4U6CA

Hsmetap in complex with [(1r)-1-amino-3-cyclopentylpropyl]phosphonic acid
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6cA00
5D6FA 1R5GA 2BWYA 3RORA 4FLKA 4S2RP 4A6VA 2GGBA 4IPAA 4IKSA 1WBQA 2GG5A 2EVMA 5JFRA 1WL6A 2GA2A 2GG3A 4R60A 4U69A 5CLSA 2BHCA 2GG7A 5FCFA 1YW7A 5CDLA 3MATA 4IKUA 2GG2A 4U76A 4U75A 2NQ6A 4FLLA 2GU6A 4U6CA 1QXYA 1XGMA 2BB7A 4FUKA 1C21A 4MATA 3IU8A 1R58A 5CDEA 4IDYA 1WKMA 2BWTA 4IECA 1MATA 2NQ7A 1QXZA 5CNXA 2BHAA 3PKCA 4S01A 2P9AA 4B28A 4ZWPA 1A16A 1B6AA 3CB6A 3IG4A 4OOKA 3CTZA 1N51A 1YW9A 2Q96A 1R5HA 3TAVA 2BH3A 4RZZA 2V3ZA 2GZ5A 5CDVA 1XGNA 2BWUA 3PKAA 2GGCA 1BN5A 2HOWA 3Q6DA 1WL9A 2EVCA 1JAWA 4S00A 2B3HA 1Y1NA 2V3XA 1QZYA 2ZSGA 4ZWUA 1WY2A 2Q92A 3PKEA 1C22A 4FO8A 4U1BA 4IKTA 2Q8KA 2Q95A 3FMRA 1KP0A 2BWWA 4PV4A 4A6WA 3BIPA 4FLJA 2V3YA 5FCHA 2GTXA 3PKBA 4U6WA 4U6ZA 1C27A 1B59A 1O0XA 1M35A 3CB5A 4IF7A 2IW2A 2EA2A 2B3KA 2P98A 1PV9A 4U73A 3MX6A 2GU4A 3L24A 2GG0A 4FKCA 5JHUA 4U70A 2G6PA 3MR1A 2GG8A 3D27A 3L7GA 4U6JA 4U71A 4EGEA 1BOAA 2GG9A 4HXXA 1YW8A 4S2TP 2OKNA 2GU7A 3FMQA 2Q94A 4RZYA 1WLRA 2BWVA 1W7VA 2BWSA 5CIKA 1KQ0A 2ADUA 3S6BA 5JI6A 5D6EA 5CE6A 2V6CA 1KQ9A 2EVOA 1QXWA 1XGSA 2BHBA 3PKDA 2GU5A 1W2MA 1YVMA 4ZWOA 4JUQA 2BHDA 1C24A 3BIQA 1YJ3A 3FM3A 2MATA 2OAZA 2B3LA 3IU9A 4IU6A 4RGZ1 1XGOA 2EA4A 3RVAA 3BITA 5E5BA 2Q93A 1WN1A 2DFIA 4FO7A 2BWXA 4IKRA 1CHMA 4QR8A 3TB5A 4FLIA 4ZNGA 1C23A 1XNZA 4PNCA 4Z7MA 2BN7A 2P99A 3IU7A 4U6EA 4KM3A
chains in the Genus database with same CATH superfamily
5D6FA 1R5GA 2BWYA 3RORA 4FLKA 4S2RP 4A6VA 2GGBA 4IPAA 4IKSA 1WBQA 2GG5A 2EVMA 5JFRA 1WL6A 2GA2A 2GG3A 4R60A 4U69A 5CLSA 2BHCA 2GG7A 5FCFA 1YW7A 5CDLA 3MATA 4IKUA 2GG2A 4U76A 4U75A 2NQ6A 4FLLA 2GU6A 4U6CA 1QXYA 1XGMA 2BB7A 4FUKA 1C21A 4MATA 3IU8A 1R58A 5CDEA 4IDYA 1WKMA 2BWTA 4IECA 1MATA 2NQ7A 1QXZA 5CNXA 2BHAA 3PKCA 4S01A 2P9AA 4B28A 4ZWPA 1A16A 1B6AA 3CB6A 3IG4A 4OOKA 3CTZA 1N51A 1YW9A 2Q96A 1R5HA 3TAVA 2BH3A 4RZZA 2V3ZA 2GZ5A 5CDVA 1XGNA 2BWUA 3PKAA 2GGCA 1BN5A 2HOWA 3Q6DA 1WL9A 2EVCA 1JAWA 4S00A 2B3HA 1Y1NA 2V3XA 1QZYA 2ZSGA 4ZWUA 1WY2A 2Q92A 3PKEA 1C22A 4FO8A 4U1BA 4IKTA 2Q8KA 2Q95A 3FMRA 1KP0A 2BWWA 4PV4A 4A6WA 3BIPA 4FLJA 2V3YA 5FCHA 2GTXA 3PKBA 4U6WA 4U6ZA 1C27A 1B59A 1O0XA 1M35A 3CB5A 4IF7A 2IW2A 2EA2A 2B3KA 2P98A 1PV9A 4U73A 3MX6A 2GU4A 3L24A 2GG0A 4FKCA 5JHUA 4U70A 2G6PA 3MR1A 2GG8A 3D27A 3L7GA 4U6JA 4U71A 4EGEA 1BOAA 2GG9A 4HXXA 1YW8A 4S2TP 2OKNA 2GU7A 3FMQA 2Q94A 4RZYA 1WLRA 2BWVA 1W7VA 2BWSA 5CIKA 1KQ0A 2ADUA 3S6BA 5JI6A 5D6EA 5CE6A 2V6CA 1KQ9A 2EVOA 1QXWA 1XGSA 2BHBA 3PKDA 2GU5A 1W2MA 1YVMA 4ZWOA 4JUQA 2BHDA 1C24A 3BIQA 1YJ3A 3FM3A 2MATA 2OAZA 2B3LA 3IU9A 4IU6A 4RGZ1 1XGOA 2EA4A 3RVAA 3BITA 5E5BA 2Q93A 1WN1A 2DFIA 4FO7A 2BWXA 4IKRA 1CHMA 4QR8A 3TB5A 4FLIA 4ZNGA 1C23A 1XNZA 4PNCA 4Z7MA 2BN7A 2P99A 3IU7A 4U6EA 4KM3A
chains in the Genus database with same CATH topology
5D6FA 1R5GA 2BWYA 3RORA 4FLKA 4S2RP 4A6VA 2GGBA 4IPAA 4IKSA 1WBQA 2GG5A 2EVMA 5JFRA 1WL6A 2GA2A 2GG3A 4R60A 4U69A 5CLSA 2BHCA 2GG7A 5FCFA 1YW7A 5CDLA 3MATA 4IKUA 2GG2A 4U76A 4U75A 2NQ6A 4FLLA 2GU6A 4U6CA 1QXYA 1XGMA 2BB7A 4FUKA 1C21A 4MATA 3IU8A 1R58A 5CDEA 4IDYA 1WKMA 2BWTA 4IECA 1MATA 2NQ7A 1QXZA 5CNXA 2BHAA 3PKCA 4S01A 2P9AA 4B28A 4ZWPA 1A16A 1B6AA 3CB6A 3IG4A 4OOKA 3CTZA 1N51A 1YW9A 2Q96A 1R5HA 3TAVA 2BH3A 4RZZA 2V3ZA 2GZ5A 5CDVA 1XGNA 2BWUA 3PKAA 2GGCA 1BN5A 2HOWA 3Q6DA 1WL9A 2EVCA 1JAWA 4S00A 2B3HA 1Y1NA 2V3XA 1QZYA 2ZSGA 4ZWUA 1WY2A 2Q92A 3PKEA 1C22A 4FO8A 4U1BA 4IKTA 2Q8KA 2Q95A 3FMRA 1KP0A 2BWWA 4PV4A 4A6WA 3BIPA 4FLJA 2V3YA 5FCHA 2GTXA 3PKBA 4U6WA 4U6ZA 1C27A 1B59A 1O0XA 1M35A 3CB5A 4IF7A 2IW2A 2EA2A 2B3KA 2P98A 1PV9A 4U73A 3MX6A 2GU4A 3L24A 2GG0A 4FKCA 5JHUA 4U70A 2G6PA 3MR1A 2GG8A 3D27A 3L7GA 4U6JA 4U71A 4EGEA 1BOAA 2GG9A 4HXXA 1YW8A 4S2TP 2OKNA 2GU7A 3FMQA 2Q94A 4RZYA 1WLRA 2BWVA 1W7VA 2BWSA 5CIKA 1KQ0A 2ADUA 3S6BA 5JI6A 5D6EA 5CE6A 2V6CA 1KQ9A 2EVOA 1QXWA 1XGSA 2BHBA 3PKDA 2GU5A 1W2MA 1YVMA 4ZWOA 4JUQA 2BHDA 1C24A 3BIQA 1YJ3A 3FM3A 2MATA 2OAZA 2B3LA 3IU9A 4IU6A 4RGZ1 1XGOA 2EA4A 3RVAA 3BITA 5E5BA 2Q93A 1WN1A 2DFIA 4FO7A 2BWXA 4IKRA 1CHMA 4QR8A 3TB5A 4FLIA 4ZNGA 1C23A 1XNZA 4PNCA 4Z7MA 2BN7A 2P99A 3IU7A 4U6EA 4KM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D6F A;  1R5G A;  2BWY A;  3ROR A;  4FLK A;  4S2R P;  4A6V A;  2GGB A;  4IPA A;  4IKS A;  1WBQ A;  2GG5 A;  2EVM A;  5JFR A;  1WL6 A;  2GA2 A;  2GG3 A;  4R60 A;  4U69 A;  5CLS A;  2BHC A;  2GG7 A;  5FCF A;  1YW7 A;  5CDL A;  3MAT A;  4IKU A;  2GG2 A;  4U76 A;  4U75 A;  2NQ6 A;  4FLL A;  2GU6 A;  4U6C A;  1QXY A;  1XGM A;  2BB7 A;  4FUK A;  1C21 A;  4MAT A;  3IU8 A;  1R58 A;  5CDE A;  4IDY A;  1WKM A;  2BWT A;  4IEC A;  1MAT A;  2NQ7 A;  1QXZ A;  5CNX A;  2BHA A;  3PKC A;  4S01 A;  2P9A A;  4B28 A;  4ZWP A;  1A16 A;  1B6A A;  3CB6 A;  3IG4 A;  4OOK A;  3CTZ A;  1N51 A;  1YW9 A;  2Q96 A;  1R5H A;  3TAV A;  2BH3 A;  4RZZ A;  2V3Z A;  2GZ5 A;  5CDV A;  1XGN A;  2BWU A;  3PKA A;  2GGC A;  1BN5 A;  2HOW A;  3Q6D A;  1WL9 A;  2EVC A;  1JAW A;  4S00 A;  2B3H A;  1Y1N A;  2V3X A;  1QZY A;  2ZSG A;  4ZWU A;  1WY2 A;  2Q92 A;  3PKE A;  1C22 A;  4FO8 A;  4U1B A;  4IKT A;  2Q8K A;  2Q95 A;  3FMR A;  1KP0 A;  2BWW A;  4PV4 A;  4A6W A;  3BIP A;  4FLJ A;  2V3Y A;  5FCH A;  2GTX A;  3PKB A;  4U6W A;  4U6Z A;  1C27 A;  1B59 A;  1O0X A;  1M35 A;  3CB5 A;  4IF7 A;  2IW2 A;  2EA2 A;  2B3K A;  2P98 A;  1PV9 A;  4U73 A;  3MX6 A;  2GU4 A;  3L24 A;  2GG0 A;  4FKC A;  5JHU A;  4U70 A;  2G6P A;  3MR1 A;  2GG8 A;  3D27 A;  3L7G A;  4U6J A;  4U71 A;  4EGE A;  1BOA A;  2GG9 A;  4HXX A;  1YW8 A;  4S2T P;  2OKN A;  2GU7 A;  3FMQ A;  2Q94 A;  4RZY A;  1WLR A;  2BWV A;  1W7V A;  2BWS A;  5CIK A;  1KQ0 A;  2ADU A;  3S6B A;  5JI6 A;  5D6E A;  5CE6 A;  2V6C A;  1KQ9 A;  2EVO A;  1QXW A;  1XGS A;  2BHB A;  3PKD A;  2GU5 A;  1W2M A;  1YVM A;  4ZWO A;  4JUQ A;  2BHD A;  1C24 A;  3BIQ A;  1YJ3 A;  3FM3 A;  2MAT A;  2OAZ A;  2B3L A;  3IU9 A;  4IU6 A;  4RGZ 1;  1XGO A;  2EA4 A;  3RVA A;  3BIT A;  5E5B A;  2Q93 A;  1WN1 A;  2DFI A;  4FO7 A;  2BWX A;  4IKR A;  1CHM A;  4QR8 A;  3TB5 A;  4FLI A;  4ZNG A;  1C23 A;  1XNZ A;  4PNC A;  4Z7M A;  2BN7 A;  2P99 A;  3IU7 A;  4U6E A;  4KM3 A; 
#chains in the Genus database with same CATH topology
 5D6F A;  1R5G A;  2BWY A;  3ROR A;  4FLK A;  4S2R P;  4A6V A;  2GGB A;  4IPA A;  4IKS A;  1WBQ A;  2GG5 A;  2EVM A;  5JFR A;  1WL6 A;  2GA2 A;  2GG3 A;  4R60 A;  4U69 A;  5CLS A;  2BHC A;  2GG7 A;  5FCF A;  1YW7 A;  5CDL A;  3MAT A;  4IKU A;  2GG2 A;  4U76 A;  4U75 A;  2NQ6 A;  4FLL A;  2GU6 A;  4U6C A;  1QXY A;  1XGM A;  2BB7 A;  4FUK A;  1C21 A;  4MAT A;  3IU8 A;  1R58 A;  5CDE A;  4IDY A;  1WKM A;  2BWT A;  4IEC A;  1MAT A;  2NQ7 A;  1QXZ A;  5CNX A;  2BHA A;  3PKC A;  4S01 A;  2P9A A;  4B28 A;  4ZWP A;  1A16 A;  1B6A A;  3CB6 A;  3IG4 A;  4OOK A;  3CTZ A;  1N51 A;  1YW9 A;  2Q96 A;  1R5H A;  3TAV A;  2BH3 A;  4RZZ A;  2V3Z A;  2GZ5 A;  5CDV A;  1XGN A;  2BWU A;  3PKA A;  2GGC A;  1BN5 A;  2HOW A;  3Q6D A;  1WL9 A;  2EVC A;  1JAW A;  4S00 A;  2B3H A;  1Y1N A;  2V3X A;  1QZY A;  2ZSG A;  4ZWU A;  1WY2 A;  2Q92 A;  3PKE A;  1C22 A;  4FO8 A;  4U1B A;  4IKT A;  2Q8K A;  2Q95 A;  3FMR A;  1KP0 A;  2BWW A;  4PV4 A;  4A6W A;  3BIP A;  4FLJ A;  2V3Y A;  5FCH A;  2GTX A;  3PKB A;  4U6W A;  4U6Z A;  1C27 A;  1B59 A;  1O0X A;  1M35 A;  3CB5 A;  4IF7 A;  2IW2 A;  2EA2 A;  2B3K A;  2P98 A;  1PV9 A;  4U73 A;  3MX6 A;  2GU4 A;  3L24 A;  2GG0 A;  4FKC A;  5JHU A;  4U70 A;  2G6P A;  3MR1 A;  2GG8 A;  3D27 A;  3L7G A;  4U6J A;  4U71 A;  4EGE A;  1BOA A;  2GG9 A;  4HXX A;  1YW8 A;  4S2T P;  2OKN A;  2GU7 A;  3FMQ A;  2Q94 A;  4RZY A;  1WLR A;  2BWV A;  1W7V A;  2BWS A;  5CIK A;  1KQ0 A;  2ADU A;  3S6B A;  5JI6 A;  5D6E A;  5CE6 A;  2V6C A;  1KQ9 A;  2EVO A;  1QXW A;  1XGS A;  2BHB A;  3PKD A;  2GU5 A;  1W2M A;  1YVM A;  4ZWO A;  4JUQ A;  2BHD A;  1C24 A;  3BIQ A;  1YJ3 A;  3FM3 A;  2MAT A;  2OAZ A;  2B3L A;  3IU9 A;  4IU6 A;  4RGZ 1;  1XGO A;  2EA4 A;  3RVA A;  3BIT A;  5E5B A;  2Q93 A;  1WN1 A;  2DFI A;  4FO7 A;  2BWX A;  4IKR A;  1CHM A;  4QR8 A;  3TB5 A;  4FLI A;  4ZNG A;  1C23 A;  1XNZ A;  4PNC A;  4Z7M A;  2BN7 A;  2P99 A;  3IU7 A;  4U6E A;  4KM3 A; 
#chains in the Genus database with same CATH homology
 5D6F A;  1R5G A;  2BWY A;  3ROR A;  4FLK A;  4S2R P;  4A6V A;  2GGB A;  4IPA A;  4IKS A;  1WBQ A;  2GG5 A;  2EVM A;  5JFR A;  1WL6 A;  2GA2 A;  2GG3 A;  4R60 A;  4U69 A;  5CLS A;  2BHC A;  2GG7 A;  5FCF A;  1YW7 A;  5CDL A;  3MAT A;  4IKU A;  2GG2 A;  4U76 A;  4U75 A;  2NQ6 A;  4FLL A;  2GU6 A;  4U6C A;  1QXY A;  1XGM A;  2BB7 A;  4FUK A;  1C21 A;  4MAT A;  3IU8 A;  1R58 A;  5CDE A;  4IDY A;  1WKM A;  2BWT A;  4IEC A;  1MAT A;  2NQ7 A;  1QXZ A;  5CNX A;  2BHA A;  3PKC A;  4S01 A;  2P9A A;  4B28 A;  4ZWP A;  1A16 A;  1B6A A;  3CB6 A;  3IG4 A;  4OOK A;  3CTZ A;  1N51 A;  1YW9 A;  2Q96 A;  1R5H A;  3TAV A;  2BH3 A;  4RZZ A;  2V3Z A;  2GZ5 A;  5CDV A;  1XGN A;  2BWU A;  3PKA A;  2GGC A;  1BN5 A;  2HOW A;  3Q6D A;  1WL9 A;  2EVC A;  1JAW A;  4S00 A;  2B3H A;  1Y1N A;  2V3X A;  1QZY A;  2ZSG A;  4ZWU A;  1WY2 A;  2Q92 A;  3PKE A;  1C22 A;  4FO8 A;  4U1B A;  4IKT A;  2Q8K A;  2Q95 A;  3FMR A;  1KP0 A;  2BWW A;  4PV4 A;  4A6W A;  3BIP A;  4FLJ A;  2V3Y A;  5FCH A;  2GTX A;  3PKB A;  4U6W A;  4U6Z A;  1C27 A;  1B59 A;  1O0X A;  1M35 A;  3CB5 A;  4IF7 A;  2IW2 A;  2EA2 A;  2B3K A;  2P98 A;  1PV9 A;  4U73 A;  3MX6 A;  2GU4 A;  3L24 A;  2GG0 A;  4FKC A;  5JHU A;  4U70 A;  2G6P A;  3MR1 A;  2GG8 A;  3D27 A;  3L7G A;  4U6J A;  4U71 A;  4EGE A;  1BOA A;  2GG9 A;  4HXX A;  1YW8 A;  4S2T P;  2OKN A;  2GU7 A;  3FMQ A;  2Q94 A;  4RZY A;  1WLR A;  2BWV A;  1W7V A;  2BWS A;  5CIK A;  1KQ0 A;  2ADU A;  3S6B A;  5JI6 A;  5D6E A;  5CE6 A;  2V6C A;  1KQ9 A;  2EVO A;  1QXW A;  1XGS A;  2BHB A;  3PKD A;  2GU5 A;  1W2M A;  1YVM A;  4ZWO A;  4JUQ A;  2BHD A;  1C24 A;  3BIQ A;  1YJ3 A;  3FM3 A;  2MAT A;  2OAZ A;  2B3L A;  3IU9 A;  4IU6 A;  4RGZ 1;  1XGO A;  2EA4 A;  3RVA A;  3BIT A;  5E5B A;  2Q93 A;  1WN1 A;  2DFI A;  4FO7 A;  2BWX A;  4IKR A;  1CHM A;  4QR8 A;  3TB5 A;  4FLI A;  4ZNG A;  1C23 A;  1XNZ A;  4PNC A;  4Z7M A;  2BN7 A;  2P99 A;  3IU7 A;  4U6E A;  4KM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...