4UB8O

Native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
243
structure length
243
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
molecule keywords Photosystem Q(B) protein
molecule tags Electron transport, photosynthesis
total genus 56
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 4ub8O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 4ub8O02
5GTIO 2AXTO 3WU2O 5KAFO 5H2FO 4UB6O 5G3AA 5KAIO 5G38A 1S5LO 3A0HO 5TISO 3JCUO 4IL6O 5B66O 3A0BO 5G39A 3KZIO 5B5EO 5GTHO 4PJ0O 5E79O 4UB8O
chains in the Genus database with same CATH superfamily
2ERVA 3A2SX 3AA1B 6PRNA 3SY9A 1GFQA 5ADXL 2K0LA 3EMNX 4LSIA 4E1SA 3LK42 4FOZA 3RBHA 3VZWX 2R88A 2XTRA 4UB6O 2K4TA 2R4PA 3NJTA 4N58A 2XE2A 5D5DA 4FZMA 4N74A 4JCHA 2XMXA 4C4VA 3VY9X 1HXXA 3DA3A 1HXUA 3A0HO 1PRNA 4D64A 2XE3A 1Q9GA 3QRAA 4AKMA 3PORA 1THQA 4GCQA 5G26A 3SY7A 3SZVA 3SZDA 4AYID 4G75A 2Y0HA 4LSEA 2LFUA 3T24A 2ZLDA 4PUXA 2J4UP 3WI4A 3KZIO 3T20A 3AAAA 5GTHO 4C4VB 3POUA 5IYUA 4PJ0O 2YNKA 4UB8O 2XE5A 2Y2XA 1T16A 4FSPA 2N2LA 2KDYA 1OSMA 3PGUA 3PRNA 1ORMA 5EE2A 3G7GA 5GTIO 4O4XA 1GFPA 3DA4A 4F4BA 1ZHYA 2X27X 4N75A 4RJWA 3V8UA 3WU2O 1PHOA 3PGSA 5FVNA 3DWNA 3UU2A 4AUIA 4D5UA 5H2FO 3AAAB 4FZNA 1IZNB 2KZ7B 3VY8X 2KXPA 2WVPA 2PRNA 4KRAA 5DL5A 5G3AA 3FYXA 3VZTX 5AFUK 2R4OA 1MM4A 3AAEB 1P4TA 3T0SA 3UPGA 3C5OA 3HOLA 2WJQA 4AYDC 4FZLA 4GHBA 2W80C 5AFUL 1YS5A 3SYSA 3JCUO 1E54A 4KR4A 4O3ZA 4FQEA 4XNKA 5GV0A 3TZGA 4GCSA 5B66O 2YPVA 3A0BO 1GFMA 5DL7A 2KXPB 2R4NA 3HOEA 5G39A 5B5EO 3AA6A 3PGRA 4FT6A 4AFKA 1Q9FA 3PQSA 5E79O 2Y0LA 4RLBA 4RL9A 1QJPA 4Z3TA 2WJRA 1T1LA 2IWVA 3LK41 3BRYA 3QRCA 2Y0KA 4C69X 4D65A 4KR8A 2XE1A 4O3XB 4U9CA 4XNLA 2FGQX 2O4VA 4O4UA 1H6S1 2LHFA 3AA0A 5KAFO 3PQUA 3UAQA 3AA6B 5T5FA 1MM5A 4AYEC 1MPFA 3AA7A 2R4LA 2X9KA 1GFOA 1BT9A 3HWBA 4JFBA 3POQA 2F1TA 2FGRA 2QTKA 5JDPA 3NSGA 5PRNA 3AA0B 4K3BA 4BUMX 4E1TA 4FSOA 4C00A 2M06A 2MNHA 3AA7B 3LK3A 4O3WA 4LSFA 1BH3A 2F1VA 3VE2A 2M07A 3VZUX 3DWOX 4GF4A 3POXA 4AKRA 2ZFGA 4GCPA 2PORA 3LK2A 1ZHWA 2OMFA 2J1NA 2R8AA 4FESA 4G76A 4AYNA 2AXTO 4O49A 4O3YA 3K19A 1HXTA 2ODJA 3LK3B 1OPFA 2GE4A 2N2MA 4AYMC 1ZHZA 3HW9A 2XG6A 2XTQA 3GP6A 4RJXA 5KAIO 4AKRB 3KVDD 4FRXA 4AZLA 5G38A 1BXWA 3LK2B 7PRNA 1QJ9A 4LSHA 4N59A 1S5LO 5DL6A 3BS0A 1GFNA 3JTYA 3O0EA 4FUVA 2F1CX 3AA1A 3PF1A 4FMSA 1QJ8A 4FRTA 5TISO 2Y7SA 3VE1A 4CTDA 4IL6O 2W81C 2MHLA 2KC0A 1ZHTA 4PR7A 8PRNA 1IZNA 2JMMA 2KZ7A 4QQ1A 3SYBA 3BRZA 4K3CA 4RLCA 4B61A 5DL8A 5ADXK 2IWWA 2JQYA 3AAEA 3WI5A 1G90A 2R89A 1ZHXA 3DZMA
chains in the Genus database with same CATH topology
5GTIO 2AXTO 3WU2O 5KAFO 5H2FO 4UB6O 5G3AA 5KAIO 5G38A 1S5LO 3A0HO 5TISO 3JCUO 4IL6O 5B66O 3A0BO 5G39A 3KZIO 5B5EO 5GTHO 4PJ0O 5E79O 4UB8O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTI O;  2AXT O;  3WU2 O;  5KAF O;  5H2F O;  4UB6 O;  5G3A A;  5KAI O;  5G38 A;  1S5L O;  3A0H O;  5TIS O;  3JCU O;  4IL6 O;  5B66 O;  3A0B O;  5G39 A;  3KZI O;  5B5E O;  5GTH O;  4PJ0 O;  5E79 O;  4UB8 O; 
#chains in the Genus database with same CATH topology
 2ERV A;  3A2S X;  3AA1 B;  6PRN A;  3SY9 A;  1GFQ A;  5ADX L;  2K0L A;  3EMN X;  4LSI A;  4E1S A;  3LK4 2;  4FOZ A;  3RBH A;  3VZW X;  2R88 A;  2XTR A;  4UB6 O;  2K4T A;  2R4P A;  3NJT A;  4N58 A;  2XE2 A;  5D5D A;  4FZM A;  4N74 A;  4JCH A;  2XMX A;  4C4V A;  3VY9 X;  1HXX A;  3DA3 A;  1HXU A;  3A0H O;  1PRN A;  4D64 A;  2XE3 A;  1Q9G A;  3QRA A;  4AKM A;  3POR A;  1THQ A;  4GCQ A;  5G26 A;  3SY7 A;  3SZV A;  3SZD A;  4AYI D;  4G75 A;  2Y0H A;  4LSE A;  2LFU A;  3T24 A;  2ZLD A;  4PUX A;  2J4U P;  3WI4 A;  3KZI O;  3T20 A;  3AAA A;  5GTH O;  4C4V B;  3POU A;  5IYU A;  4PJ0 O;  2YNK A;  4UB8 O;  2XE5 A;  2Y2X A;  1T16 A;  4FSP A;  2N2L A;  2KDY A;  1OSM A;  3PGU A;  3PRN A;  1ORM A;  5EE2 A;  3G7G A;  5GTI O;  4O4X A;  1GFP A;  3DA4 A;  4F4B A;  1ZHY A;  2X27 X;  4N75 A;  4RJW A;  3V8U A;  3WU2 O;  1PHO A;  3PGS A;  5FVN A;  3DWN A;  3UU2 A;  4AUI A;  4D5U A;  5H2F O;  3AAA B;  4FZN A;  1IZN B;  2KZ7 B;  3VY8 X;  2KXP A;  2WVP A;  2PRN A;  4KRA A;  5DL5 A;  5G3A A;  3FYX A;  3VZT X;  5AFU K;  2R4O A;  1MM4 A;  3AAE B;  1P4T A;  3T0S A;  3UPG A;  3C5O A;  3HOL A;  2WJQ A;  4AYD C;  4FZL A;  4GHB A;  2W80 C;  5AFU L;  1YS5 A;  3SYS A;  3JCU O;  1E54 A;  4KR4 A;  4O3Z A;  4FQE A;  4XNK A;  5GV0 A;  3TZG A;  4GCS A;  5B66 O;  2YPV A;  3A0B O;  1GFM A;  5DL7 A;  2KXP B;  2R4N A;  3HOE A;  5G39 A;  5B5E O;  3AA6 A;  3PGR A;  4FT6 A;  4AFK A;  1Q9F A;  3PQS A;  5E79 O;  2Y0L A;  4RLB A;  4RL9 A;  1QJP A;  4Z3T A;  2WJR A;  1T1L A;  2IWV A;  3LK4 1;  3BRY A;  3QRC A;  2Y0K A;  4C69 X;  4D65 A;  4KR8 A;  2XE1 A;  4O3X B;  4U9C A;  4XNL A;  2FGQ X;  2O4V A;  4O4U A;  1H6S 1;  2LHF A;  3AA0 A;  5KAF O;  3PQU A;  3UAQ A;  3AA6 B;  5T5F A;  1MM5 A;  4AYE C;  1MPF A;  3AA7 A;  2R4L A;  2X9K A;  1GFO A;  1BT9 A;  3HWB A;  4JFB A;  3POQ A;  2F1T A;  2FGR A;  2QTK A;  5JDP A;  3NSG A;  5PRN A;  3AA0 B;  4K3B A;  4BUM X;  4E1T A;  4FSO A;  4C00 A;  2M06 A;  2MNH A;  3AA7 B;  3LK3 A;  4O3W A;  4LSF A;  1BH3 A;  2F1V A;  3VE2 A;  2M07 A;  3VZU X;  3DWO X;  4GF4 A;  3POX A;  4AKR A;  2ZFG A;  4GCP A;  2POR A;  3LK2 A;  1ZHW A;  2OMF A;  2J1N A;  2R8A A;  4FES A;  4G76 A;  4AYN A;  2AXT O;  4O49 A;  4O3Y A;  3K19 A;  1HXT A;  2ODJ A;  3LK3 B;  1OPF A;  2GE4 A;  2N2M A;  4AYM C;  1ZHZ A;  3HW9 A;  2XG6 A;  2XTQ A;  3GP6 A;  4RJX A;  5KAI O;  4AKR B;  3KVD D;  4FRX A;  4AZL A;  5G38 A;  1BXW A;  3LK2 B;  7PRN A;  1QJ9 A;  4LSH A;  4N59 A;  1S5L O;  5DL6 A;  3BS0 A;  1GFN A;  3JTY A;  3O0E A;  4FUV A;  2F1C X;  3AA1 A;  3PF1 A;  4FMS A;  1QJ8 A;  4FRT A;  5TIS O;  2Y7S A;  3VE1 A;  4CTD A;  4IL6 O;  2W81 C;  2MHL A;  2KC0 A;  1ZHT A;  4PR7 A;  8PRN A;  1IZN A;  2JMM A;  2KZ7 A;  4QQ1 A;  3SYB A;  3BRZ A;  4K3C A;  4RLC A;  4B61 A;  5DL8 A;  5ADX K;  2IWW A;  2JQY A;  3AAE A;  3WI5 A;  1G90 A;  2R89 A;  1ZHX A;  3DZM A; 
#chains in the Genus database with same CATH homology
 5GTI O;  2AXT O;  3WU2 O;  5KAF O;  5H2F O;  4UB6 O;  5G3A A;  5KAI O;  5G38 A;  1S5L O;  3A0H O;  5TIS O;  3JCU O;  4IL6 O;  5B66 O;  3A0B O;  5G39 A;  3KZI O;  5B5E O;  5GTH O;  4PJ0 O;  5E79 O;  4UB8 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...