4U76A

Hsmetap (f309m) holo form
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u76A00
2OKNA 2Q95A 2HOWA 1KP0A 2GG9A 5CNXA 2BWXA 2P99A 1C24A 5CDVA 4IKUA 3L24A 1R5HA 4KM3A 3MX6A 1Y1NA 4FLJA 1W2MA 1R58A 2GGBA 2GZ5A 2BWTA 2EA2A 2BB7A 3Q6DA 4U70A 5D6EA 4IKSA 2ZSGA 4IECA 5FCFA 3IU7A 1QXZA 2B3KA 4U75A 4ZNGA 1XNZA 2IW2A 1R5GA 5CDEA 2BWYA 1KQ0A 2GTXA 4R60A 2GU6A 1XGOA 4IF7A 3PKBA 4ZWPA 2GG5A 2NQ6A 4FKCA 1B59A 1XGMA 1PV9A 2BN7A 1XGNA 2B3LA 2EVOA 1C22A 3BIQA 4JUQA 1JAWA 2GA2A 3BITA 5E5BA 5FCHA 5JHUA 2Q96A 4IPAA 1MATA 4U6CA 4U6JA 4S00A 2GG7A 1YVMA 3FM3A 1BN5A 2GU4A 3IU9A 4QR8A 3RORA 4FLIA 1WLRA 3TAVA 2V6CA 2EVMA 2GG3A 5D6FA 4IKTA 5CDLA 1QXYA 2G6PA 4RGZ1 4U6ZA 1WBQA 4IDYA 4RZYA 2Q92A 4IU6A 1WKMA 2Q8KA 1M35A 1WY2A 1CHMA 2P9AA 5JFRA 2NQ7A 2P98A 4FO8A 4FUKA 4FLKA 1WL9A 4EGEA 4RZZA 2DFIA 2OAZA 1YW8A 4ZWUA 2GG8A 1BOAA 3TB5A 2BWUA 2BHCA 3IG4A 2BWVA 4S2TP 1XGSA 2Q93A 3CB6A 4OOKA 4U76A 4A6VA 2BHDA 2GU7A 2GU5A 4B28A 1YW7A 1A16A 4S01A 4A6WA 3PKAA 1C21A 1KQ9A 2GG2A 2GGCA 5CIKA 2B3HA 1B6AA 2V3XA 4PNCA 4PV4A 4U1BA 1WL6A 3FMQA 4FO7A 3FMRA 2Q94A 2BWSA 3IU8A 4FLLA 2GG0A 3MR1A 1QZYA 4Z7MA 2BWWA 3S6BA 3BIPA 3L7GA 2BH3A 1N51A 1YW9A 2EA4A 4ZWOA 4U6WA 5JI6A 4S2RP 5CLSA 1WN1A 2V3YA 4IKRA 1C27A 3PKCA 1C23A 3RVAA 5CE6A 1QXWA 2BHAA 2EVCA 3CTZA 4MATA 2ADUA 1O0XA 4U73A 3PKEA 1YJ3A 4U71A 1W7VA 3D27A 4U69A 3MATA 3CB5A 2V3ZA 2BHBA 3PKDA 4HXXA 2MATA 4U6EA
chains in the Genus database with same CATH superfamily
2OKNA 2Q95A 2HOWA 1KP0A 2GG9A 5CNXA 2BWXA 2P99A 1C24A 5CDVA 4IKUA 3L24A 1R5HA 4KM3A 3MX6A 1Y1NA 4FLJA 1W2MA 1R58A 2GGBA 2GZ5A 2BWTA 2EA2A 2BB7A 3Q6DA 4U70A 5D6EA 4IKSA 2ZSGA 4IECA 5FCFA 3IU7A 1QXZA 2B3KA 4U75A 4ZNGA 1XNZA 2IW2A 1R5GA 5CDEA 2BWYA 1KQ0A 2GTXA 4R60A 2GU6A 1XGOA 4IF7A 3PKBA 4ZWPA 2GG5A 2NQ6A 4FKCA 1B59A 1XGMA 1PV9A 2BN7A 1XGNA 2B3LA 2EVOA 1C22A 3BIQA 4JUQA 1JAWA 2GA2A 3BITA 5E5BA 5FCHA 5JHUA 2Q96A 4IPAA 1MATA 4U6CA 4U6JA 4S00A 2GG7A 1YVMA 3FM3A 1BN5A 2GU4A 3IU9A 4QR8A 3RORA 4FLIA 1WLRA 3TAVA 2V6CA 2EVMA 2GG3A 5D6FA 4IKTA 5CDLA 1QXYA 2G6PA 4RGZ1 4U6ZA 1WBQA 4IDYA 4RZYA 2Q92A 4IU6A 1WKMA 2Q8KA 1M35A 1WY2A 1CHMA 2P9AA 5JFRA 2NQ7A 2P98A 4FO8A 4FUKA 4FLKA 1WL9A 4EGEA 4RZZA 2DFIA 2OAZA 1YW8A 4ZWUA 2GG8A 1BOAA 3TB5A 2BWUA 2BHCA 3IG4A 2BWVA 4S2TP 1XGSA 2Q93A 3CB6A 4OOKA 4U76A 4A6VA 2BHDA 2GU7A 2GU5A 4B28A 1YW7A 1A16A 4S01A 4A6WA 3PKAA 1C21A 1KQ9A 2GG2A 2GGCA 5CIKA 2B3HA 1B6AA 2V3XA 4PNCA 4PV4A 4U1BA 1WL6A 3FMQA 4FO7A 3FMRA 2Q94A 2BWSA 3IU8A 4FLLA 2GG0A 3MR1A 1QZYA 4Z7MA 2BWWA 3S6BA 3BIPA 3L7GA 2BH3A 1N51A 1YW9A 2EA4A 4ZWOA 4U6WA 5JI6A 4S2RP 5CLSA 1WN1A 2V3YA 4IKRA 1C27A 3PKCA 1C23A 3RVAA 5CE6A 1QXWA 2BHAA 2EVCA 3CTZA 4MATA 2ADUA 1O0XA 4U73A 3PKEA 1YJ3A 4U71A 1W7VA 3D27A 4U69A 3MATA 3CB5A 2V3ZA 2BHBA 3PKDA 4HXXA 2MATA 4U6EA
chains in the Genus database with same CATH topology
2OKNA 2Q95A 2HOWA 1KP0A 2GG9A 5CNXA 2BWXA 2P99A 1C24A 5CDVA 4IKUA 3L24A 1R5HA 4KM3A 3MX6A 1Y1NA 4FLJA 1W2MA 1R58A 2GGBA 2GZ5A 2BWTA 2EA2A 2BB7A 3Q6DA 4U70A 5D6EA 4IKSA 2ZSGA 4IECA 5FCFA 3IU7A 1QXZA 2B3KA 4U75A 4ZNGA 1XNZA 2IW2A 1R5GA 5CDEA 2BWYA 1KQ0A 2GTXA 4R60A 2GU6A 1XGOA 4IF7A 3PKBA 4ZWPA 2GG5A 2NQ6A 4FKCA 1B59A 1XGMA 1PV9A 2BN7A 1XGNA 2B3LA 2EVOA 1C22A 3BIQA 4JUQA 1JAWA 2GA2A 3BITA 5E5BA 5FCHA 5JHUA 2Q96A 4IPAA 1MATA 4U6CA 4U6JA 4S00A 2GG7A 1YVMA 3FM3A 1BN5A 2GU4A 3IU9A 4QR8A 3RORA 4FLIA 1WLRA 3TAVA 2V6CA 2EVMA 2GG3A 5D6FA 4IKTA 5CDLA 1QXYA 2G6PA 4RGZ1 4U6ZA 1WBQA 4IDYA 4RZYA 2Q92A 4IU6A 1WKMA 2Q8KA 1M35A 1WY2A 1CHMA 2P9AA 5JFRA 2NQ7A 2P98A 4FO8A 4FUKA 4FLKA 1WL9A 4EGEA 4RZZA 2DFIA 2OAZA 1YW8A 4ZWUA 2GG8A 1BOAA 3TB5A 2BWUA 2BHCA 3IG4A 2BWVA 4S2TP 1XGSA 2Q93A 3CB6A 4OOKA 4U76A 4A6VA 2BHDA 2GU7A 2GU5A 4B28A 1YW7A 1A16A 4S01A 4A6WA 3PKAA 1C21A 1KQ9A 2GG2A 2GGCA 5CIKA 2B3HA 1B6AA 2V3XA 4PNCA 4PV4A 4U1BA 1WL6A 3FMQA 4FO7A 3FMRA 2Q94A 2BWSA 3IU8A 4FLLA 2GG0A 3MR1A 1QZYA 4Z7MA 2BWWA 3S6BA 3BIPA 3L7GA 2BH3A 1N51A 1YW9A 2EA4A 4ZWOA 4U6WA 5JI6A 4S2RP 5CLSA 1WN1A 2V3YA 4IKRA 1C27A 3PKCA 1C23A 3RVAA 5CE6A 1QXWA 2BHAA 2EVCA 3CTZA 4MATA 2ADUA 1O0XA 4U73A 3PKEA 1YJ3A 4U71A 1W7VA 3D27A 4U69A 3MATA 3CB5A 2V3ZA 2BHBA 3PKDA 4HXXA 2MATA 4U6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OKN A;  2Q95 A;  2HOW A;  1KP0 A;  2GG9 A;  5CNX A;  2BWX A;  2P99 A;  1C24 A;  5CDV A;  4IKU A;  3L24 A;  1R5H A;  4KM3 A;  3MX6 A;  1Y1N A;  4FLJ A;  1W2M A;  1R58 A;  2GGB A;  2GZ5 A;  2BWT A;  2EA2 A;  2BB7 A;  3Q6D A;  4U70 A;  5D6E A;  4IKS A;  2ZSG A;  4IEC A;  5FCF A;  3IU7 A;  1QXZ A;  2B3K A;  4U75 A;  4ZNG A;  1XNZ A;  2IW2 A;  1R5G A;  5CDE A;  2BWY A;  1KQ0 A;  2GTX A;  4R60 A;  2GU6 A;  1XGO A;  4IF7 A;  3PKB A;  4ZWP A;  2GG5 A;  2NQ6 A;  4FKC A;  1B59 A;  1XGM A;  1PV9 A;  2BN7 A;  1XGN A;  2B3L A;  2EVO A;  1C22 A;  3BIQ A;  4JUQ A;  1JAW A;  2GA2 A;  3BIT A;  5E5B A;  5FCH A;  5JHU A;  2Q96 A;  4IPA A;  1MAT A;  4U6C A;  4U6J A;  4S00 A;  2GG7 A;  1YVM A;  3FM3 A;  1BN5 A;  2GU4 A;  3IU9 A;  4QR8 A;  3ROR A;  4FLI A;  1WLR A;  3TAV A;  2V6C A;  2EVM A;  2GG3 A;  5D6F A;  4IKT A;  5CDL A;  1QXY A;  2G6P A;  4RGZ 1;  4U6Z A;  1WBQ A;  4IDY A;  4RZY A;  2Q92 A;  4IU6 A;  1WKM A;  2Q8K A;  1M35 A;  1WY2 A;  1CHM A;  2P9A A;  5JFR A;  2NQ7 A;  2P98 A;  4FO8 A;  4FUK A;  4FLK A;  1WL9 A;  4EGE A;  4RZZ A;  2DFI A;  2OAZ A;  1YW8 A;  4ZWU A;  2GG8 A;  1BOA A;  3TB5 A;  2BWU A;  2BHC A;  3IG4 A;  2BWV A;  4S2T P;  1XGS A;  2Q93 A;  3CB6 A;  4OOK A;  4U76 A;  4A6V A;  2BHD A;  2GU7 A;  2GU5 A;  4B28 A;  1YW7 A;  1A16 A;  4S01 A;  4A6W A;  3PKA A;  1C21 A;  1KQ9 A;  2GG2 A;  2GGC A;  5CIK A;  2B3H A;  1B6A A;  2V3X A;  4PNC A;  4PV4 A;  4U1B A;  1WL6 A;  3FMQ A;  4FO7 A;  3FMR A;  2Q94 A;  2BWS A;  3IU8 A;  4FLL A;  2GG0 A;  3MR1 A;  1QZY A;  4Z7M A;  2BWW A;  3S6B A;  3BIP A;  3L7G A;  2BH3 A;  1N51 A;  1YW9 A;  2EA4 A;  4ZWO A;  4U6W A;  5JI6 A;  4S2R P;  5CLS A;  1WN1 A;  2V3Y A;  4IKR A;  1C27 A;  3PKC A;  1C23 A;  3RVA A;  5CE6 A;  1QXW A;  2BHA A;  2EVC A;  3CTZ A;  4MAT A;  2ADU A;  1O0X A;  4U73 A;  3PKE A;  1YJ3 A;  4U71 A;  1W7V A;  3D27 A;  4U69 A;  3MAT A;  3CB5 A;  2V3Z A;  2BHB A;  3PKD A;  4HXX A;  2MAT A;  4U6E A; 
#chains in the Genus database with same CATH topology
 2OKN A;  2Q95 A;  2HOW A;  1KP0 A;  2GG9 A;  5CNX A;  2BWX A;  2P99 A;  1C24 A;  5CDV A;  4IKU A;  3L24 A;  1R5H A;  4KM3 A;  3MX6 A;  1Y1N A;  4FLJ A;  1W2M A;  1R58 A;  2GGB A;  2GZ5 A;  2BWT A;  2EA2 A;  2BB7 A;  3Q6D A;  4U70 A;  5D6E A;  4IKS A;  2ZSG A;  4IEC A;  5FCF A;  3IU7 A;  1QXZ A;  2B3K A;  4U75 A;  4ZNG A;  1XNZ A;  2IW2 A;  1R5G A;  5CDE A;  2BWY A;  1KQ0 A;  2GTX A;  4R60 A;  2GU6 A;  1XGO A;  4IF7 A;  3PKB A;  4ZWP A;  2GG5 A;  2NQ6 A;  4FKC A;  1B59 A;  1XGM A;  1PV9 A;  2BN7 A;  1XGN A;  2B3L A;  2EVO A;  1C22 A;  3BIQ A;  4JUQ A;  1JAW A;  2GA2 A;  3BIT A;  5E5B A;  5FCH A;  5JHU A;  2Q96 A;  4IPA A;  1MAT A;  4U6C A;  4U6J A;  4S00 A;  2GG7 A;  1YVM A;  3FM3 A;  1BN5 A;  2GU4 A;  3IU9 A;  4QR8 A;  3ROR A;  4FLI A;  1WLR A;  3TAV A;  2V6C A;  2EVM A;  2GG3 A;  5D6F A;  4IKT A;  5CDL A;  1QXY A;  2G6P A;  4RGZ 1;  4U6Z A;  1WBQ A;  4IDY A;  4RZY A;  2Q92 A;  4IU6 A;  1WKM A;  2Q8K A;  1M35 A;  1WY2 A;  1CHM A;  2P9A A;  5JFR A;  2NQ7 A;  2P98 A;  4FO8 A;  4FUK A;  4FLK A;  1WL9 A;  4EGE A;  4RZZ A;  2DFI A;  2OAZ A;  1YW8 A;  4ZWU A;  2GG8 A;  1BOA A;  3TB5 A;  2BWU A;  2BHC A;  3IG4 A;  2BWV A;  4S2T P;  1XGS A;  2Q93 A;  3CB6 A;  4OOK A;  4U76 A;  4A6V A;  2BHD A;  2GU7 A;  2GU5 A;  4B28 A;  1YW7 A;  1A16 A;  4S01 A;  4A6W A;  3PKA A;  1C21 A;  1KQ9 A;  2GG2 A;  2GGC A;  5CIK A;  2B3H A;  1B6A A;  2V3X A;  4PNC A;  4PV4 A;  4U1B A;  1WL6 A;  3FMQ A;  4FO7 A;  3FMR A;  2Q94 A;  2BWS A;  3IU8 A;  4FLL A;  2GG0 A;  3MR1 A;  1QZY A;  4Z7M A;  2BWW A;  3S6B A;  3BIP A;  3L7G A;  2BH3 A;  1N51 A;  1YW9 A;  2EA4 A;  4ZWO A;  4U6W A;  5JI6 A;  4S2R P;  5CLS A;  1WN1 A;  2V3Y A;  4IKR A;  1C27 A;  3PKC A;  1C23 A;  3RVA A;  5CE6 A;  1QXW A;  2BHA A;  2EVC A;  3CTZ A;  4MAT A;  2ADU A;  1O0X A;  4U73 A;  3PKE A;  1YJ3 A;  4U71 A;  1W7V A;  3D27 A;  4U69 A;  3MAT A;  3CB5 A;  2V3Z A;  2BHB A;  3PKD A;  4HXX A;  2MAT A;  4U6E A; 
#chains in the Genus database with same CATH homology
 2OKN A;  2Q95 A;  2HOW A;  1KP0 A;  2GG9 A;  5CNX A;  2BWX A;  2P99 A;  1C24 A;  5CDV A;  4IKU A;  3L24 A;  1R5H A;  4KM3 A;  3MX6 A;  1Y1N A;  4FLJ A;  1W2M A;  1R58 A;  2GGB A;  2GZ5 A;  2BWT A;  2EA2 A;  2BB7 A;  3Q6D A;  4U70 A;  5D6E A;  4IKS A;  2ZSG A;  4IEC A;  5FCF A;  3IU7 A;  1QXZ A;  2B3K A;  4U75 A;  4ZNG A;  1XNZ A;  2IW2 A;  1R5G A;  5CDE A;  2BWY A;  1KQ0 A;  2GTX A;  4R60 A;  2GU6 A;  1XGO A;  4IF7 A;  3PKB A;  4ZWP A;  2GG5 A;  2NQ6 A;  4FKC A;  1B59 A;  1XGM A;  1PV9 A;  2BN7 A;  1XGN A;  2B3L A;  2EVO A;  1C22 A;  3BIQ A;  4JUQ A;  1JAW A;  2GA2 A;  3BIT A;  5E5B A;  5FCH A;  5JHU A;  2Q96 A;  4IPA A;  1MAT A;  4U6C A;  4U6J A;  4S00 A;  2GG7 A;  1YVM A;  3FM3 A;  1BN5 A;  2GU4 A;  3IU9 A;  4QR8 A;  3ROR A;  4FLI A;  1WLR A;  3TAV A;  2V6C A;  2EVM A;  2GG3 A;  5D6F A;  4IKT A;  5CDL A;  1QXY A;  2G6P A;  4RGZ 1;  4U6Z A;  1WBQ A;  4IDY A;  4RZY A;  2Q92 A;  4IU6 A;  1WKM A;  2Q8K A;  1M35 A;  1WY2 A;  1CHM A;  2P9A A;  5JFR A;  2NQ7 A;  2P98 A;  4FO8 A;  4FUK A;  4FLK A;  1WL9 A;  4EGE A;  4RZZ A;  2DFI A;  2OAZ A;  1YW8 A;  4ZWU A;  2GG8 A;  1BOA A;  3TB5 A;  2BWU A;  2BHC A;  3IG4 A;  2BWV A;  4S2T P;  1XGS A;  2Q93 A;  3CB6 A;  4OOK A;  4U76 A;  4A6V A;  2BHD A;  2GU7 A;  2GU5 A;  4B28 A;  1YW7 A;  1A16 A;  4S01 A;  4A6W A;  3PKA A;  1C21 A;  1KQ9 A;  2GG2 A;  2GGC A;  5CIK A;  2B3H A;  1B6A A;  2V3X A;  4PNC A;  4PV4 A;  4U1B A;  1WL6 A;  3FMQ A;  4FO7 A;  3FMR A;  2Q94 A;  2BWS A;  3IU8 A;  4FLL A;  2GG0 A;  3MR1 A;  1QZY A;  4Z7M A;  2BWW A;  3S6B A;  3BIP A;  3L7G A;  2BH3 A;  1N51 A;  1YW9 A;  2EA4 A;  4ZWO A;  4U6W A;  5JI6 A;  4S2R P;  5CLS A;  1WN1 A;  2V3Y A;  4IKR A;  1C27 A;  3PKC A;  1C23 A;  3RVA A;  5CE6 A;  1QXW A;  2BHA A;  2EVC A;  3CTZ A;  4MAT A;  2ADU A;  1O0X A;  4U73 A;  3PKE A;  1YJ3 A;  4U71 A;  1W7V A;  3D27 A;  4U69 A;  3MAT A;  3CB5 A;  2V3Z A;  2BHB A;  3PKD A;  4HXX A;  2MAT A;  4U6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...