4UB8Z

Native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
molecule keywords Photosystem Q(B) protein
molecule tags Electron transport, photosynthesis
total genus 25
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 4ub8Z00
5KAFZ 4UB6Z 5KAIZ 3A0HZ 1S5LZ 5TISZ 3JCUZ 5B66Z 3A0BZ 4IL6Z 3KZIZ 5GTHZ 5B5EZ 4PJ0Z 5E79Z 4UB8Z 5GTIZ 2AXTZ 5H2FZ 3WU2Z
chains in the Genus database with same CATH superfamily
5BR8O 3R65A 3G80A 1VQ4V 2F4VB 3C90A 2ZXWC 2Z3YA 4JAAA 5IWAO 4DR3O 4D7SA 3SYOA 2KG7A 2ZIMA 1EBOA 1N8RW 1AB3A 1YF2A 3SDLA 2FKXA 5LYJA 1W0JG 1PNKA 1JR9A 2EJRA 1ORQC 2EINC 1ZX3A 4ASUG 4YY3B 4CH4A 3BFRA 4IGGA 3HR0A 1S72V 1Q86W 1OCZC 4GKJO 3U10A 1R3IC 2Y0PA 1I94O 4YXWG 5LGUA 3E89A 4MS2A 2OWOA 3ASOC 1MSDA 2ADPA 2P7TC 5LHHA 3W7XA 4U3JB 1NR1A 3HKEA 3LDCA 2ZINA 1OJHA 3SYCA 3U11A 4DV3B 3CRAA 4Z2WA 2ADQB 2VQFO 2UUCB 4K8ZA 1IDSA 3HKEB 3SPJA 4KUMA 1Q81W 3QO7A 2QR4A 2YI9A 1U96A 1HDJA 1M93A 1FFTB 1KKDA 3G6EV 1Z5VA 2OCCC 2NR5A 4HNAA 2V4DA 5KX5A 4DUYB 3J80N 4CZZA 1XUQA 1PKXA 4DW1A 1WAZA 4QJFB 5KX5B 2WLHA 3L71H 4BW5A 4J41A 4U7OA 3BA9A 2JDIG 4BWAA 2P4KA 1FXHA 3CX5F 3K9AA 1KUQA 2Y0IA 3CC2V 1WLEA 5GTIZ 3FX7A 5IJ0A 1WP8A 3QO8A 3ABMB 2CGNA 2JS5A 2W0FC 4PA7A 2B1GA 3CD6V 2D2CB 3WG7C 5IJ0B 2CTPA 1HWYA 3OGIB 1F4MA 1YZBA 4E2LA 4JI1B 3R66A 2XAQA 3T4ZA 1NS1A 2E5LB 2DWEC 1L8DA 4UCSA 4TWKA 2LP7A 3SPHA 4UCUA 3ZHVA 2AZ2A 3DC5A 4JAVA 3F7VC 4PI2A 2A7WA 4FM2A 3JATB 3AG4B 4FIPC 5HFMA 1PL4A 3B40A 3F7YC 4DR5O 1NZ6A 5H6RA 1HNZB 4DK0A 4LF6B 2N74A 1NQTA 2GTAA 2QM4A 1K4DC 4JYAB 2Y69B 1K33A 1W0KG 1QLEC 3ZX6A 1JQ0A 5CA0A 5KAFZ 3B77A 1QU7A 1OHHG 2Q73A 3ASNB 1Y4MA 4KXRA 5H9CA 2VWJA 5CA0B 3L75H 2WAMA 4JI7O 1XDCA 2ZE6A 1E79G 3APOA 4PA9A 2DYRC 3CC4V 2BTOA 2X7RB 1N0JA 3H1KH 4N21A 1I08A 2UXCO 3DXRA 2CTQA 3K03A 4K3AA 5EZYA 1JPXA 2EZOA 2PTMA 1DGSA 1GM7A 2Y4TA 4QIWF 1AP5A 2QEXV 4U7NA 3CPWU 1Q8IA 2Z0AA 3C3TA 3DXRB 4KL1A 5EZYB 3MHSC 3OGCC 1W59A 3APQA 5KHIA 4BIUA 1AI6A 5LOVA 2Q7EA 3ZCCA 1SC5B 1TUEB 4NXMO 4JTCB 2EZPA 1XMOB 1YHQV 3H01A 2Q69A 1ZL8A 5LOVB 2QTOA 1QR8A 4IYHA 1KBHA 1GH6A 2KQXA 3EFFK 4O4HA 3OMAB 1H8HG 4TSFG 4LR3A 2EILB 3JSNA 1ZL8B 4XDKA 4DR7B 4MVSA 1FD9A 1T5EA 5JVDB 1YJNV 3X2QB 3T1CA 1WA8A 1UPGA 3N2KA 5BZBA 4UVBA 4IHJA 2H8PC 2DMXA 5E79Z 3H1JH 1BZKA 3CRQA 1FYJA 1WA8B 4LCUC 1XREA 4BW9A 4UCRA 2UU9B 4IHJB 2JVDA 4JYYA 4TV9B 1IBLB 1CXZB 2WLLA 1XMQO 2DYSC 3ZMUA 2LW7A 4OX9O 1YDXA 4FFBA 3KCXA 3N2GA 4MSWC 2KKWA 4AHCA 4MTFA 3FFQA 4LF8O 4ZHQA 4FFBB 3N2GB 3GWKC 1XQ8A 3G67A 2VQEB 4ZHQB 1K5SA 1EN6A 4NTXA 4B3SB 4JTAB 1NI8A 3JASA 4ZIBA 3WB0A 1IBKO 2IJIA 3KCYA 4DV1O 5KUKA 4YJ3A 4X64B 4B3TO 1L0NH 1Y74A 3JASB 3D36A 2HHHB 1JFFA 1D5AA 5FNVA 3TXQA 1RPRA 4G27B 4YJ3B 3K57A 1QBZA 2F43G 4FLXA 4GKKB 1M56C 1Y74B 1SQXH 1K73W 1BCCH 2ZR2A 1JFFB 4TOIA 2ZNIA 3CCUV 2XUMA 3LSQA 4FLWA 5IYZA 3W7UA 4GX2A 3K5MA 4O2BB 2DE0X 4DR1B 2Q7HA 4LH7A 4DXWA 3AG1C 2K1EA 2Q4PA 4DV7B 3SJCC 1N36B 4LNUA 4FMTA 4JI8B 3B8MA 2YI8A 2ODMA 1AI4A 4BR6A 1R3LC 1RPOA 2XAHA 1I5XA 5FLXN 2G38A 1NBMG 5B1BC 1GRJA 3W7WA 1TUBA 3SGIA 1XOUA 4LNUB 2UXBB 2VRZA 3OEEG 3LNNA 5LP6C 1QCEA 2BOCC 2JGDA 1B06A 3AK2A 4JV5O 2E3CA 1XEQA 3PN1A 3H1HH 5DM6V 3N27A 3AG2C 2JGDB 1OCCC 4JI3B 4FLTA 4FLZA 3H9VA 3DTUB 2UXXA 5KHKA 1HR0O 5CB4A 2ZR3A 1GN4A 4O4LA 3P3NA 4JYBA 3B4SA 4HAMA 3CRMA 3QNEA 4WFEA 3OM3B 5CB4B 2IU0A 1FXVA 5LL6Y 4NYKA 4MTOA 4DV5O 3MDSA 3I55V 2QWRB 1OCRB 1V54C 1Y67A 1S5LZ 4LFAB 2GHYA 4B3MB 4C7UA 4Q20A 2QWPB 4RWUA 4JI8O 4ZBMA 3K08A 2Q5ZA 1NTZH 2EIMB 3AG3B 2R70A 3JD2A 3JD3A 1G1XB 1D5NA 2B9ZA 4G2KA 4D6TH 1F23A 2RJZA 4N23A 1BHAA 3WFVA 5GW7A 1EM1A 4MVRA 3T1YO 2DOSA 4DW0A 4TV8B 5H6QA 2Q7GA 3OUFA 3OTOB 4UCOA 5B1NA 1GAXA 4X1IA 1FJGO 1Q6UA 4W4KA 1AR1B 1EZVH 4K0KB 2VWKA 4UVCA 4YIOA 2IBZH 4X1IB 4WFHA 2UXDB 2HEPA 3T1HB 1K3EA 1BQZA 1VEWA 4WF9V 1S76D 4MVOA 2PZSA 3G4SV 1SQGA 1YIJV 2CK3G 5BXZA 5IY5C 4O4JA 3CXHF 4Z1VA 2L35A 1SESA 1GO3F 3KG2A 5CA3A 2PYLA 2EIJB 5B3SC 3F5TA 4XDLA 3OEHG 4O4JB 4I9QA 3HKDA 1J5EB 1ZTEA 5BR8B 3ABLB 1YJWV 1AR4A 1TVKA 3TETA 2OTLV 1PL0A 4FZ1A 4FPPA 2ZM6O 1AROP 2FYUH 4P30A 3AG7A 5IWAB 2AXTZ 1IXMA 3OMNB 2E74B 1BGYH 1VF7A 4JI0O 4EFEA 4J7KA 3JSLA 4J80A 1S5JA 2PYJA 1N33O 1NVPB 5TISZ 2WLJA 5H5NA 1VQPV 2YXYA 4PDLA 2HLDG 1Q82W 1AI5A 1RM1C 1Y76B 4J42A 4GKJB 2GDSA 1I94B 4TT3G 4RAIA 5LBQA 4DV0O 4LFCO 4LBEC 5A9GA 1GM9A 4NVPA 1KYOF 4CS3A 4WFAV 2VQFB 3CCQV 4DK1A 2ZDIC 5LMNO 2RN9A 4XDJA 3RVZA 4JI5O 4JI6O 2YUAA 1YTFB 1ZUQA 1OCOB 4UV9A 1NH2D 3U0ZA 3JCUZ 1YXBA 3ZRVA 1CPYA 2EX3A 2EULA 2B1IA 1K5QA 3O9OA 3UCSC 2M7WA 1VQLV 4GX0A 2WLNA 1YEWA 4KP4A 4FK5C 2XHBA 1EN4A 5B1AC 3GVMA 4PA3A 2KG7B 4GCZA 5LGNA 2OCHA 2JGUA 5LYJB 1JCHA 3K59A 3B2EE 1QQCA 1H8EG 2AGAA 4IIJA 1AJNA 1VMGA 4JPRA 1H2KA 3RBZA 1SZXA 2PI4A 3CSXA 5J2TA 4IIJB 2YIBD 3K58A 1MNGA 1PNMA 3OE7G 4LF9O 1KC8W 3STZC 1AP6A 5J9PC 3G6BA 5J2TB 2KSDA 4FJCC 1YJ9V 4X20A 2PY5A 3DSQA 3L70H 3OW2U 4PI0A 2HJDA 2ZQMA 4DR5B 2XOKG 4GT1A 4QPKA 3RWRD 1XHZA 4HNAB 4X20B 4B3RO 2UXNA 2DWDC 2PGGA 1FS0G 5LXTA 4EEQA 1XNQO 4DYLA 1RSOA 3CC7V 3FYIB 2X6CA 3J81N 3K0DA 1BSMA 3EHBB 3WG7B 3RYFA 4UB8Z 1B04A 5LXTB 3G71V 3SPIA 3J7AU 1XL4A 3SJBC 4JI7B 2DQ3A 3Q4HA 4MVZA 1GTOA 4J7ZA 4AQYO 3OFNG 4ICGA 1P84F 1KMIZ 3OMIB 3MHHC 4MTGA 1S3JA 3Q4HB 4UXNA 3K06A 1NU1H 1FFXA 2GSMB 3CHXA 2XT9A 2UUBO 2UXCB 2XASA 4RQEA 3K79A 1FFXB 4U3FH 1MG1A 2MK3A 4X62O 3RFRA 2BTQA 1PPJH 2A9HA 1QLEB 3LSSA 4P9OA 1OZ0A 3ZHUA 4AILC 2CUGA 4NXMB 3SJQC 3TXSA 4I50A 4RQFA 1JX9A 2BTQB 3NXSA 1BMFG 5IDJA 2DYRB 1F7YA 2A0LA 3E35A 1WNSA 1I0HA 5KMGA 2NNUA 1K4CC 2XAJA 3RYIA 1N4CA 1YSCA 1B3QA 1VF5B 5EYPA 5CN0A 5KUMA 4PJ0Z 4UFZA 5KMGB 2MW2B 2F23A 3T4DA 3ETEA 1XBLA 1SQPH 2R9AA 3RYIB 1G8MA 1QVGU 2ZE7A 4LF7O 1Q6HA 2YIDA 2P5OA 3D3IA 4JZ2A 3ZHRA 2LFRA 5L3CA 1VQ6V 1MOFA 3CB2A 2AHZA 1COWG 1YI2V 4DR4O 2QDOA 4X1KA 4NTYA 1XMQB 4OX9B 2UUAO 2F1MA 2IH3C 3FB6C 1V55B 1AVMA 3QF7A 4X1KB 4FLUA 4LF8B 4QE7A 3ZRSA 4YHHO 5KA5A 5L3GA 1X4TA 3ZRXA 5IYDO 1URFA 1S0VA 1VQ7V 4E4EA 2OYQA 2RQ6A 5EC1C 5B1OA 2RCVA 1I5YA 1IBKB 4DV1B 4RO2A 3HKCA 3E8HA 1O9GA 4B3TB 3UO3A 3E2EA 4O4HB 3ZBHA 2V7QG 2XTAA 1AJPA 3JYCA 1QNMA 5IT9N 2HVJC 1XNRO 1KD1W 4PA4A 2YIAA 1P49A 2P67A 3CP1A 1GN3A 3N2KB 4DV4O 4DR2O 3JARA 2Q0OC 1R6NA 2ZCEA 1MZFA 4L87A 4OPHA 1L0LH 1VQMV 3CJHA 2BCCH 4IL6Z 3JARB 2WLKA 1M4UA 4X8AA 4KHPO 2QA4V 2BE3A 4X89A 3CCEV 2WLLB 3CJHB 2D3OW 4CBCA 4P9PA 1L1FA 1NR7A 2CAZC 1FXKC 4JV5B 4GZRB 5LA6A 2ZIOA 4MVQA 3I56V 4NKGB 4CC5A 4HYOA 1NT2B 1H2MA 5E1AC 4UUJC 4LF4O 3OR7C 4ZI7A 3K04A 5LA6B 4OXSA 1BHBA 2CH7A 1WB7A 5KA6A 2EIKB 1Q3EA 4NXNO 5EBLC 2IJKA 1HR0B 1K9MW 4X1YA 1K8AW 1DF5A 4ZI7B 3NR7A 2PI5A 2CH7B 2A3QA 4JF3A 3AG1B 1WN7A 5FNVB 2R72A 1Q90D 1NKDA 3OUSA 4I5SA 4ABMA 5B5EZ 4JAUA 4DV5B 5B1BB 4X66B 1JOYA 1WPBA 1JMKC 2YC0A 4OGQB 2Y48A 1WPXA 1H2LA 5IYZB 5JH7A 1IX9A 2FMLA 3ABKB 3ZHTA 5L3DA 3BRCA 4MTXA 3H1IH 5HFLA 5JH7B 4MW8A 1UJWB 1IXBA 1DLBA 5GONA 4CH5A 5LHIA 1TUBB 4CH3A 3T1YB 1IBMO 2QSAA 2HJFC 3A8TA 3ZHSA 2OTJV 1FJGB 5D5QA 4H13B 1Q43A 1SA0A 3WB2A 4TUYA 1V54B 3JAWA 3F5WC 1ZSPA 2YEVA 5J2UA 1PM9A 1MA1A 2C2AA 2WA4A 1SA0B 4I9WA 1QHTA 4CS4A 3CCLV 3JAWB 3CMEV 1FAFA 2YEVB 3ETQA 3UO2A 1R1BA 4O4LB 4LFBO 3BCCH 4X66O 3BY6A 3P3PA 5B66Z 1U97A 3C3SA 3P32A 4GX1A 1UFIA 1NVPD 3CRCA 4TQDA 2Z5UA 1EFRG 3SYQA 2W0XA 3CS5A 1FPOA 4DUZO 1VIBA 1HNXO 4L8JA 5LMUO 2ZM6B 3TK1A 1M1KW 4JI2O 1JA8A 3AEIA 1RP3B 4PV1B 3BA8A 3CCSV 4JI0B 1AILA 3K5NA 1BS3A 1OCRC 1N33B 3IAYA 1F4NA 2LGQA 4PDRA 3IGAC 2ITDC 4UCVA 5ITZA 2FL4A 5IY5B 5IYCO 1GN6A 1B6QA 3S3XA 5L3FA 1F51A 3W7SA 2EIMC 2BOBC 1TAEA 5B3SB 1KKCA 2FB5A 5ITZB 4O2AA 4PHZA 4JTDB 4DV0B 5KHJA 4LFCB 2LFSA 2IU3A 2RMKB 3EVKA 4DV6O 2PF4E 4I55A 4DV2B 4O2AB 2GBOA 4J9ZB 2P90A 3AK1A 1HNWO 5LMNB 2LQTA 4BIZA 4F6EA 1MABG 4X88A 1AR5A 2ITCC 3RYHA 4I55B 4JI5B 3VQYA 4JI6B 2CDYA 2BSKA 3TGUH 1N34O 3K9SA 4H33A 2X6AA 1K92A 3SYAA 1GK9A 3K5LA 2ZNJA 3HKDB 2W6JG 2BSKB 3JALA 3BEHA 1TVKB 1RM1B 5CMUA 3FB7C 4FLYA 1N32O 3OTFA 1JJOA 2IM9A 2JIZG 4DRXA 3JALB 4PDMA 2Q9LA 2EIJC 2ZDIA 5GTHZ 2QE7G 4JZGA 1SQQH 5DECA 4DRXB 4DR6O 1M57C 4NR1A 2FTKA 2QWOB 3L74H 3KKYA 3W7TA 1ZWIC 1EN5A 4EB6A 1IVSA 3P30A 3I5DA 4LF5O 4DV2O 1ROPA 4W4LA 2ZXWB 4LF9B 5LHGA 1M90W 3SR2C 3OT7A 4H0LB 5IE9A 5L3EA 4FLVA 3K3WA 1VF6C 5F2VO 4F6RA 3ETGA 4QNHB 4RUFA 3MAQA 2ZKOA 2ZD9A 2EINB 4YJ2A 4Z1MG 4UV8A 5JQGA 2AW9A 1M5IA 1Y6XA 4B3RB 4F6RB 2ZE8A 1H38A 4QE9A 1OCZB 2PUSA 4QGPA 1XNQB 3GWOA 2K9PA 4YJ2B 5JJEB 5JCOC 5CBHA 2Q6AA 3HPLC 5JQGB 3JAMN 3FD9A 2Y4UA 3ASOB 5IJ9A 1RFYA 1BT8A 3E22A 3CRRA 2GUZA 1NTMH 3CYOA 1P7BA 2Y69C 5IJ9B 5K1PA 4AQYB 1OCOC 5L3BA 3E22B 1H2SB 2GUZB 2Q68A 1LUWA 3E86A 1TA8A 2X0LA 1KP2A 2OCCB 1R73A 3ZMTA 2CTRA 2ZE5A 3UT5A 2UUBB 4FM1A 2WSSG 2HR3A 1MZEA 2N05A 2P06A 4U3JA 2X6BA 4JI4O 1E1QG 3A0BZ 1SETA 5BY1A 1KQSU 1IZ3A 1FKAO 3UT5B 1NJIW 2YDEA 4X62B 1R6KA 4AI8A 2Q67A 4JASA 1AI7A 1R3JC 2GV9A 2OIEA 3DC6A 4UVAA 4K8XA 1YVWA 4HZ3A 5C93A 1H2GA 3UQ8A 4R7CA 1XI1A 2F4VO 1SRYA 3JD1A 5CA1A 1RSOB 3S3WA 1WB8A 2WWWA 1X59A 1OV9A 3HB3B 3JAKA 3RVYA 1MMMA 3RYFB 3VQVA 3TJTA 3BPZA 2LJ2A 1YITV 5CA1B 1A32A 4LF7B 3EXAA 1VARA 3JAKB 4YY3O 4MT8A 4KFMA 3BVOA 4Q6GA 2HKOA 3BAAA 1NH2B 1M9NA 3RGBA 4DR4B 3CCRV 4GYCB 5KAIZ 2JJ1G 2YSUB 2ILMA 1Q7YW 2QM8A 2UUAB 3VOUA 3M7MX 4DV3O 3ZN0A 5DEDA 3ABMC 2UUCO 2H3OA 4YHHB 4GUNA 1SF9A 3JATA 4JYCA 2QWNB 3ZMSA 1P7GA 1WP7A 1DF4A 4OPAA 1VQ8V 2DJVA 5DN6G 4I50B 4EFBA 4MVUA 2YIBA 4DUYO 1IURA 1GKFA 3CMAV 1HW7A 4QPJA 3K0GA 1W2BU 3PJSK 2JRIA 3WU2Z 2YICA 3AG4C 5EYPB 1GMGA 1P4RA 2YXLA 3LDDA 5EIBD 4PD4F 1XL6A 2XNDG 1TGOA 1XNRB 4FZ0A 4B7KA 3QG5A 3ZS8C 4DV4B 4DR2B 3CEIA 3T2MA 2WLMA 3IC9A 3ASNC 1NTKH 2XAFA 2ATKC 4GX5A 3AK3A 2OIGA 1BE3H 3QVNA 3M8AA 1PP9H 1MSWD 4KHPB 4JI1O 1XILA 1AJQA 2YS8A 3B8NA 3FYEB 3RYCA 1K97A 3QTCA 2E5LO 2HP8A 4IYIA 2P4VA 1G6UA 2AHYA 3RYCB 2ZT9B 4PELA 2R9RB 2B5UA 4O4IA 3SJAC 3IFXA 3ABTA 2L6LA 2IH1C 4LF4B 2F66C 1HNZO 5KLVH 4LF6O 2DW4A 5C8YA 3JCZA 4GLXA 4J10A 4O4IB 4JYAO 4NXNB 1US6A 1V55C 3HKCB 1QLNA 2E76B 1QVFU 4WBNA 5C8YB 5JVDA 4I4TA 4J11A 2DYSB 2E75B 4A5UB 2ARHA 2NN4A 3VQXA 4WBNB 4X65B 1FXKA 4I4TB 3O65A 1S5HC 3FB5C 4K35A 4YIPA 2EILC 3SYPA 5EC2C 3JD0A 1FXKB 4NB5A 4WFBV 3TCUA 3FAVA 1Q5OA 2OT5A 4TV9A 2F93B 3A0RA 3X2QC 3E8BA 1SS3A 1N0NA 3FAVB 3BHPA 2QKSA 2W6IG 4CH6A 1LR1A 3SPGA 5K1XA 1R6TA 1SZTA 2P6JA 1IBMB 1K34A 4B7EA 2A79B 1M56B 1DK1A 3IC7A 4LWSA 1XMOO 1GM8A 3CXCU 3ABUA 3ZMZA 2HFEC 4CC6A 3VBBA 3JD4A 1VQOV 1HP8A 2DQ0A 4ZKIA 3K5OA 3ZN1A 1SERA 4LWSB 1XHXA 2LO1A 3LUTB 5EIBC 1Y66A 2JJ2G 4LC1A 2QWQB 3D3QA 3HKBA 4LH6A 4WFFA 4DR7O 3LSUA 4X1YB 2CGOA 2QGNA 3LDEA 5LP6A 4X65O 2WLIA 3OR6C 4CS2A 3QO5A 1VQNV 2QKCA 4LFBB 3ZMVA 3HKBB 3CCJV 1CEZA 1ENVA 4R6ZA 3UM7A 5LP6B 2A06H 2WLIB 1YCIA 2LW1A 2VS0A 4O2BA 3A0HZ 3CWBH 1LUVA 2EIKC 1Q6IA 2N04A 1H2NA 3L73H 3AG2B 4I7ZB 2UU9O 1OCCB 2IJJA 3D8CA 4DUZB 5KHHA 2QM7A 1HNXB 5LMUB 1IBLO 4JI2B 3D36C 1JJ2U 1E1RG 4TQFA 1ZLZA 1BL8A 3SPCA 3L72H 4NTWA 1VQ9V 2R9IA 4FFKA 5GONB 4ZOLA 3RT3C 1WJZA 3CCMV 2HG5C 2VQEO 5FL7G 4LP8A 3FB8C 4B3SO 4ZOLB 3ABKC 1VP7A 1S77D 5A2QN 4D7TA 5D5PA 4TUYB 3E8FA 4X64O 5J2UB 3E83A 5IYBO 1SKVA 4DV6B 2HHHO 2RNBA 1PV0A 1DTOA 2M6YA 1HNWB 5BMVA 5JJNB 4MW3A 4GKKO 5EK0A 2EBOA 1KECA 2DN9A 1ZAUA 2IW5A 1QR9A 4WCEV 1N34B 4RUEA 1Z2GA 1VQ5V 5BMVB 3STLC 3E8GA 2NLJC 1R3KC 1KB9F 4DR1O 1THZA 3CE2A 3CCVV 4DV7O 1N36O 1I7FA 1SQVH 4H37A 2RDCA 2YXHA 1N32B 3ZEDA 4F4LA 2JEUA 3GB7C 2UXBO 1G4YB 4B08A 4TV8A 4FM0A 5EBMC 4DR6B 4DO2A 3OD4A 3AG3C 1YTFD 3ML0A 3ZRWA 1V9PA 2HVKC 4JI3O 4BIOA 2ETNA 2QKAA 3L9DA 4XBFA 3ETDA 4I0XA 5AG2A 2H94A 1O9HA 2JK5C 3M99B 4LF5B 3ZRWB 3ZIAG 1J95A 4UB6Z 2WPDG 5CBGA 2GTSA 3H1LH 1JVMA 3VQWA 5FPOA 4I0XB 4PA6A 3LNMB 5JJJB 1LNQA 2V1DA 1KP3A 1D2DA 4PDVA 2JEXA 3RYHB 2CE4A 2XAGA 4G28B 4LFAO 4WFGA 4BAYA 2Q0AA 4B3MO 4MVMA 1PD3A 4R50A 2JS3A 1SQFA 1M57B 2KB1A 1BQ0A 3FKSG 4P2ZA 3DGEA 2P22C 5JWPA 2EJ7A 2IJHA 2AZ0A 3ZJZA 4J9YB 5KHGA 2LGWA 3UKMA 4H44B 3ICXA 4DR3B 2QJ1A 1SQBH 3ABLC 1VF6A 4J7JA 1VQKV 3RN4A 3OTOO 3OAAG 1Y76A 4HBNA 1CP9A 1K7DA 3THOA 4K0KO 4X9QA 3RW0A 3WB1A 5EBWC 3IJ4A 4EB6B 1PNLA 4IT5A 4JI4B 2UXDO 2CTWA 5JCOA 3T1HO 1Z5WA 4JGSA 2WA3A 4EKWA 4UCTA 4FVMA 1GN2A 3A2FA 4R8CA 2Q8VA 5B1AB 2F95B 2QTSA 1EZJA 3BABA 3ZHQA 3KZIZ 3MD0A 5LGTA 3B09A 2O57A 5CBFA 1KU9A 1J5EO 5H2FZ 5FPRA
chains in the Genus database with same CATH topology
5KAFZ 4UB6Z 5KAIZ 3A0HZ 1S5LZ 5TISZ 3JCUZ 5B66Z 3A0BZ 4IL6Z 3KZIZ 5GTHZ 5B5EZ 4PJ0Z 5E79Z 4UB8Z 5GTIZ 2AXTZ 5H2FZ 3WU2Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAF Z;  4UB6 Z;  5KAI Z;  3A0H Z;  1S5L Z;  5TIS Z;  3JCU Z;  5B66 Z;  3A0B Z;  4IL6 Z;  3KZI Z;  5GTH Z;  5B5E Z;  4PJ0 Z;  5E79 Z;  4UB8 Z;  5GTI Z;  2AXT Z;  5H2F Z;  3WU2 Z; 
#chains in the Genus database with same CATH topology
 5BR8 O;  3R65 A;  3G80 A;  1VQ4 V;  2F4V B;  3C90 A;  2ZXW C;  2Z3Y A;  4JAA A;  5IWA O;  4DR3 O;  4D7S A;  3SYO A;  2KG7 A;  2ZIM A;  1EBO A;  1N8R W;  1AB3 A;  1YF2 A;  3SDL A;  2FKX A;  5LYJ A;  1W0J G;  1PNK A;  1JR9 A;  2EJR A;  1ORQ C;  2EIN C;  1ZX3 A;  4ASU G;  4YY3 B;  4CH4 A;  3BFR A;  4IGG A;  3HR0 A;  1S72 V;  1Q86 W;  1OCZ C;  4GKJ O;  3U10 A;  1R3I C;  2Y0P A;  1I94 O;  4YXW G;  5LGU A;  3E89 A;  4MS2 A;  2OWO A;  3ASO C;  1MSD A;  2ADP A;  2P7T C;  5LHH A;  3W7X A;  4U3J B;  1NR1 A;  3HKE A;  3LDC A;  2ZIN A;  1OJH A;  3SYC A;  3U11 A;  4DV3 B;  3CRA A;  4Z2W A;  2ADQ B;  2VQF O;  2UUC B;  4K8Z A;  1IDS A;  3HKE B;  3SPJ A;  4KUM A;  1Q81 W;  3QO7 A;  2QR4 A;  2YI9 A;  1U96 A;  1HDJ A;  1M93 A;  1FFT B;  1KKD A;  3G6E V;  1Z5V A;  2OCC C;  2NR5 A;  4HNA A;  2V4D A;  5KX5 A;  4DUY B;  3J80 N;  4CZZ A;  1XUQ A;  1PKX A;  4DW1 A;  1WAZ A;  4QJF B;  5KX5 B;  2WLH A;  3L71 H;  4BW5 A;  4J41 A;  4U7O A;  3BA9 A;  2JDI G;  4BWA A;  2P4K A;  1FXH A;  3CX5 F;  3K9A A;  1KUQ A;  2Y0I A;  3CC2 V;  1WLE A;  5GTI Z;  3FX7 A;  5IJ0 A;  1WP8 A;  3QO8 A;  3ABM B;  2CGN A;  2JS5 A;  2W0F C;  4PA7 A;  2B1G A;  3CD6 V;  2D2C B;  3WG7 C;  5IJ0 B;  2CTP A;  1HWY A;  3OGI B;  1F4M A;  1YZB A;  4E2L A;  4JI1 B;  3R66 A;  2XAQ A;  3T4Z A;  1NS1 A;  2E5L B;  2DWE C;  1L8D A;  4UCS A;  4TWK A;  2LP7 A;  3SPH A;  4UCU A;  3ZHV A;  2AZ2 A;  3DC5 A;  4JAV A;  3F7V C;  4PI2 A;  2A7W A;  4FM2 A;  3JAT B;  3AG4 B;  4FIP C;  5HFM A;  1PL4 A;  3B40 A;  3F7Y C;  4DR5 O;  1NZ6 A;  5H6R A;  1HNZ B;  4DK0 A;  4LF6 B;  2N74 A;  1NQT A;  2GTA A;  2QM4 A;  1K4D C;  4JYA B;  2Y69 B;  1K33 A;  1W0K G;  1QLE C;  3ZX6 A;  1JQ0 A;  5CA0 A;  5KAF Z;  3B77 A;  1QU7 A;  1OHH G;  2Q73 A;  3ASN B;  1Y4M A;  4KXR A;  5H9C A;  2VWJ A;  5CA0 B;  3L75 H;  2WAM A;  4JI7 O;  1XDC A;  2ZE6 A;  1E79 G;  3APO A;  4PA9 A;  2DYR C;  3CC4 V;  2BTO A;  2X7R B;  1N0J A;  3H1K H;  4N21 A;  1I08 A;  2UXC O;  3DXR A;  2CTQ A;  3K03 A;  4K3A A;  5EZY A;  1JPX A;  2EZO A;  2PTM A;  1DGS A;  1GM7 A;  2Y4T A;  4QIW F;  1AP5 A;  2QEX V;  4U7N A;  3CPW U;  1Q8I A;  2Z0A A;  3C3T A;  3DXR B;  4KL1 A;  5EZY B;  3MHS C;  3OGC C;  1W59 A;  3APQ A;  5KHI A;  4BIU A;  1AI6 A;  5LOV A;  2Q7E A;  3ZCC A;  1SC5 B;  1TUE B;  4NXM O;  4JTC B;  2EZP A;  1XMO B;  1YHQ V;  3H01 A;  2Q69 A;  1ZL8 A;  5LOV B;  2QTO A;  1QR8 A;  4IYH A;  1KBH A;  1GH6 A;  2KQX A;  3EFF K;  4O4H A;  3OMA B;  1H8H G;  4TSF G;  4LR3 A;  2EIL B;  3JSN A;  1ZL8 B;  4XDK A;  4DR7 B;  4MVS A;  1FD9 A;  1T5E A;  5JVD B;  1YJN V;  3X2Q B;  3T1C A;  1WA8 A;  1UPG A;  3N2K A;  5BZB A;  4UVB A;  4IHJ A;  2H8P C;  2DMX A;  5E79 Z;  3H1J H;  1BZK A;  3CRQ A;  1FYJ A;  1WA8 B;  4LCU C;  1XRE A;  4BW9 A;  4UCR A;  2UU9 B;  4IHJ B;  2JVD A;  4JYY A;  4TV9 B;  1IBL B;  1CXZ B;  2WLL A;  1XMQ O;  2DYS C;  3ZMU A;  2LW7 A;  4OX9 O;  1YDX A;  4FFB A;  3KCX A;  3N2G A;  4MSW C;  2KKW A;  4AHC A;  4MTF A;  3FFQ A;  4LF8 O;  4ZHQ A;  4FFB B;  3N2G B;  3GWK C;  1XQ8 A;  3G67 A;  2VQE B;  4ZHQ B;  1K5S A;  1EN6 A;  4NTX A;  4B3S B;  4JTA B;  1NI8 A;  3JAS A;  4ZIB A;  3WB0 A;  1IBK O;  2IJI A;  3KCY A;  4DV1 O;  5KUK A;  4YJ3 A;  4X64 B;  4B3T O;  1L0N H;  1Y74 A;  3JAS B;  3D36 A;  2HHH B;  1JFF A;  1D5A A;  5FNV A;  3TXQ A;  1RPR A;  4G27 B;  4YJ3 B;  3K57 A;  1QBZ A;  2F43 G;  4FLX A;  4GKK B;  1M56 C;  1Y74 B;  1SQX H;  1K73 W;  1BCC H;  2ZR2 A;  1JFF B;  4TOI A;  2ZNI A;  3CCU V;  2XUM A;  3LSQ A;  4FLW A;  5IYZ A;  3W7U A;  4GX2 A;  3K5M A;  4O2B B;  2DE0 X;  4DR1 B;  2Q7H A;  4LH7 A;  4DXW A;  3AG1 C;  2K1E A;  2Q4P A;  4DV7 B;  3SJC C;  1N36 B;  4LNU A;  4FMT A;  4JI8 B;  3B8M A;  2YI8 A;  2ODM A;  1AI4 A;  4BR6 A;  1R3L C;  1RPO A;  2XAH A;  1I5X A;  5FLX N;  2G38 A;  1NBM G;  5B1B C;  1GRJ A;  3W7W A;  1TUB A;  3SGI A;  1XOU A;  4LNU B;  2UXB B;  2VRZ A;  3OEE G;  3LNN A;  5LP6 C;  1QCE A;  2BOC C;  2JGD A;  1B06 A;  3AK2 A;  4JV5 O;  2E3C A;  1XEQ A;  3PN1 A;  3H1H H;  5DM6 V;  3N27 A;  3AG2 C;  2JGD B;  1OCC C;  4JI3 B;  4FLT A;  4FLZ A;  3H9V A;  3DTU B;  2UXX A;  5KHK A;  1HR0 O;  5CB4 A;  2ZR3 A;  1GN4 A;  4O4L A;  3P3N A;  4JYB A;  3B4S A;  4HAM A;  3CRM A;  3QNE A;  4WFE A;  3OM3 B;  5CB4 B;  2IU0 A;  1FXV A;  5LL6 Y;  4NYK A;  4MTO A;  4DV5 O;  3MDS A;  3I55 V;  2QWR B;  1OCR B;  1V54 C;  1Y67 A;  1S5L Z;  4LFA B;  2GHY A;  4B3M B;  4C7U A;  4Q20 A;  2QWP B;  4RWU A;  4JI8 O;  4ZBM A;  3K08 A;  2Q5Z A;  1NTZ H;  2EIM B;  3AG3 B;  2R70 A;  3JD2 A;  3JD3 A;  1G1X B;  1D5N A;  2B9Z A;  4G2K A;  4D6T H;  1F23 A;  2RJZ A;  4N23 A;  1BHA A;  3WFV A;  5GW7 A;  1EM1 A;  4MVR A;  3T1Y O;  2DOS A;  4DW0 A;  4TV8 B;  5H6Q A;  2Q7G A;  3OUF A;  3OTO B;  4UCO A;  5B1N A;  1GAX A;  4X1I A;  1FJG O;  1Q6U A;  4W4K A;  1AR1 B;  1EZV H;  4K0K B;  2VWK A;  4UVC A;  4YIO A;  2IBZ H;  4X1I B;  4WFH A;  2UXD B;  2HEP A;  3T1H B;  1K3E A;  1BQZ A;  1VEW A;  4WF9 V;  1S76 D;  4MVO A;  2PZS A;  3G4S V;  1SQG A;  1YIJ V;  2CK3 G;  5BXZ A;  5IY5 C;  4O4J A;  3CXH F;  4Z1V A;  2L35 A;  1SES A;  1GO3 F;  3KG2 A;  5CA3 A;  2PYL A;  2EIJ B;  5B3S C;  3F5T A;  4XDL A;  3OEH G;  4O4J B;  4I9Q A;  3HKD A;  1J5E B;  1ZTE A;  5BR8 B;  3ABL B;  1YJW V;  1AR4 A;  1TVK A;  3TET A;  2OTL V;  1PL0 A;  4FZ1 A;  4FPP A;  2ZM6 O;  1ARO P;  2FYU H;  4P30 A;  3AG7 A;  5IWA B;  2AXT Z;  1IXM A;  3OMN B;  2E74 B;  1BGY H;  1VF7 A;  4JI0 O;  4EFE A;  4J7K A;  3JSL A;  4J80 A;  1S5J A;  2PYJ A;  1N33 O;  1NVP B;  5TIS Z;  2WLJ A;  5H5N A;  1VQP V;  2YXY A;  4PDL A;  2HLD G;  1Q82 W;  1AI5 A;  1RM1 C;  1Y76 B;  4J42 A;  4GKJ B;  2GDS A;  1I94 B;  4TT3 G;  4RAI A;  5LBQ A;  4DV0 O;  4LFC O;  4LBE C;  5A9G A;  1GM9 A;  4NVP A;  1KYO F;  4CS3 A;  4WFA V;  2VQF B;  3CCQ V;  4DK1 A;  2ZDI C;  5LMN O;  2RN9 A;  4XDJ A;  3RVZ A;  4JI5 O;  4JI6 O;  2YUA A;  1YTF B;  1ZUQ A;  1OCO B;  4UV9 A;  1NH2 D;  3U0Z A;  3JCU Z;  1YXB A;  3ZRV A;  1CPY A;  2EX3 A;  2EUL A;  2B1I A;  1K5Q A;  3O9O A;  3UCS C;  2M7W A;  1VQL V;  4GX0 A;  2WLN A;  1YEW A;  4KP4 A;  4FK5 C;  2XHB A;  1EN4 A;  5B1A C;  3GVM A;  4PA3 A;  2KG7 B;  4GCZ A;  5LGN A;  2OCH A;  2JGU A;  5LYJ B;  1JCH A;  3K59 A;  3B2E E;  1QQC A;  1H8E G;  2AGA A;  4IIJ A;  1AJN A;  1VMG A;  4JPR A;  1H2K A;  3RBZ A;  1SZX A;  2PI4 A;  3CSX A;  5J2T A;  4IIJ B;  2YIB D;  3K58 A;  1MNG A;  1PNM A;  3OE7 G;  4LF9 O;  1KC8 W;  3STZ C;  1AP6 A;  5J9P C;  3G6B A;  5J2T B;  2KSD A;  4FJC C;  1YJ9 V;  4X20 A;  2PY5 A;  3DSQ A;  3L70 H;  3OW2 U;  4PI0 A;  2HJD A;  2ZQM A;  4DR5 B;  2XOK G;  4GT1 A;  4QPK A;  3RWR D;  1XHZ A;  4HNA B;  4X20 B;  4B3R O;  2UXN A;  2DWD C;  2PGG A;  1FS0 G;  5LXT A;  4EEQ A;  1XNQ O;  4DYL A;  1RSO A;  3CC7 V;  3FYI B;  2X6C A;  3J81 N;  3K0D A;  1BSM A;  3EHB B;  3WG7 B;  3RYF A;  4UB8 Z;  1B04 A;  5LXT B;  3G71 V;  3SPI A;  3J7A U;  1XL4 A;  3SJB C;  4JI7 B;  2DQ3 A;  3Q4H A;  4MVZ A;  1GTO A;  4J7Z A;  4AQY O;  3OFN G;  4ICG A;  1P84 F;  1KMI Z;  3OMI B;  3MHH C;  4MTG A;  1S3J A;  3Q4H B;  4UXN A;  3K06 A;  1NU1 H;  1FFX A;  2GSM B;  3CHX A;  2XT9 A;  2UUB O;  2UXC B;  2XAS A;  4RQE A;  3K79 A;  1FFX B;  4U3F H;  1MG1 A;  2MK3 A;  4X62 O;  3RFR A;  2BTQ A;  1PPJ H;  2A9H A;  1QLE B;  3LSS A;  4P9O A;  1OZ0 A;  3ZHU A;  4AIL C;  2CUG A;  4NXM B;  3SJQ C;  3TXS A;  4I50 A;  4RQF A;  1JX9 A;  2BTQ B;  3NXS A;  1BMF G;  5IDJ A;  2DYR B;  1F7Y A;  2A0L A;  3E35 A;  1WNS A;  1I0H A;  5KMG A;  2NNU A;  1K4C C;  2XAJ A;  3RYI A;  1N4C A;  1YSC A;  1B3Q A;  1VF5 B;  5EYP A;  5CN0 A;  5KUM A;  4PJ0 Z;  4UFZ A;  5KMG B;  2MW2 B;  2F23 A;  3T4D A;  3ETE A;  1XBL A;  1SQP H;  2R9A A;  3RYI B;  1G8M A;  1QVG U;  2ZE7 A;  4LF7 O;  1Q6H A;  2YID A;  2P5O A;  3D3I A;  4JZ2 A;  3ZHR A;  2LFR A;  5L3C A;  1VQ6 V;  1MOF A;  3CB2 A;  2AHZ A;  1COW G;  1YI2 V;  4DR4 O;  2QDO A;  4X1K A;  4NTY A;  1XMQ B;  4OX9 B;  2UUA O;  2F1M A;  2IH3 C;  3FB6 C;  1V55 B;  1AVM A;  3QF7 A;  4X1K B;  4FLU A;  4LF8 B;  4QE7 A;  3ZRS A;  4YHH O;  5KA5 A;  5L3G A;  1X4T A;  3ZRX A;  5IYD O;  1URF A;  1S0V A;  1VQ7 V;  4E4E A;  2OYQ A;  2RQ6 A;  5EC1 C;  5B1O A;  2RCV A;  1I5Y A;  1IBK B;  4DV1 B;  4RO2 A;  3HKC A;  3E8H A;  1O9G A;  4B3T B;  3UO3 A;  3E2E A;  4O4H B;  3ZBH A;  2V7Q G;  2XTA A;  1AJP A;  3JYC A;  1QNM A;  5IT9 N;  2HVJ C;  1XNR O;  1KD1 W;  4PA4 A;  2YIA A;  1P49 A;  2P67 A;  3CP1 A;  1GN3 A;  3N2K B;  4DV4 O;  4DR2 O;  3JAR A;  2Q0O C;  1R6N A;  2ZCE A;  1MZF A;  4L87 A;  4OPH A;  1L0L H;  1VQM V;  3CJH A;  2BCC H;  4IL6 Z;  3JAR B;  2WLK A;  1M4U A;  4X8A A;  4KHP O;  2QA4 V;  2BE3 A;  4X89 A;  3CCE V;  2WLL B;  3CJH B;  2D3O W;  4CBC A;  4P9P A;  1L1F A;  1NR7 A;  2CAZ C;  1FXK C;  4JV5 B;  4GZR B;  5LA6 A;  2ZIO A;  4MVQ A;  3I56 V;  4NKG B;  4CC5 A;  4HYO A;  1NT2 B;  1H2M A;  5E1A C;  4UUJ C;  4LF4 O;  3OR7 C;  4ZI7 A;  3K04 A;  5LA6 B;  4OXS A;  1BHB A;  2CH7 A;  1WB7 A;  5KA6 A;  2EIK B;  1Q3E A;  4NXN O;  5EBL C;  2IJK A;  1HR0 B;  1K9M W;  4X1Y A;  1K8A W;  1DF5 A;  4ZI7 B;  3NR7 A;  2PI5 A;  2CH7 B;  2A3Q A;  4JF3 A;  3AG1 B;  1WN7 A;  5FNV B;  2R72 A;  1Q90 D;  1NKD A;  3OUS A;  4I5S A;  4ABM A;  5B5E Z;  4JAU A;  4DV5 B;  5B1B B;  4X66 B;  1JOY A;  1WPB A;  1JMK C;  2YC0 A;  4OGQ B;  2Y48 A;  1WPX A;  1H2L A;  5IYZ B;  5JH7 A;  1IX9 A;  2FML A;  3ABK B;  3ZHT A;  5L3D A;  3BRC A;  4MTX A;  3H1I H;  5HFL A;  5JH7 B;  4MW8 A;  1UJW B;  1IXB A;  1DLB A;  5GON A;  4CH5 A;  5LHI A;  1TUB B;  4CH3 A;  3T1Y B;  1IBM O;  2QSA A;  2HJF C;  3A8T A;  3ZHS A;  2OTJ V;  1FJG B;  5D5Q A;  4H13 B;  1Q43 A;  1SA0 A;  3WB2 A;  4TUY A;  1V54 B;  3JAW A;  3F5W C;  1ZSP A;  2YEV A;  5J2U A;  1PM9 A;  1MA1 A;  2C2A A;  2WA4 A;  1SA0 B;  4I9W A;  1QHT A;  4CS4 A;  3CCL V;  3JAW B;  3CME V;  1FAF A;  2YEV B;  3ETQ A;  3UO2 A;  1R1B A;  4O4L B;  4LFB O;  3BCC H;  4X66 O;  3BY6 A;  3P3P A;  5B66 Z;  1U97 A;  3C3S A;  3P32 A;  4GX1 A;  1UFI A;  1NVP D;  3CRC A;  4TQD A;  2Z5U A;  1EFR G;  3SYQ A;  2W0X A;  3CS5 A;  1FPO A;  4DUZ O;  1VIB A;  1HNX O;  4L8J A;  5LMU O;  2ZM6 B;  3TK1 A;  1M1K W;  4JI2 O;  1JA8 A;  3AEI A;  1RP3 B;  4PV1 B;  3BA8 A;  3CCS V;  4JI0 B;  1AIL A;  3K5N A;  1BS3 A;  1OCR C;  1N33 B;  3IAY A;  1F4N A;  2LGQ A;  4PDR A;  3IGA C;  2ITD C;  4UCV A;  5ITZ A;  2FL4 A;  5IY5 B;  5IYC O;  1GN6 A;  1B6Q A;  3S3X A;  5L3F A;  1F51 A;  3W7S A;  2EIM C;  2BOB C;  1TAE A;  5B3S B;  1KKC A;  2FB5 A;  5ITZ B;  4O2A A;  4PHZ A;  4JTD B;  4DV0 B;  5KHJ A;  4LFC B;  2LFS A;  2IU3 A;  2RMK B;  3EVK A;  4DV6 O;  2PF4 E;  4I55 A;  4DV2 B;  4O2A B;  2GBO A;  4J9Z B;  2P90 A;  3AK1 A;  1HNW O;  5LMN B;  2LQT A;  4BIZ A;  4F6E A;  1MAB G;  4X88 A;  1AR5 A;  2ITC C;  3RYH A;  4I55 B;  4JI5 B;  3VQY A;  4JI6 B;  2CDY A;  2BSK A;  3TGU H;  1N34 O;  3K9S A;  4H33 A;  2X6A A;  1K92 A;  3SYA A;  1GK9 A;  3K5L A;  2ZNJ A;  3HKD B;  2W6J G;  2BSK B;  3JAL A;  3BEH A;  1TVK B;  1RM1 B;  5CMU A;  3FB7 C;  4FLY A;  1N32 O;  3OTF A;  1JJO A;  2IM9 A;  2JIZ G;  4DRX A;  3JAL B;  4PDM A;  2Q9L A;  2EIJ C;  2ZDI A;  5GTH Z;  2QE7 G;  4JZG A;  1SQQ H;  5DEC A;  4DRX B;  4DR6 O;  1M57 C;  4NR1 A;  2FTK A;  2QWO B;  3L74 H;  3KKY A;  3W7T A;  1ZWI C;  1EN5 A;  4EB6 A;  1IVS A;  3P30 A;  3I5D A;  4LF5 O;  4DV2 O;  1ROP A;  4W4L A;  2ZXW B;  4LF9 B;  5LHG A;  1M90 W;  3SR2 C;  3OT7 A;  4H0L B;  5IE9 A;  5L3E A;  4FLV A;  3K3W A;  1VF6 C;  5F2V O;  4F6R A;  3ETG A;  4QNH B;  4RUF A;  3MAQ A;  2ZKO A;  2ZD9 A;  2EIN B;  4YJ2 A;  4Z1M G;  4UV8 A;  5JQG A;  2AW9 A;  1M5I A;  1Y6X A;  4B3R B;  4F6R B;  2ZE8 A;  1H38 A;  4QE9 A;  1OCZ B;  2PUS A;  4QGP A;  1XNQ B;  3GWO A;  2K9P A;  4YJ2 B;  5JJE B;  5JCO C;  5CBH A;  2Q6A A;  3HPL C;  5JQG B;  3JAM N;  3FD9 A;  2Y4U A;  3ASO B;  5IJ9 A;  1RFY A;  1BT8 A;  3E22 A;  3CRR A;  2GUZ A;  1NTM H;  3CYO A;  1P7B A;  2Y69 C;  5IJ9 B;  5K1P A;  4AQY B;  1OCO C;  5L3B A;  3E22 B;  1H2S B;  2GUZ B;  2Q68 A;  1LUW A;  3E86 A;  1TA8 A;  2X0L A;  1KP2 A;  2OCC B;  1R73 A;  3ZMT A;  2CTR A;  2ZE5 A;  3UT5 A;  2UUB B;  4FM1 A;  2WSS G;  2HR3 A;  1MZE A;  2N05 A;  2P06 A;  4U3J A;  2X6B A;  4JI4 O;  1E1Q G;  3A0B Z;  1SET A;  5BY1 A;  1KQS U;  1IZ3 A;  1FKA O;  3UT5 B;  1NJI W;  2YDE A;  4X62 B;  1R6K A;  4AI8 A;  2Q67 A;  4JAS A;  1AI7 A;  1R3J C;  2GV9 A;  2OIE A;  3DC6 A;  4UVA A;  4K8X A;  1YVW A;  4HZ3 A;  5C93 A;  1H2G A;  3UQ8 A;  4R7C A;  1XI1 A;  2F4V O;  1SRY A;  3JD1 A;  5CA1 A;  1RSO B;  3S3W A;  1WB8 A;  2WWW A;  1X59 A;  1OV9 A;  3HB3 B;  3JAK A;  3RVY A;  1MMM A;  3RYF B;  3VQV A;  3TJT A;  3BPZ A;  2LJ2 A;  1YIT V;  5CA1 B;  1A32 A;  4LF7 B;  3EXA A;  1VAR A;  3JAK B;  4YY3 O;  4MT8 A;  4KFM A;  3BVO A;  4Q6G A;  2HKO A;  3BAA A;  1NH2 B;  1M9N A;  3RGB A;  4DR4 B;  3CCR V;  4GYC B;  5KAI Z;  2JJ1 G;  2YSU B;  2ILM A;  1Q7Y W;  2QM8 A;  2UUA B;  3VOU A;  3M7M X;  4DV3 O;  3ZN0 A;  5DED A;  3ABM C;  2UUC O;  2H3O A;  4YHH B;  4GUN A;  1SF9 A;  3JAT A;  4JYC A;  2QWN B;  3ZMS A;  1P7G A;  1WP7 A;  1DF4 A;  4OPA A;  1VQ8 V;  2DJV A;  5DN6 G;  4I50 B;  4EFB A;  4MVU A;  2YIB A;  4DUY O;  1IUR A;  1GKF A;  3CMA V;  1HW7 A;  4QPJ A;  3K0G A;  1W2B U;  3PJS K;  2JRI A;  3WU2 Z;  2YIC A;  3AG4 C;  5EYP B;  1GMG A;  1P4R A;  2YXL A;  3LDD A;  5EIB D;  4PD4 F;  1XL6 A;  2XND G;  1TGO A;  1XNR B;  4FZ0 A;  4B7K A;  3QG5 A;  3ZS8 C;  4DV4 B;  4DR2 B;  3CEI A;  3T2M A;  2WLM A;  3IC9 A;  3ASN C;  1NTK H;  2XAF A;  2ATK C;  4GX5 A;  3AK3 A;  2OIG A;  1BE3 H;  3QVN A;  3M8A A;  1PP9 H;  1MSW D;  4KHP B;  4JI1 O;  1XIL A;  1AJQ A;  2YS8 A;  3B8N A;  3FYE B;  3RYC A;  1K97 A;  3QTC A;  2E5L O;  2HP8 A;  4IYI A;  2P4V A;  1G6U A;  2AHY A;  3RYC B;  2ZT9 B;  4PEL A;  2R9R B;  2B5U A;  4O4I A;  3SJA C;  3IFX A;  3ABT A;  2L6L A;  2IH1 C;  4LF4 B;  2F66 C;  1HNZ O;  5KLV H;  4LF6 O;  2DW4 A;  5C8Y A;  3JCZ A;  4GLX A;  4J10 A;  4O4I B;  4JYA O;  4NXN B;  1US6 A;  1V55 C;  3HKC B;  1QLN A;  2E76 B;  1QVF U;  4WBN A;  5C8Y B;  5JVD A;  4I4T A;  4J11 A;  2DYS B;  2E75 B;  4A5U B;  2ARH A;  2NN4 A;  3VQX A;  4WBN B;  4X65 B;  1FXK A;  4I4T B;  3O65 A;  1S5H C;  3FB5 C;  4K35 A;  4YIP A;  2EIL C;  3SYP A;  5EC2 C;  3JD0 A;  1FXK B;  4NB5 A;  4WFB V;  3TCU A;  3FAV A;  1Q5O A;  2OT5 A;  4TV9 A;  2F93 B;  3A0R A;  3X2Q C;  3E8B A;  1SS3 A;  1N0N A;  3FAV B;  3BHP A;  2QKS A;  2W6I G;  4CH6 A;  1LR1 A;  3SPG A;  5K1X A;  1R6T A;  1SZT A;  2P6J A;  1IBM B;  1K34 A;  4B7E A;  2A79 B;  1M56 B;  1DK1 A;  3IC7 A;  4LWS A;  1XMO O;  1GM8 A;  3CXC U;  3ABU A;  3ZMZ A;  2HFE C;  4CC6 A;  3VBB A;  3JD4 A;  1VQO V;  1HP8 A;  2DQ0 A;  4ZKI A;  3K5O A;  3ZN1 A;  1SER A;  4LWS B;  1XHX A;  2LO1 A;  3LUT B;  5EIB C;  1Y66 A;  2JJ2 G;  4LC1 A;  2QWQ B;  3D3Q A;  3HKB A;  4LH6 A;  4WFF A;  4DR7 O;  3LSU A;  4X1Y B;  2CGO A;  2QGN A;  3LDE A;  5LP6 A;  4X65 O;  2WLI A;  3OR6 C;  4CS2 A;  3QO5 A;  1VQN V;  2QKC A;  4LFB B;  3ZMV A;  3HKB B;  3CCJ V;  1CEZ A;  1ENV A;  4R6Z A;  3UM7 A;  5LP6 B;  2A06 H;  2WLI B;  1YCI A;  2LW1 A;  2VS0 A;  4O2B A;  3A0H Z;  3CWB H;  1LUV A;  2EIK C;  1Q6I A;  2N04 A;  1H2N A;  3L73 H;  3AG2 B;  4I7Z B;  2UU9 O;  1OCC B;  2IJJ A;  3D8C A;  4DUZ B;  5KHH A;  2QM7 A;  1HNX B;  5LMU B;  1IBL O;  4JI2 B;  3D36 C;  1JJ2 U;  1E1R G;  4TQF A;  1ZLZ A;  1BL8 A;  3SPC A;  3L72 H;  4NTW A;  1VQ9 V;  2R9I A;  4FFK A;  5GON B;  4ZOL A;  3RT3 C;  1WJZ A;  3CCM V;  2HG5 C;  2VQE O;  5FL7 G;  4LP8 A;  3FB8 C;  4B3S O;  4ZOL B;  3ABK C;  1VP7 A;  1S77 D;  5A2Q N;  4D7T A;  5D5P A;  4TUY B;  3E8F A;  4X64 O;  5J2U B;  3E83 A;  5IYB O;  1SKV A;  4DV6 B;  2HHH O;  2RNB A;  1PV0 A;  1DTO A;  2M6Y A;  1HNW B;  5BMV A;  5JJN B;  4MW3 A;  4GKK O;  5EK0 A;  2EBO A;  1KEC A;  2DN9 A;  1ZAU A;  2IW5 A;  1QR9 A;  4WCE V;  1N34 B;  4RUE A;  1Z2G A;  1VQ5 V;  5BMV B;  3STL C;  3E8G A;  2NLJ C;  1R3K C;  1KB9 F;  4DR1 O;  1THZ A;  3CE2 A;  3CCV V;  4DV7 O;  1N36 O;  1I7F A;  1SQV H;  4H37 A;  2RDC A;  2YXH A;  1N32 B;  3ZED A;  4F4L A;  2JEU A;  3GB7 C;  2UXB O;  1G4Y B;  4B08 A;  4TV8 A;  4FM0 A;  5EBM C;  4DR6 B;  4DO2 A;  3OD4 A;  3AG3 C;  1YTF D;  3ML0 A;  3ZRW A;  1V9P A;  2HVK C;  4JI3 O;  4BIO A;  2ETN A;  2QKA A;  3L9D A;  4XBF A;  3ETD A;  4I0X A;  5AG2 A;  2H94 A;  1O9H A;  2JK5 C;  3M99 B;  4LF5 B;  3ZRW B;  3ZIA G;  1J95 A;  4UB6 Z;  2WPD G;  5CBG A;  2GTS A;  3H1L H;  1JVM A;  3VQW A;  5FPO A;  4I0X B;  4PA6 A;  3LNM B;  5JJJ B;  1LNQ A;  2V1D A;  1KP3 A;  1D2D A;  4PDV A;  2JEX A;  3RYH B;  2CE4 A;  2XAG A;  4G28 B;  4LFA O;  4WFG A;  4BAY A;  2Q0A A;  4B3M O;  4MVM A;  1PD3 A;  4R50 A;  2JS3 A;  1SQF A;  1M57 B;  2KB1 A;  1BQ0 A;  3FKS G;  4P2Z A;  3DGE A;  2P22 C;  5JWP A;  2EJ7 A;  2IJH A;  2AZ0 A;  3ZJZ A;  4J9Y B;  5KHG A;  2LGW A;  3UKM A;  4H44 B;  3ICX A;  4DR3 B;  2QJ1 A;  1SQB H;  3ABL C;  1VF6 A;  4J7J A;  1VQK V;  3RN4 A;  3OTO O;  3OAA G;  1Y76 A;  4HBN A;  1CP9 A;  1K7D A;  3THO A;  4K0K O;  4X9Q A;  3RW0 A;  3WB1 A;  5EBW C;  3IJ4 A;  4EB6 B;  1PNL A;  4IT5 A;  4JI4 B;  2UXD O;  2CTW A;  5JCO A;  3T1H O;  1Z5W A;  4JGS A;  2WA3 A;  4EKW A;  4UCT A;  4FVM A;  1GN2 A;  3A2F A;  4R8C A;  2Q8V A;  5B1A B;  2F95 B;  2QTS A;  1EZJ A;  3BAB A;  3ZHQ A;  3KZI Z;  3MD0 A;  5LGT A;  3B09 A;  2O57 A;  5CBF A;  1KU9 A;  1J5E O;  5H2F Z;  5FPR A; 
#chains in the Genus database with same CATH homology
 5KAF Z;  4UB6 Z;  5KAI Z;  3A0H Z;  1S5L Z;  5TIS Z;  3JCU Z;  5B66 Z;  3A0B Z;  4IL6 Z;  3KZI Z;  5GTH Z;  5B5E Z;  4PJ0 Z;  5E79 Z;  4UB8 Z;  5GTI Z;  2AXT Z;  5H2F Z;  3WU2 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...