX A;  3FGA D;  4LC1 A;  1RF1 B;  2H8P D;  2QM8 A;  3L36 A;  3N7N A;  3P7K A;  1DD4 A;  3V2P A;  2ZYD A;  1PP9 E;  3S1K A;  1HBW A;  2OYI A;  3RK2 D;  1KTM A;  4N6J A;  4QUQ A;  1X8Y A;  2NPS B;  1CW5 A;  1FS0 E;  4HJG H;  1M90 Q;  2FXP A;  3CWB G;  2GUV A;  4C7R A;  4CPG A;  1OFC X;  1PGP A;  5CCH A;  1X22 A;  1AV1 A;  1BSN A;  3L72 D;  1FZA A;  4HM1 A;  1E79 H;  1MFT A;  1RF0 C;  3O6Q B;  1PV3 A;  2XV5 A;  4DZO A;  5APU A;  2FYU K;  3MIW A;  1GK6 A;  3GCE A;  1X0T A;  1ZOY C;  2K9J B;  2Q1K A;  1S9K E;  2RH0 A;  2E74 B;  5DJU B;  4IL6 X;  4HM7 A;  3H1K E;  1A02 J;  1OVV A;  5CMZ A;  1LT1 A;  1QL1 A;  3IF4 A;  1SQQ G;  3EFF K;  2V7Q H;  3MHV A;  1HH0 A;  1T3U A;  4U3F D;  4D6T D;  1FZG A;  3HE4 B;  1ZW0 A;  3L37 A;  1IFD A;  4H44 D;  3V2R A;  4MN4 C;  3PLN A;  4O9B A;  2OQQ A;  2IBZ I;  1KIL A;  1X9V A;  1SQX K;  3RK3 B;  1RE4 C;  1S5L X;  2K1A A;  1GU5 A;  2KYV A;  3AEB C;  5APX A;  1KMI Z;  3PHL A;  4HM2 A;  1NDO A;  1LWU B;  5CCG C;  1LWU A;  2WWW A;  2G8Y A;  3CWB E;  1HJ0 A;  2B9B A;  3L70 D;  4PD4 H;  1KYO H;  2J58 A;  4YPC A;  1VQ8 P;  2QG4 A;  2E43 A;  1H8A A;  4JYB A;  1G8J B;  1RF0 A;  2W83 C;  3N0Q A;  1TU3 F;  3IN6 A;  2WSC J;  2BAS A;  4OGQ B;  3WMM 0;  4NPF X;  3L75 G;  1GL2 B;  1OXZ A;  1KB9 H;  5CCG D;  5TIS H;  4PV1 C;  1S9K D;  1NU1 G;  3L70 G;  1KQG B;  3CX5 I;  3H1J D;  2ZAE B;  3V6I A;  4H13 C;  1HGV A;  1MUU A;  4XFJ A;  2KSE A;  2O01 N;  3GZY A;  2OYH A;  2RKL A;  1JTH B;  1LT9 C;  2D2C C;  1HF9 A;  3F5H A;  2HLO A;  4U3F G;  4D6T G;  2KZI A;  2N1T D;  1IFM A;  2ZT9 C;  3H1L G;  1YJN P;  3CXH H;  1T2K C;  2A45 H;  3CD6 P;  5KAI H;  1QX8 A;  3HUS B;  3CWB D;  1SLQ A;  1NTM E;  4QDD A;  3GF7 A;  2WSF H;  3L70 E;  2HFE D;  3AEF C;  1SQP G;  2E76 C;  3A2A A;  1RE3 A;  1J2J B;  2XU6 A;  2JP3 A;  1SQX D;  1RY3 A;  1YHQ P;  1G2C A;  1FJP A;  1FBM A;  1SVF A;  4EI2 A;  1DX7 A;  2YFL A;  3H1I J;  5BU8 B;  4A7P A;  1NOH A;  1OZH A;  5APW A;  2XR8 A;  5GTH H;  2XKM A;  2LKM A;  2QJY C;  3B8E B;  1P84 I;  2FFD A;  1G8K B;  3RK2 C;  2FYU E;  2O1K A;  1RFS A;  1EDJ A;  3HUS A;  3OW2 O;  1KQS O;  4LLH A;  2W6B A;  1EZV I;  3W68 A;  5C39 A;  2BCC G;  1BGY G;  4DT0 A;  1JY3 O;  3WUT A;  4W7Y A;  1BCC E;  1L0N K;  2YO2 A;  1OX3 A;  2NVE A;  2N1T A;  3AEA C;  3C8V A;  3S9O A;  3QH9 A;  1LGH B;  4L76 A;  3L74 E;  1J1E C;  4YTP C;  2WTY A;  2E75 C;  1OW7 A;  4AAY B;  2R3S A;  3N4X A;  2P58 A;  1PZQ A;  5KLV J;  3M9Q A;  3H1J E;  1SJG A;  3M9H A;  1O7W A;  1X79 B;  1HJB A;  2NVF A;  2H88 C;  2KZJ A;  2L5G B;  1L0L K;  3NFQ A;  1BCC J;  2ZVN B;  1KYO I;  1LP1 B;  1P84 D;  1T3J A;  4GOD A;  3U1C A;  2JDI H;  3VCA A;  1PGJ A;  1NAF A;  1YTZ I;  2B87 A;  1FAV A;  3PRJ A;  1VQ9 P;  2P1J A;  1IZN B;  3IR9 A;  2Z4E A;  2FYN C;  1GTW A;  1NKZ B;  2B87 B;  4U3F J;  1EZV E;  4D6T J;  1YIJ P;  3PH0 A;  3R2P A;  3V2Q A;  4QMA A;  1N2D C;  2E4Q A;  3LIE A;  1NTM D;  2R5B A;  2FYU D;  1NWQ A;  3K5B A;  2C9L Y;  4H13 B;  3GW6 A;  3H1I G;  3Q5S A;  2FFD B;  1JOC A;  1EXI A;  3JC2 2;  1M56 D;  1Y47 A;  3O8Z A;  1DIP A;  4QDF B;  5KAF E;  3T97 B;  2IFM A;  3L70 J;  2OYO A;  1RE4 A;  1L0L G;  2AXT H;  4HJL A;  2B1X A;  5AW8 B;  1NTK D;  5B5E H;  2IBZ D;  1JCD A;  1LT9 A;  3V4Q A;  1W2E A;  1BE3 E;  1KB9 I;  1KYO E;  1LTG C;  4XE5 B;  1J1D C;  4I7Z B;  3L72 J;  1JMB A;  4NBC D;  1JY2 N;  1N8R Q;  2BCC E;  2FXO A;  3HUS C;  3GHG B;  1GW4 A;  1SFC D;  3H1H E;  3KZI E;  1VQL P;  3EN1 A;  1QEX A;  3CMA P;  4HM4 A;  4IFD K;  1FQT A;  1NGM B;  3WUV A;  2Y9Z A;  2ZYL A;  1SQP D;  2ZVO B;  3JSV C;  2E5T A;  1T2K D;  1GD2 E;  2Q6Q A;  2N1T C;  4I7Z C;  3L35 A;  3GMA A;  3SWK A;  4EMJ B;  1MFZ A;  1NYH A;  4IL6 E;  4UB6 E;  4IFF A;  3VYI A;  1QGK B;  3LW5 H;  1AA0 A;  1M1K Q;  2I8D A;  3CX5 E;  4P1C H;  3CCM P;  4H13 D;  1PPJ E;  1DEE G;  2P7J A;  2C0X A;  1LJ2 A;  2Y9Y A;  2QJK C;  5K5G B;  5KLV K;  4RKU J;  3D6Y A;  3LW5 J;  3H32 B;  3GOB A;  2KNC A;  2OTK E;  5AVZ B;  2H43 A;  3I5C A;  1ZR2 A;  3A0B H;  2HMK A;  2KB7 P;  3L73 D;  4XA4 A;  2HYN A;  2WPQ A;  3RGU A;  3CI9 A;  1LTA C;  1Q90 C;  1KV4 A;  2BMO A;  1EZV D;  3M0A A;  4BRY B;  1JNM A;  3G4S P;  3VP8 A;  3L73 J;  4NBA D;  1AJY A;  1SQV E;  2A45 I;  5AVX B;  3II6 A;  3KXD A;  3CPW O;  2E74 D;  3GG2 A;  2HPC A;  2J59 M;  3E1R A;  4GT1 A;  1NU1 E;  4ZKU A;  3L75 J;  2YFJ A;  3WU2 E;  2YMK A;  2KP8 A;  2JZA A;  2Q3E A;  1VQK P;  3AEG C;  5APQ A;  1KB9 E;  1IFP A;  4NB9 D;  1GL2 A;  1FDI A;  1MZ9 A;  5AW7 B;  1N7S C;  2KLV A;  3H1K J;  3B4S A;  2C0W A;  1ZRT E;  1KYO D;  2WVR A;  2OYH C;  2ZFC A;  1BGY D;  5AW0 B;  3TGU G;  2WIT A;  1VF5 D;  3HTK B;  2OYH B;  2C9N Y;  5EFW B;  5AVU B;  3NXS A;  3MZW B;  3CX5 D;  1CSB A;  1R5L A;  2FYU G;  2HMO A;  3RK2 B;  1RQV A;  1AQT A;  2AXC A;  3V4W A;  3W67 A;  4HM6 A;  2WSE J;  4JF7 A;  5KJ7 D;  1GZL A;  5BVZ A;  3KYQ A;  2NPS C;  3L73 E;  4H0L B;  2OTL P;  1Z56 A;  5AW9 B;  1URQ D;  2QPZ A;  1UUV A;  3TYY A;  1A02 F;  2YVJ B;  1SQV K;  1QVF O;  1YJ9 P;  3L4F A;  2A06 G;  3PJS K;  5KLV E;  3CC7 P;  2XNX A;  2XSH A;  1CI6 B;  3HE5 A;  2M5A A;  5KKZ B;  4QDC A;  2RMZ A;  3RK3 C;  3L74 J;  2HPC B;  1NAY A;  4KHX A;  1ZME C;  1EDK A;  3EFG A;  1SQQ D;  1KIL D;  1LTB C;  1SQB G;  4DJG A;  1IO4 A;  1KB9 D;  4BRY A;  3L71 J;  1BSH A;  1SS1 A;  2SPZ A;  2HML A;  3TNU B;  1BGY E;  4WY4 A;  4IFM A;  1DD3 A;  3B5N B;  3H1L D;  1BGY J;  1KD1 Q;  2JJL A;  2GUS A;  1H89 A;  1NTZ G;  3PP5 A;  2FYU J;  5H2F E;  1FDO A;  2WZ7 A;  1NU1 D;  2P2U A;  5KTB A;  2I1J A;  4BXL A;  2QE7 H;  1MKM A;  1USE A;  3ABV C;  3KHU A;  5GTH E;  1VQP P;  4ZKP A;  1FZB A;  3AE6 C;  1N73 B;  2E75 B;  1H0T A;  5KLV G;  4DOJ A;  2FYZ A;  1BE3 G;  1S2E A;  5AVV B;  3CXH D;  1YI2 P;  1LTS C;  5TJH A;  3Q5R A;  1LNQ A;  3MUD A;  3AE5 C;  5M1B A;  4IOI H;  1RIE A;  1LT9 B;  3FX0 A;  1L2P A;  2WSF J;  1IC2 A;  2V4H A;  4M3L A;  1SQV J;  2A45 G;  2V7Q J;  3AE1 C;  1JUN A;  1IK7 A;  1N7S A;  4K35 A;  1GMJ A;  1O7N A;  1NTZ K;  2XDJ A;  5GTI E;  2YNY A;  4NPD A;  2J5U A;  1KFN A;  1PP9 J;  1UII A;  1EDL A;  2AEM A;  4EDF A;  3D89 A;  3Q1M A;  4L74 A;  1YIT P;  4KT0 J;  1NVO A;  1FJK A;  1KIL E;  2KNC B;  2AXT E;  2Y0D A;  5BU5 A;  2ZT9 D;  2YIU B;  4L73 A;  1SQQ K;  2D2C D;  3EQ2 A;  1ULJ A;  2ITA A;  2Y0C A;  3TSI A;  2R44 A;  3H1K G;  3A0B E;  1L0N G;  1JB0 J;  2IYP A;  1YBK A;  1OW6 A;  3TGU J;  3JCU H;  1D7M A;  5B5E E;  3ITK A;  3VP9 A;  4WY4 B;  3L75 E;  1ZV8 A;  3MP7 B;  4W80 A;  1XTC C;  4PV1 D;  3AEE C;  1NU1 K;  4NBB D;  1L4A D;  3RBZ A;  1OVR A;  5AVT B;  3HD7 A;  3WU2 H;  3BAT A;  4HKV A;  3H32 A;  1LTT C;  3VMH D;  1SFC C;  4ASV A;  3CCE P;  1HVV A;  4H0L C;  2IZ0 A;  2WPS A;  3LID A;  3U1A A;  3S4R A;  2WT7 A;  3EQQ A;  3GTS A;  2Q5U A;  1FC2 C;  3FXE A;  5APS A;  3CCR P;  3CCU P;  2E5Y A;  3I55 P;  2D2C B;  2Q9I A;  2A06 D;  1KFM A;  3OA7 A;  2YXQ B;  2IYO A;  3AE2 C;  4H0L D;  2FY8 A;  2XSO A;  2IPP A;  1PP9 D;  4QCK A;  1BDC A;  1O7P A;  4HB1 A;  3A3Y B;  1PGQ A;  2GA1 A;  3A0H E;  1M7L A;  1VL2 A;  4RJT A;  5E79 E;  1MV8 A;  4HKZ H;  1L0L D;  5H2F H;  2PP6 A;  4OGQ C;  4UB6 H;  1JY2 O;  5KLI B;  5HL4 A;  2FYN B;  2AEJ A;  4NPE A;  1EDI A;  2KXP B;  2G3A A;  1NTZ J;  2JEE A;  3VMX A;  2Y0E A;  4DCK A;  3TDK A;  2WSC H;  1EQ7 A;  1SQQ J;  1JCC A;  3I56 P;  2RN0 A;  1HUC A;  3H1H J;  2QM7 A;  2JKV A;  1VQ5 P;  4OH8 B;  3IFM A;  3H1K D;  3BCC G;  3QWO C;  3B5N A;  1OVU A;  3O6Q A;  1S1C X;  5KAF H;  1P84 E;  4UB8 E;  5GTI H;  4C46 A;  2QSI A;  2A06 E;  4JYC A;  3BRT B;  1NTZ D;  1SQV G;  1Q81 Q;  3M91 A;  4HM3 A;  1M1J C;  1NTM G;  2K9J A;  1WQL A;  4ZNC A;  1YJW P;  5CHX A;  1HWT C;  1KIL C;  1UIX A;  2N9Y B;  1H0T B;  1K05 A;  1CI6 A;  1JY3 P;  1N73 C;  2OGU A;  2QRX A;  2JWA A;  5L8R J;  4ASW A;  1EZV G;  1E5W A;  3WUU A;  3R4Y A;  3GL2 A;  4AQR D;  3RL0 D;  3L71 G;  3BCC D;  1L4A B;  4AYC A;  2QIW A;  4PJ0 H;  1NHL A;  2ZJS E;  1O7M A;  2Q3I A;  1AQ5 A;  1N7S B;  3C0D A;  2WPR A;  1T8Z A;  1SQX J;  2N9B A;  1RHZ B;  4WVZ A;  1R8E A;  3V5B A;  1IJD B;  1URQ C;  2DE7 D;  2WMM A;  2YKP A;  2OTJ P;  1U7J A;  4HM5 A;  4KJM A;  1YQ3 C;  2QEX P;  1Q7Y Q;  1BE3 D;  3M0D C;  4QDF A;  2R3C A;  3FXD A;  4EIJ A;  2O1J A;  3H1H G;  3G71 P;  2XND H;  3U59 A;  1L0N E;  2IDB A;  2HG5 D;  3L74 G;  1DEB A;  1HTL C;  1SFC A;  3VTP C;  4PD4 I;  3CC2 P;  2KS1 A;  3GKE A;  3CCS P;  3H6P A;  1VQ7 P;  1L0L E;  1BCC G;  3C1L A;  1QLE D;  1G1J A;  2Q7C A;  1VF5 C;  3GF3 A;  3VMA A;  5AVY B;  2BCC J;  4OGQ D;  1ZXG A;  1FZE A;  4GKG A;  1RE3 C;  1J1D B;  1NTZ E;  1JO5 A;  2OYI C;  1YYC A;  1N7S D;  2QJK B;  1T6A A;  4YXW H;  1YTZ T;  3TGU D;  1L0N J;  1OIP A;  1RF1 C;  1AFO A;  1USD A;  3M9B A;  1QL2 A;  2M0B A;  1YQ4 C;  2HOD A;  3JCU E;  2AEF A;  4WY4 D;  4OWF A;  3AE8 C;  1JY2 P;  1NH4 A;  5B66 E;  5KJ7 C;  3DQY A;  3A7O A;  2O3J A;  3FOU A;  1BDD A;  2KI7 B;  2E76 B;  2FKW B;  1NYK A;  2KSJ A;  1N73 A;  1VQ4 P;  3SWY A;  2UWJ E;  1S5L H;  2IFN A;  4JQ0 D;  1O7G A;  1NTK K;  3H1I D;  3VN0 A;  4U7J A;  1K9M Q;  3A5T A;  3H1J G;  2ZT9 B;  4NBG D;  3G9R A;  2P67 A;  3HD7 B;  1KQL A;  1W2B O;  4N3Y B;  5AVS B;  3OJA B;  4NB8 D;  1L0N D;  1FZC A;  1NO4 A;  2ZYA A;  1NU1 J;  3L73 G;  2HOD B;  4HYT B;  3MUD C;  1AVO A;  4PD4 D;  2WSE H;  2POH A;  3C9I A;  3H1J J;  3CWB J;  3USS A;  1RH5 B;  1IFJ A;  1KIL B;  4R4L A;  5AVW B;  5KJ7 A;  2LXB A;  3CME P;  2N1T B;  1FU1 A;  2M5A B;  1OW8 A;  5DJT B;  1SQB E;  1BCC D;  4I2L C;  3BVH A;  2IBZ G;  2H7H A;  3A0H H;  3GLM A;  2M3B A;  3GHG C;  5E79 H;  3D71 A;  3V2N A;  1Q90 D;  4P1B H;  3L74 D;  3VMZ A;  2M3E A;  3TGU E;  4WBA A;  1ZP0 C;  2K37 A;  4Y99 B;  2I7F A;  5APV A;  5AW1 B;  1SQB K;  2OAR A;  1FOS E;  2IX7 C;  2E4P A;  4GOF A;  1HGZ A;  1OWA A;  3GHG A;  4PJ0 E;  3M06 A;  2DE5 D;  2XRX A;  5CXM A;  1VPC A;  2WQY C;  2YO3 A;  3EWK A;  5CCH C;  1M8O B;  3H1I E;  4NBD D;  4H44 C;  1NTK E;  2I1K A;  3MGN A;  3BAS A;  4EOT A;  2ZXX A;  5CJ4 A;  3CCJ P;  3OAK A;  1GDT A;  5AW6 B;  4QUR A;  3SSU A;  2JWD A;  3H1H D;  1FDM A;  1VDF A;  2W90 A;  1WRG A;  5KKZ C;  1LTJ A;  4RES B;  2OYI B;  4PD4 E;  3IAO A;  2NZ2 A;  2DE6 D;  3BRV B;  3RL0 g;  1KN7 A;  2PFX A;  2YMY A;  1LTI C;  1G1I A;  2LR2 A;  4AIV A;  2FBW C;  1CZQ A;  2DW3 A;  4W7Z A;  1SP4 A;  1SQQ E;  1LWU C;  5CCG A;  2CKF A;  1Q82 Q;  4NBE D;  1Y9B A;  1ZN5 A;  1JM1 A;  1GW3 A;  2NUK A;  3HRN A;  1JEK A;  2QA4 P;  3H1L J;  1NKN A;  2QJP B;  2GBX A;  2BCC D;  1O7H A;  4Y28 J;  3RL0 C;  1N86 A;  2CK3 H;  2YXR B;  1S3J A;  2VRS A;  1ZR4 A;  1L4A A;  2WPV B;  1Q86 Q;  2PGD A;  2Z5H A;  1NTM K;  2CPB A;  2W8Z A;  1GL2 C;  1PGO A;  3SWF A;  1EG9 A;  1SQX E;  3VOP A;  1SQB D;  1OMI A;  4JBZ A;  3E1I A;  3AE7 C;  2MKV A;  3HE4 A;  2HMM A;  1NTK G;  4TLF A;  1SQX G;  5CBN A;  1PP9 G;  3HTK A;  1WMK A;  1GK4 A;  2KOG A;  3G6E P;  2NPS D;  5APT A;  4YXD C;  3MD0 A;  2P10 A;  3VMI D;  2YIU C;  1Y8A A;  4L75 A;  2B24 A;  1KC8 Q;  1K04 A;  1PFI A;  1SFC B;  1QVG O;  3CLQ A;  4GIF A;  3Q2Y A;  2JO1 A;  1GU4 A;  2E75 D;  2FXM A;  1IK9 A;  1XTG B;  2BEQ D;  2K9Y A;  1ZRT D;  1U7M A;  2ZXE B;  5CBO A;  4ZMD A;  3CCL P;  3SFD C;  2M8R A;  1BE3 J;  1SQV D;  1P84 H;  1AVY A;  1VF5 B;  1ZLL A;  2WSS H;  3TK1 A;  4HH2 A;  4AUW A;  3F89 A;  1PIX A;  1FZC C;  1VQN P;  3GTE A;  4I6M C;  1FZF A;  1VCK A;  1RF1 A;  2KLU A;  1JTH A;  1FOS F;  2KIK A;  4NBH D;  4PV1 B;  1S4X A;  1KQF B;  1NTK J;  2E74 C;  1R5S A;  3CC4 P;  2ZYG A;  1RQU A;  4OVN F;  3BCC J;  3B5N C;  3KQG A;  1DH3 A;  1SQP J;  2R32 A;  3NMD A;  3TNU A; 
#chains in the Genus database with same CATH homology
 2QJK C;  4HM6 A;  3H1L E;  4NBG D;  3GOB A;  4HM7 A;  3L75 E;  2NUM A;  3H1K E;  4QUR A;  2BMQ A;  4QDF A;  3L71 E;  3VMG D;  4QDF B;  4PV1 D;  3GB4 A;  4NBB D;  4NB8 D;  4HJL A;  1L0N E;  2B1X A;  2HMK A;  5AEW A;  3GZY A;  5KKZ C;  3L73 E;  1BCC E;  3VMI D;  4HKV A;  2E76 D;  2NVE A;  2QJP C;  3GL0 A;  2YIU C;  4HM8 A;  3VMH D;  4PD4 E;  1BE3 E;  1KYO E;  1Q90 C;  1VM9 A;  3L72 E;  2BMO A;  4H44 D;  2B24 A;  4NBC D;  2QPZ A;  1UUV A;  2DE6 D;  3GKE A;  1RIE A;  2BCC E;  3L74 E;  2YVJ B;  1L0L E;  4AIV A;  3AZC A;  4QUP A;  3VCP A;  4NBA D;  3H1H E;  1PP9 E;  3EQQ A;  1SQV E;  1SQQ E;  3EN1 A;  4AAY B;  2CKF A;  3GTS A;  1P84 E;  2IBZ E;  1SQB E;  4NBE D;  5KLV E;  2E75 D;  2NWF A;  2E74 D;  4HM2 A;  1NDO A;  4NBF D;  1O7N A;  4OGQ D;  1UUW A;  1NTM E;  3CWB E;  1NU1 E;  1JM1 A;  2NUK A;  3H1J E;  2A06 E;  1SJG A;  2XSH A;  2YFJ A;  4HM4 A;  1O7W A;  4QDD A;  1FQT A;  1NTZ E;  1ULI A;  2NVG A;  4QDC A;  3L70 E;  2NVF A;  3D89 A;  2GBX A;  4P1B H;  4H0L D;  2XSO A;  2ZYL A;  4HM3 A;  1WQL A;  3BCC E;  3TGU E;  2JZA A;  1O7H A;  4QCK A;  5BOK A;  3VCA A;  1KB9 E;  2YFI A;  1O7P A;  4NB9 D;  1G8J B;  2I7F A;  3N0Q A;  2ZT9 D;  4EMJ B;  5AEU A;  3GZX A;  1ZRT E;  2BMR A;  4U3F E;  4D6T E;  2HML A;  2YFL A;  3DQY A;  1BGY E;  3FOU A;  4HM1 A;  2D2C D;  3GL2 A;  1ULJ A;  2E4P A;  2FYN C;  1NYK A;  1SQP E;  3GTE A;  2XR8 A;  5KLI C;  1EZV E;  1EG9 A;  1VF5 D;  2GBW A;  2DE5 D;  2XRX A;  1VCK A;  2JO6 A;  4HM0 A;  1O7M A;  5CXM A;  1SQX E;  3C0D A;  2QJY C;  1O7G A;  3H1I E;  3CXH E;  4NBH D;  4NBD D;  3GCE A;  3CX5 E;  4P1C H;  2HMJ A;  1G8K B;  4QUQ A;  2E4Q A;  2Q3W A;  4H13 D;  1NTK E;  1PPJ E;  2FYU E;  2HMM A;  2DE7 D;  5HL4 A;  1RFS A;  2HMN A;  2HMO A;  4HM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...