4U52p0

Crystal structure of nagilactone c bound to the yeast 80s ribosome
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
219
structure length
143
Chain Sequence
GIREKKAEYFAKLREYLEEYKSLFVVGVDNVSSQQMHEVRKELRGRAVVLMGKNTMVRRAIRGFLSDLPDFEKLLPFVKGNVGFVFTNEPLTEIKNVIVSNRVAAGLTVVQVYDNGQVFPSSILDITDEELVSHFVSAVSTIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the inhibition of the eukaryotic ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 18S ribosomal RNA
total genus 30
structure length 143
sequence length 219
ec nomenclature
pdb deposition date 2014-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
p0 PF00428 Ribosomal_60s 60s Acidic ribosomal protein
p0 PF00466 Ribosomal_L10 Ribosomal protein L10
p0 PF17777 RL10P_insert Insertion domain in 60S ribosomal protein L10P
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...