4U69A

Hsmetap complex with (1-amino-2-methylpentyl)phosphonic acid
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u69A00
5CDVA 1KP0A 4FLLA 1XGMA 4A6WA 4EGEA 2V3YA 1MATA 1C21A 2B3HA 4U70A 4U73A 5D6FA 4U75A 2BWUA 1XNZA 2BHBA 4S01A 1YW7A 3Q6DA 3BIQA 1YJ3A 4QR8A 2P9AA 4FO8A 1C27A 1R5GA 2Q93A 3BIPA 4RZZA 3L7GA 2BWVA 4FO7A 4R60A 2GG8A 3RORA 2Q95A 3CTZA 1YW8A 4IKRA 4MATA 1W2MA 2IW2A 1C22A 1WL9A 4U6JA 2V3ZA 1QXWA 5E5BA 5D6EA 1WN1A 3IG4A 2EA2A 4IKTA 2GGCA 1KQ9A 1PV9A 4HXXA 1WBQA 1R58A 4U6WA 4U71A 4FUKA 1O0XA 2GG9A 3MATA 1XGOA 1B59A 1QXZA 1A16A 1WLRA 2BB7A 5CDLA 2NQ6A 2OAZA 4ZWPA 2Q96A 4IDYA 3L24A 3CB5A 5CLSA 2ZSGA 1C24A 1WL6A 4B28A 3FMQA 3FMRA 2Q92A 2V6CA 2B3LA 4IPAA 1XGNA 4PNCA 1M35A 2BWWA 1N51A 4U76A 3IU7A 1WY2A 5CE6A 4IKUA 1Y1NA 4FLKA 3PKCA 1YW9A 1QXYA 2ADUA 4A6VA 1YVMA 4FLIA 4U6EA 5FCFA 3MR1A 1JAWA 2BWXA 1C23A 2G6PA 2P98A 2BHAA 4IF7A 2GGBA 5FCHA 4S00A 2GG2A 1QZYA 4RGZ1 2BWTA 2BHCA 3PKDA 2BN7A 4U69A 3CB6A 2HOWA 4KM3A 1KQ0A 4IECA 1XGSA 2GU6A 2GG0A 2GG5A 4FKCA 4IU6A 2GG7A 3PKAA 5CDEA 2GZ5A 2EVMA 2BWSA 2GTXA 4S2TP 4JUQA 5JI6A 2GG3A 5CIKA 2Q8KA 2NQ7A 3TB5A 2EA4A 1CHMA 2BWYA 3FM3A 4Z7MA 3IU8A 3MX6A 1BN5A 3S6BA 3D27A 4FLJA 2GU4A 2EVOA 5CNXA 2B3KA 2GA2A 4ZNGA 2Q94A 2BHDA 4ZWUA 4PV4A 4ZWOA 4U6CA 1R5HA 2BH3A 3TAVA 1B6AA 4U1BA 4RZYA 1WKMA 2EVCA 2V3XA 3PKEA 4OOKA 3PKBA 4S2RP 2GU5A 3RVAA 1BOAA 4IKSA 2OKNA 2GU7A 2DFIA 3BITA 5JHUA 4U6ZA 2P99A 2MATA 1W7VA 5JFRA 3IU9A
chains in the Genus database with same CATH superfamily
5CDVA 1KP0A 4FLLA 1XGMA 4A6WA 4EGEA 2V3YA 1MATA 1C21A 2B3HA 4U70A 4U73A 5D6FA 4U75A 2BWUA 1XNZA 2BHBA 4S01A 1YW7A 3Q6DA 3BIQA 1YJ3A 4QR8A 2P9AA 4FO8A 1C27A 1R5GA 2Q93A 3BIPA 4RZZA 3L7GA 2BWVA 4FO7A 4R60A 2GG8A 3RORA 2Q95A 3CTZA 1YW8A 4IKRA 4MATA 1W2MA 2IW2A 1C22A 1WL9A 4U6JA 2V3ZA 1QXWA 5E5BA 5D6EA 1WN1A 3IG4A 2EA2A 4IKTA 2GGCA 1KQ9A 1PV9A 4HXXA 1WBQA 1R58A 4U6WA 4U71A 4FUKA 1O0XA 2GG9A 3MATA 1XGOA 1B59A 1QXZA 1A16A 1WLRA 2BB7A 5CDLA 2NQ6A 2OAZA 4ZWPA 2Q96A 4IDYA 3L24A 3CB5A 5CLSA 2ZSGA 1C24A 1WL6A 4B28A 3FMQA 3FMRA 2Q92A 2V6CA 2B3LA 4IPAA 1XGNA 4PNCA 1M35A 2BWWA 1N51A 4U76A 3IU7A 1WY2A 5CE6A 4IKUA 1Y1NA 4FLKA 3PKCA 1YW9A 1QXYA 2ADUA 4A6VA 1YVMA 4FLIA 4U6EA 5FCFA 3MR1A 1JAWA 2BWXA 1C23A 2G6PA 2P98A 2BHAA 4IF7A 2GGBA 5FCHA 4S00A 2GG2A 1QZYA 4RGZ1 2BWTA 2BHCA 3PKDA 2BN7A 4U69A 3CB6A 2HOWA 4KM3A 1KQ0A 4IECA 1XGSA 2GU6A 2GG0A 2GG5A 4FKCA 4IU6A 2GG7A 3PKAA 5CDEA 2GZ5A 2EVMA 2BWSA 2GTXA 4S2TP 4JUQA 5JI6A 2GG3A 5CIKA 2Q8KA 2NQ7A 3TB5A 2EA4A 1CHMA 2BWYA 3FM3A 4Z7MA 3IU8A 3MX6A 1BN5A 3S6BA 3D27A 4FLJA 2GU4A 2EVOA 5CNXA 2B3KA 2GA2A 4ZNGA 2Q94A 2BHDA 4ZWUA 4PV4A 4ZWOA 4U6CA 1R5HA 2BH3A 3TAVA 1B6AA 4U1BA 4RZYA 1WKMA 2EVCA 2V3XA 3PKEA 4OOKA 3PKBA 4S2RP 2GU5A 3RVAA 1BOAA 4IKSA 2OKNA 2GU7A 2DFIA 3BITA 5JHUA 4U6ZA 2P99A 2MATA 1W7VA 5JFRA 3IU9A
chains in the Genus database with same CATH topology
5CDVA 1KP0A 4FLLA 1XGMA 4A6WA 4EGEA 2V3YA 1MATA 1C21A 2B3HA 4U70A 4U73A 5D6FA 4U75A 2BWUA 1XNZA 2BHBA 4S01A 1YW7A 3Q6DA 3BIQA 1YJ3A 4QR8A 2P9AA 4FO8A 1C27A 1R5GA 2Q93A 3BIPA 4RZZA 3L7GA 2BWVA 4FO7A 4R60A 2GG8A 3RORA 2Q95A 3CTZA 1YW8A 4IKRA 4MATA 1W2MA 2IW2A 1C22A 1WL9A 4U6JA 2V3ZA 1QXWA 5E5BA 5D6EA 1WN1A 3IG4A 2EA2A 4IKTA 2GGCA 1KQ9A 1PV9A 4HXXA 1WBQA 1R58A 4U6WA 4U71A 4FUKA 1O0XA 2GG9A 3MATA 1XGOA 1B59A 1QXZA 1A16A 1WLRA 2BB7A 5CDLA 2NQ6A 2OAZA 4ZWPA 2Q96A 4IDYA 3L24A 3CB5A 5CLSA 2ZSGA 1C24A 1WL6A 4B28A 3FMQA 3FMRA 2Q92A 2V6CA 2B3LA 4IPAA 1XGNA 4PNCA 1M35A 2BWWA 1N51A 4U76A 3IU7A 1WY2A 5CE6A 4IKUA 1Y1NA 4FLKA 3PKCA 1YW9A 1QXYA 2ADUA 4A6VA 1YVMA 4FLIA 4U6EA 5FCFA 3MR1A 1JAWA 2BWXA 1C23A 2G6PA 2P98A 2BHAA 4IF7A 2GGBA 5FCHA 4S00A 2GG2A 1QZYA 4RGZ1 2BWTA 2BHCA 3PKDA 2BN7A 4U69A 3CB6A 2HOWA 4KM3A 1KQ0A 4IECA 1XGSA 2GU6A 2GG0A 2GG5A 4FKCA 4IU6A 2GG7A 3PKAA 5CDEA 2GZ5A 2EVMA 2BWSA 2GTXA 4S2TP 4JUQA 5JI6A 2GG3A 5CIKA 2Q8KA 2NQ7A 3TB5A 2EA4A 1CHMA 2BWYA 3FM3A 4Z7MA 3IU8A 3MX6A 1BN5A 3S6BA 3D27A 4FLJA 2GU4A 2EVOA 5CNXA 2B3KA 2GA2A 4ZNGA 2Q94A 2BHDA 4ZWUA 4PV4A 4ZWOA 4U6CA 1R5HA 2BH3A 3TAVA 1B6AA 4U1BA 4RZYA 1WKMA 2EVCA 2V3XA 3PKEA 4OOKA 3PKBA 4S2RP 2GU5A 3RVAA 1BOAA 4IKSA 2OKNA 2GU7A 2DFIA 3BITA 5JHUA 4U6ZA 2P99A 2MATA 1W7VA 5JFRA 3IU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CDV A;  1KP0 A;  4FLL A;  1XGM A;  4A6W A;  4EGE A;  2V3Y A;  1MAT A;  1C21 A;  2B3H A;  4U70 A;  4U73 A;  5D6F A;  4U75 A;  2BWU A;  1XNZ A;  2BHB A;  4S01 A;  1YW7 A;  3Q6D A;  3BIQ A;  1YJ3 A;  4QR8 A;  2P9A A;  4FO8 A;  1C27 A;  1R5G A;  2Q93 A;  3BIP A;  4RZZ A;  3L7G A;  2BWV A;  4FO7 A;  4R60 A;  2GG8 A;  3ROR A;  2Q95 A;  3CTZ A;  1YW8 A;  4IKR A;  4MAT A;  1W2M A;  2IW2 A;  1C22 A;  1WL9 A;  4U6J A;  2V3Z A;  1QXW A;  5E5B A;  5D6E A;  1WN1 A;  3IG4 A;  2EA2 A;  4IKT A;  2GGC A;  1KQ9 A;  1PV9 A;  4HXX A;  1WBQ A;  1R58 A;  4U6W A;  4U71 A;  4FUK A;  1O0X A;  2GG9 A;  3MAT A;  1XGO A;  1B59 A;  1QXZ A;  1A16 A;  1WLR A;  2BB7 A;  5CDL A;  2NQ6 A;  2OAZ A;  4ZWP A;  2Q96 A;  4IDY A;  3L24 A;  3CB5 A;  5CLS A;  2ZSG A;  1C24 A;  1WL6 A;  4B28 A;  3FMQ A;  3FMR A;  2Q92 A;  2V6C A;  2B3L A;  4IPA A;  1XGN A;  4PNC A;  1M35 A;  2BWW A;  1N51 A;  4U76 A;  3IU7 A;  1WY2 A;  5CE6 A;  4IKU A;  1Y1N A;  4FLK A;  3PKC A;  1YW9 A;  1QXY A;  2ADU A;  4A6V A;  1YVM A;  4FLI A;  4U6E A;  5FCF A;  3MR1 A;  1JAW A;  2BWX A;  1C23 A;  2G6P A;  2P98 A;  2BHA A;  4IF7 A;  2GGB A;  5FCH A;  4S00 A;  2GG2 A;  1QZY A;  4RGZ 1;  2BWT A;  2BHC A;  3PKD A;  2BN7 A;  4U69 A;  3CB6 A;  2HOW A;  4KM3 A;  1KQ0 A;  4IEC A;  1XGS A;  2GU6 A;  2GG0 A;  2GG5 A;  4FKC A;  4IU6 A;  2GG7 A;  3PKA A;  5CDE A;  2GZ5 A;  2EVM A;  2BWS A;  2GTX A;  4S2T P;  4JUQ A;  5JI6 A;  2GG3 A;  5CIK A;  2Q8K A;  2NQ7 A;  3TB5 A;  2EA4 A;  1CHM A;  2BWY A;  3FM3 A;  4Z7M A;  3IU8 A;  3MX6 A;  1BN5 A;  3S6B A;  3D27 A;  4FLJ A;  2GU4 A;  2EVO A;  5CNX A;  2B3K A;  2GA2 A;  4ZNG A;  2Q94 A;  2BHD A;  4ZWU A;  4PV4 A;  4ZWO A;  4U6C A;  1R5H A;  2BH3 A;  3TAV A;  1B6A A;  4U1B A;  4RZY A;  1WKM A;  2EVC A;  2V3X A;  3PKE A;  4OOK A;  3PKB A;  4S2R P;  2GU5 A;  3RVA A;  1BOA A;  4IKS A;  2OKN A;  2GU7 A;  2DFI A;  3BIT A;  5JHU A;  4U6Z A;  2P99 A;  2MAT A;  1W7V A;  5JFR A;  3IU9 A; 
#chains in the Genus database with same CATH topology
 5CDV A;  1KP0 A;  4FLL A;  1XGM A;  4A6W A;  4EGE A;  2V3Y A;  1MAT A;  1C21 A;  2B3H A;  4U70 A;  4U73 A;  5D6F A;  4U75 A;  2BWU A;  1XNZ A;  2BHB A;  4S01 A;  1YW7 A;  3Q6D A;  3BIQ A;  1YJ3 A;  4QR8 A;  2P9A A;  4FO8 A;  1C27 A;  1R5G A;  2Q93 A;  3BIP A;  4RZZ A;  3L7G A;  2BWV A;  4FO7 A;  4R60 A;  2GG8 A;  3ROR A;  2Q95 A;  3CTZ A;  1YW8 A;  4IKR A;  4MAT A;  1W2M A;  2IW2 A;  1C22 A;  1WL9 A;  4U6J A;  2V3Z A;  1QXW A;  5E5B A;  5D6E A;  1WN1 A;  3IG4 A;  2EA2 A;  4IKT A;  2GGC A;  1KQ9 A;  1PV9 A;  4HXX A;  1WBQ A;  1R58 A;  4U6W A;  4U71 A;  4FUK A;  1O0X A;  2GG9 A;  3MAT A;  1XGO A;  1B59 A;  1QXZ A;  1A16 A;  1WLR A;  2BB7 A;  5CDL A;  2NQ6 A;  2OAZ A;  4ZWP A;  2Q96 A;  4IDY A;  3L24 A;  3CB5 A;  5CLS A;  2ZSG A;  1C24 A;  1WL6 A;  4B28 A;  3FMQ A;  3FMR A;  2Q92 A;  2V6C A;  2B3L A;  4IPA A;  1XGN A;  4PNC A;  1M35 A;  2BWW A;  1N51 A;  4U76 A;  3IU7 A;  1WY2 A;  5CE6 A;  4IKU A;  1Y1N A;  4FLK A;  3PKC A;  1YW9 A;  1QXY A;  2ADU A;  4A6V A;  1YVM A;  4FLI A;  4U6E A;  5FCF A;  3MR1 A;  1JAW A;  2BWX A;  1C23 A;  2G6P A;  2P98 A;  2BHA A;  4IF7 A;  2GGB A;  5FCH A;  4S00 A;  2GG2 A;  1QZY A;  4RGZ 1;  2BWT A;  2BHC A;  3PKD A;  2BN7 A;  4U69 A;  3CB6 A;  2HOW A;  4KM3 A;  1KQ0 A;  4IEC A;  1XGS A;  2GU6 A;  2GG0 A;  2GG5 A;  4FKC A;  4IU6 A;  2GG7 A;  3PKA A;  5CDE A;  2GZ5 A;  2EVM A;  2BWS A;  2GTX A;  4S2T P;  4JUQ A;  5JI6 A;  2GG3 A;  5CIK A;  2Q8K A;  2NQ7 A;  3TB5 A;  2EA4 A;  1CHM A;  2BWY A;  3FM3 A;  4Z7M A;  3IU8 A;  3MX6 A;  1BN5 A;  3S6B A;  3D27 A;  4FLJ A;  2GU4 A;  2EVO A;  5CNX A;  2B3K A;  2GA2 A;  4ZNG A;  2Q94 A;  2BHD A;  4ZWU A;  4PV4 A;  4ZWO A;  4U6C A;  1R5H A;  2BH3 A;  3TAV A;  1B6A A;  4U1B A;  4RZY A;  1WKM A;  2EVC A;  2V3X A;  3PKE A;  4OOK A;  3PKB A;  4S2R P;  2GU5 A;  3RVA A;  1BOA A;  4IKS A;  2OKN A;  2GU7 A;  2DFI A;  3BIT A;  5JHU A;  4U6Z A;  2P99 A;  2MAT A;  1W7V A;  5JFR A;  3IU9 A; 
#chains in the Genus database with same CATH homology
 5CDV A;  1KP0 A;  4FLL A;  1XGM A;  4A6W A;  4EGE A;  2V3Y A;  1MAT A;  1C21 A;  2B3H A;  4U70 A;  4U73 A;  5D6F A;  4U75 A;  2BWU A;  1XNZ A;  2BHB A;  4S01 A;  1YW7 A;  3Q6D A;  3BIQ A;  1YJ3 A;  4QR8 A;  2P9A A;  4FO8 A;  1C27 A;  1R5G A;  2Q93 A;  3BIP A;  4RZZ A;  3L7G A;  2BWV A;  4FO7 A;  4R60 A;  2GG8 A;  3ROR A;  2Q95 A;  3CTZ A;  1YW8 A;  4IKR A;  4MAT A;  1W2M A;  2IW2 A;  1C22 A;  1WL9 A;  4U6J A;  2V3Z A;  1QXW A;  5E5B A;  5D6E A;  1WN1 A;  3IG4 A;  2EA2 A;  4IKT A;  2GGC A;  1KQ9 A;  1PV9 A;  4HXX A;  1WBQ A;  1R58 A;  4U6W A;  4U71 A;  4FUK A;  1O0X A;  2GG9 A;  3MAT A;  1XGO A;  1B59 A;  1QXZ A;  1A16 A;  1WLR A;  2BB7 A;  5CDL A;  2NQ6 A;  2OAZ A;  4ZWP A;  2Q96 A;  4IDY A;  3L24 A;  3CB5 A;  5CLS A;  2ZSG A;  1C24 A;  1WL6 A;  4B28 A;  3FMQ A;  3FMR A;  2Q92 A;  2V6C A;  2B3L A;  4IPA A;  1XGN A;  4PNC A;  1M35 A;  2BWW A;  1N51 A;  4U76 A;  3IU7 A;  1WY2 A;  5CE6 A;  4IKU A;  1Y1N A;  4FLK A;  3PKC A;  1YW9 A;  1QXY A;  2ADU A;  4A6V A;  1YVM A;  4FLI A;  4U6E A;  5FCF A;  3MR1 A;  1JAW A;  2BWX A;  1C23 A;  2G6P A;  2P98 A;  2BHA A;  4IF7 A;  2GGB A;  5FCH A;  4S00 A;  2GG2 A;  1QZY A;  4RGZ 1;  2BWT A;  2BHC A;  3PKD A;  2BN7 A;  4U69 A;  3CB6 A;  2HOW A;  4KM3 A;  1KQ0 A;  4IEC A;  1XGS A;  2GU6 A;  2GG0 A;  2GG5 A;  4FKC A;  4IU6 A;  2GG7 A;  3PKA A;  5CDE A;  2GZ5 A;  2EVM A;  2BWS A;  2GTX A;  4S2T P;  4JUQ A;  5JI6 A;  2GG3 A;  5CIK A;  2Q8K A;  2NQ7 A;  3TB5 A;  2EA4 A;  1CHM A;  2BWY A;  3FM3 A;  4Z7M A;  3IU8 A;  3MX6 A;  1BN5 A;  3S6B A;  3D27 A;  4FLJ A;  2GU4 A;  2EVO A;  5CNX A;  2B3K A;  2GA2 A;  4ZNG A;  2Q94 A;  2BHD A;  4ZWU A;  4PV4 A;  4ZWO A;  4U6C A;  1R5H A;  2BH3 A;  3TAV A;  1B6A A;  4U1B A;  4RZY A;  1WKM A;  2EVC A;  2V3X A;  3PKE A;  4OOK A;  3PKB A;  4S2R P;  2GU5 A;  3RVA A;  1BOA A;  4IKS A;  2OKN A;  2GU7 A;  2DFI A;  3BIT A;  5JHU A;  4U6Z A;  2P99 A;  2MAT A;  1W7V A;  5JFR A;  3IU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...