4UEMA

Uch-l5 in complex with the rpn13 deubad domain
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
Knots found
sequence length
309
structure length
281
Chain Sequence
EWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKRFNLMAIVSDRKMIYEQKIAELQRQLAESMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Uch-L5 Activation and Inhibition by Deubad Domains in Rpn13 and Ino80G.
pubmed doi rcsb
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE ISOZYME L5
molecule tags Hydrolase
source organism Homo sapiens
total genus 86
structure length 281
sequence length 309
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
A PF18031 UCH_C Ubiquitin carboxyl-terminal hydrolases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.860 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4uemA02
3.40.532.10 Alpha Beta 3-Layer(aba) Sandwich Ubiquitin C-terminal Hydrolase UCH-l3 Peptidase C12, ubiquitin carboxyl-terminal hydrolase 4uemA01
3TB3A 1UCHA 1XD3A 4UELA 3IFWA 4DM9A 2LENA 3RISA 2ETLA 4JKJA 3KVFA 3RIIA 4UEMA 3A7SA 3KW5A 4I6NA 1CMXA 4IG7A 3IHRA 3IRTA
chains in the Genus database with same CATH superfamily
3MZKB 1HG5A 3AEFA 2NOXA 3SRZA 4QWNB 2JQ9A 5FXZA 3KVBA 4QX8B 5LA6E 2IC9A 2LRKA 3PJAJ 3IF8B 5L47A 3NWIA 2D5UA 5JREA 3KW5A 2UXCT 3MXZA 3UU6A 5BMVE 5JDLA 1D0ZA 4I50E 4U7YA 2IW5B 2XY8B 2XAQB 3PUYF 3CIRA 5TAOA 1KNPA 4AKHA 4UV8B 1XMQT 4A97A 5A1LA 3ZYLA 4UF0B 2XAFB 2ODVA 4O4LE 5AQIB 4OK0A 2D9DA 3AE9A 5ABGA 2XJ7A 4PFPA 4CQIA 3C4XA 5AQLB 2E8IA 3RF1A 4X65T 3HR0A 4EEBA 3AEAA 4UVAB 3LK42 2VKJA 2X67A 1NENA 4H9OC 3QOFA 2WMOA 4G63A 5FY1A 4YLHA 1M7KA 2E9XD 2BVLA 5F8PA 4PJNA 2LHRA 2X0YA 5J2TE 1Z8UA 3LJCA 3P4RA 3AE6A 5LGTB 5JDHA 1QLBA 3C4ZA 3H3AA 4ZHQE 3EUHA 2JPFA 1SE7A 2VQET 3I9YA 3LK2B 2WSSV 3DTOA 3MKDA 1BR0A 1ZHCA 4IE0A 3UULA 4IE6A 4IDPA 3PE0A 2CWYA 4LF6T 3LSVA 4NXMT 5JDFA 5LMUT 2WU2A 1VRBA 3N5LA 3E0ZA 3ZMVB 5LJMA 1MMDA 3N9QA 5C8YE 3UU3A 4EXTA 2ZM6T 2CA5A 3VRAA 4PNIA 3AAEB 5LHGB 1ZP0A 2WMNA 3KV9A 4PFOA 2J4GA 4MFRA 4CXXA 3AXJB 1HX1B 4ILCA 3LBXB 2H7VC 4A98A 3I0OA 3TLTA 4TNVA 1KK7A 4G2AA 1U4QA 3Q9DA 2K48A 4X64T 4PAGA 3RC3A 4DM9A 3KV6A 4AKIA 2V5DA 3CQCB 4BAYB 3MK7C 3CX6B 3H37A 1MNDA 4H9SE 1I94T 4UELA 5HCJA 2A9UA 4DUZT 2QA7A 3ZKRA 2E2AA 2UU9T 4ZS2A 3AVRA 4ZZCA 1YKEB 4CZZB 4IGUA 1WR6A 4TN7B 2QGSA 1UK5A 4WW0A 4JLEA 3SFEA 5CB4E 4LF5T 3HL6A 5LMNT 4P0BA 3P8CD 5JR9B 3AE8A 2XQ5A 3RIFA 3ONLC 5GONE 2LM9A 4IE4A 1OEDA 4AQGA 3RIAA 2BVMA 4DR3T 2E9XB 2FJBA 2WM9A 3O1IA 2ZM8A 4WNKA 1FEWA 1MIVA 3KV4A 4ILBA 3K1SA 2X9YA 4TNWA 2PBIA 1QUUA 2V7LA 4MLKA 2V1DB 1Z0PA 4H9RC 5DABA 3ESLA 4HFIA 4PK6A 5JQGE 3AE2A 5AQUB 3MACA 2BDEA 1X79A 3QC9A 5LBQB 2ACXA 4KI0F 2N9DA 5FNVE 5FY0A 1D1BA 4NXNT 2KNDA 2F4VT 2R6GF 3FZFB 2M67A 4LMKA 3UUBA 2ETLA 2AE9A 4OX9T 2HN2A 5DQVA 3I9WA 4V1Av 3HA4A 3PU3A 4IHJE 2D0UA 2W4XA 3ZYMA 5DJQC 3N9NA 4TV9E 2XQ6A 2Y8DA 2MAWA 4YSYA 1ZKEA 4M1PA 2LSGA 3VR9A 3QNUA 2K24A 3IFWA 3AE3A 2BKNA 2JQQA 2HN1A 1I6ZA 2YDQA 3PUWF 4EIWA 2M6IA 1HNWT 3AEDA 1WYBA 2QRXA 5HEOA 4AKLA 4L0RA 2N2NA 5FP3A 1GQEA 2UUAT 4HGAA 4WZXA 2VKDA 4HE8A 3HI2A 4K0UA 1T98A 2Y6XA 4UIGA 4ZI7E 3RIIA 4AXPA 4YHHT 2B1EA 3H3MA 3SS1A 4E7SA 2CMRA 4OYKA 2WQYA 2KINB 2Y48B 2CEAA 4IL9A 4X62T 1HFAA 3Q5EA 2RP4A 5L3DB 2WS3A 1Y01A 4DV4T 2NR4A 2XTLA 4XZCA 1CMXA 2LKHA 2BS4A 2YK0A 2NW9A 1YQ3A 3QUJA 3AA0B 3OKQA 5LB7B 2PFVA 4U33A 2C0SA 2PG8A 3V5UA 4TZ4C 3N2OA 3RYCE 4ADZA 4OYJA 2W62A 4X1YE 1T8BA 2BZBA 3NBXX 5EK3A 1LVFA 4DO0A 5H6QB 5LJNA 4ISTA 3ANWB 4DV1T 4C90A 2UXDT 4HWIB 4CI2B 1YXRA 4DMWA 3AEEA 2VKHA 1M62A 2BG9B 2XHEB 2CLYC 1G73A 5ABEA 3O1HA 2VL0A 3K3NA 4JEUB 3N2KE 2JQKA 2E5LT 4DV6T 1KEYA 1J1JA 4LMLA 3Q5WA 2C5KT 4P0AA 3GN5A 2NTYA 4ILUA 4YJ3E 3O9XA 2MBGA 1J5WA 2W00A 2XSBA 3A5XA 3EVYA 4NUVA 3OBVE 4X1KE 4ASKA 1W9RA 5CGMA 2GK9A 2A72A 5AQTB 2CRBA 5CJ5A 3RYFE 1FMWA 4KBMB 3LG7A 4P1NA 2WP9A 3ZJ1A 5E0OA 2ZLYA 2IDOB 2XM2A 3X1DA 2L3LA 2W63A 3IBPA 3F31A 3JC6C 4U31A 5J1GA 4QH1A 4X66T 1CHUA 4GKKT 2WDRA 2Q9QC 1JNRA 4IREA 4IDNA 2BS2A 2C5IT 4TX5A 3RYIE 5AQNB 1IBMT 2ZM2A 3B13A 2K3WA 2X68A 3UT5E 5HEHA 4ZZBA 1U5PA 4I55E 3N9LA 3QK6A 3TKLB 4IT4A 2FBWA 5LBMA 4IDZA 4OFZA 1OEDC 5FL1A 1FIOA 3ONJA 2LENA 3ZN0B 3KVAA 3NZPA 5LP6E 4Z91A 4CN6A 5LGNB 2LEHA 1XDOA 5AQPB 4ANJA 1AJ3A 4JYAT 4TWFA 4DBQA 1OEDE 2BBHA 3KDSE 2DNXA 4DR7T 5HEUA 1UURA 3PURA 2V5CA 4KUMB 4O2AE 3UUMA 3S4UA 2BBJA 1LRZA 2NWBA 1HF8A 3G06A 4LFBT 3FB2A 2C5JA 3OTOT 4HEAA 2LLYA 2IUBA 3C98B 4ZXLA 3C50A 1E2AA 3FBLA 5KX5E 3M3ZB 2WU5A 1ZOYA 1MIYA 1UGOA 3JCFA 1NEKA 4YTPA 4PW8A 2LOSA 2BKPA 2PTFA 1QSDA 1ZV4X 1OXZA 3BQKA 4JUYA 4U2ZA 3U3IA 2VVSA 2CWOA 2X0LB 4I6NA 3K8PC 1LVKA 1BR2A 4QH4A 4CN4A 3VHLA 4YY3T 3AB3B 2W61A 3T8OA 3K3OA 1L0VA 3EHZA 5IUXA 2MOZA 3A7SA 2LKGA 2LSJA 4Z90A 2RA1A 5LNKA 5LG3A 1YD8G 1S35A 3CVRA 1XNRT 2W67A 3PUXF 4HN9A 4K0KT 2BKOA 2V7IA 5AQMB 5FYMA 5JDGA 2WCAA 4DVDA 3AA7B 5KDMC 4IE5A 1VOMA 2Q9QA 4U7IA 3TLSA 1X9BA 2LSYA 3CQGB 5JTGA 2WB5A 1D0XA 4LFAT 3PDYA 2SPCA 4LMJA 4I0UA 4AISA 3SWHA 1MMNA 3ZMTB 3SFDA 3K3QC 2W2UA 2CBIA 1UX4A 2FJDA 3P4WA 3FZMB 3W15B 4YSXA 1B7TA 4EEDA 3EDVA 5HEGA 4ILAA 4HFBA 4A5XA 5ABFA 5FL0A 3VRBA 3OPCA 1KNZA 4X20E 3ZMZB 2VVNA 4YFSA 3RRCA 4DNDA 2WDVA 3LDQB 2M6BA 4XBFB 4DV2T 1US7B 4BJMA 4UVCB 5IWAT 3AE7A 2DLRA 5LHHB 4TV8E 4DIDB 3UU8A 4DV5T 3AA6B 4DV0T 2Z6EA 1E7PA 2UXNB 2V6YA 2OA5A 4GKJT 2J47A 2ZM0A 2ACZA 5JR9C 2J62A 4LF7T 2CXDA 2E5VA 2YN6A 4TWDA 4YTNA 1YQ4A 2V7KA 4DV7T 3CWZB 4WYVA 1MMAA 3ZSTA 1XDPA 1V9DA 2QYWA 2LE8A 3O4XE 1EZ3A 5HWXA 2OLTA 2XZEA 3RKOA 4JKJA 3P7IA 4FJOA 5JVDE 4EOZB 2VQFT 5HCMA 1IBLT 3ZCIA 4AIUA 3JC6D 4QH5A 2LT3A 2DWKA 2Q9QD 2G0UA 3RPUA 3P4QA 4IDOA 2H88A 3BQIA 2UUCT 3RYHE 2HPJA 2XPKA 4QX7B 4H9QC 2DL1A 1VCSA 4AKGA 4COFA 1NAFA 4AKRB 4XAXB 1WLXA 3P4PA 5AQKB 5J2UE 5L2LA 5FVLA 2BS3A 4CI3B 3ZMSB 3T1HT 3VKHA 5JH7E 4HFCA 2YU2A 2FJEA 1MIWA 4UEMA 1HR0T 1UUSA 2MPKA 3J9X1 4JI8T 1ZEEA 3TLUA 4DMVA 2LM2A 4PJJA 1G8XA 2WAUA 3AAAB 1D0YA 3VU7H 2XSAA 4B3MT 1W0AA 2V7MA 1J5ET 5JRCA 5M4YA 1N34T 2KLQA 4NIQA 2KWIB 2A3DA 4HFVA 5EK4A 4JI3T 3AXJA 1D1AA 3DJBA 1JNZA 1WFDA 5AQRB 5F5WA 2CM0A 3M65A 2IIUA 2DHRA 4DBRA 2KWHA 2V6XA 2CLYB 3E22E 4BJNA 4GYRA 4L9IA 4E7ZA 4IG7A 3UU5A 4KHPT 1Y64B 1WYCA 1OWAA 4U72A 4BA9A 5HWYA 4JI2T 4JI6T 3OYZA 3RH3A 4LF8T 1SHZC 2XQ8A 2LHNA 4X5TA 4PK4A 4KMCA 5LXTE 3RI5A 4HTEA 1MMGA 2JMHA 2ZMAA 3ZMUB 2XAGB 2VKOA 4GYSA 2IAKA 2HPLA 4IDQA 4Z8XA 3LFMA 3NRYA 4U74A 4FI5A 4HFHA 5L4HA 3IHRA 4DR6T 4GK5E 2Q9QB 4P09A 3RX6A 5JR9A 2HH7A 3AEBA 4PJMA 3WAKA 1N33T 3C64A 2DI4A 4GK0E 4CXWA 5L3BB 3CX7B 3C51A 4MBQA 2X9HA 5HXCA 2BG9C 3RQWA 3P50A 3ZEFB 1HNZT 1LKXA 5LGUB 2CE7A 3FZLB 3A8YC 4ISSA 5FMNA 4YJ2E 1YW0A 3RGLA 1OEDB 5ABFB 2NTXA 1NWMX 2CHOA 5H6RB 2LJLA 3L39A 1UCHA 2JQHA 2P9BA 2K5BB 1N32T 3C4WA 4UV9B 1H7CA 1S94A 4JI1T 2V7JA 5AQHB 4OHFA 5HYAA 4NPPA 3IA3A 2JRKA 1YKHB 3ZC0A 2EHOC 5AQOB 4ERRA 2OV9A 5KXJA 3AVSA 3OYXA 2X51A 4B6XA 2VL8A 2V6YB 2I6HA 3FXEB 4F8HA 4DR5T 4YT0A 3BQLA 4CN1A 4Q25A 1WRDA 3RRWA 4I43B 2NP9A 3NVOA 5FKYA 4ZI2C 4B3TT 1N36T 4I4TE 4O4JE 1CUNA 3QB5K 5LYJE 2DWGA 2PJQA 5CA1E 2XAHB 4J2CA 4L5GA 2IHR1 4HFDA 4IIJE 5LCYA 1UCUA 5LOVE 3FXDB 1E1HB 2KSRA 3ONXA 5ADXL 3ZSSA 3PTRB 2CPTA 5HXRA 2I59A 4TWHA 3UQ4A 5ETWA 4EZHA 3JAEA 1SUMB 5KMGP 4DV3T 3UU4A 4O4HE 3RISA 2V26A 4QKNA 4HWDA 2XQAA 2UXBT 5L3FB 4UXNB 2KXPB 2IMLA 2NW7A 5FXXA 3V5SA 3RKGA 2L8KA 1HG2A 5L3CB 5FXWA 4ZI3C 5AFUL 5AQGB 1KFYA 4JI0T 4EYUA 2W0GA 4A56A 4JI4T 2LOPA 2VB6A 4KP3C 2XQ3A 4MHCA 1SA0E 1VCTA 3E08A 3ZC1A 5F3JA 5JRCB 4ZEYA 4H9PC 4HFEA 2YOEA 1XD3A 5C2TA 3B57A 4O2BE 4O8SA 3CMLA 3DP7A 4NUUA 3AA1B 2IC6A 4GOUA 2VURA 3ANWA 4AQFC 3RLFF 1R8IA 3Q5DA 1XZYA 1HTJF 3B5MA 3ZJ2A 5DQWA 3PUAA 2CHNA 2BG9A 3ETVA 4LFCT 3NRXA 3F57A 5LG4A 1T72A 2LSKA 4EYYR 3TLWA 2DCFA 2XUEA 5AQFB 4QHOA 5J0ZA 2RPAA 4YSZA 3LK3B 3A7MA 4QXHB 2XQ9A 4EV6A 3J7Yq 4QXCB 3N9PA 2MTQA 5L3EB 1KF6A 2H7OA 3PV0F 3KVFA 5EK2A 4U3CA 3AAIA 1T7SA 1XMOT 3R84B 4LF4T 2YU1A 3RQUA 3HKEE 3RIUA 3AE4A 3FZKB 2EHOA 1IJ5A 4KX6A 3D0TA 2K9AA 4EGWA 1BR1A 3MA9A 4UR9A 3KFWX 3UFEA 3GN5B 3L8RA 5HXHA 3VR8A 3PU8A 2CCQA 4KHZF 4MALA 5IHYA 3KINB 3UUNA 3FBZA 2JIWA 3ZT6A 3PUGA 1W09A 2CXLA 3EABA 2YDRA 4ZS3A 3AECA 4YTMA 2XQYA 4JV5T 4IL4A 3PJAA 3CK6A 4YHJA 2CXFA 2W66A 3L09A 3ZT7A 3VKGA 2JJ9A 3L3PA 5AQVB 4JI7T 3OVUA 4C91A 1D1CA 4O4IE 3F2EA 2E9XC 4EZ4A 2V8SV 3N9OA 4UVBB 2YKSA 3IRTA 4JI5T 2CBJA 1IZNB 2N1GA 3CPZA 4F6RC 5AQSB 2X0HA 3NZQA 2HHHT 4UF0A 3P4SA 3HKBE 1MNEA 1IBKT 4DUYT 5FY7A 2XASB 3UFGA 1HX8A 2YINA 2D2SA 3ZYKA 5HAXA 3AE5A 3MJXA 2D0TA 2LRLA 5JDQA 5L3GB 1UX5A 4PJLA 5AQJB 3OJAA 3ZCJA 3FZHB 5AQQB 4HWFA 3FHNA 1O3XA 3HKCE 2XQ4A 2WZIA 2AXDS 5EZYE 2I0MA 4HWCA 4DR2T 4H9NC 4WBNE 4N78D 5IYZE 2WWUA 5L4EA 4LF9T 2YDSA 3WI3A 2A2FX 2KZ7B 3EDUA 4WBOA 2EHOD 2WDQA 4AQYT 5C3JA 2X9WA 2XQ7A 4B3ST 4IE7A 3PUSA 4AQFA 3AE1A 4B3RT 3O1JA 2NW8A 3JAFA 3GMIA 3KV5A 2J1DG 4EAHA 3ZLIA 2JMKA 1FMVA 5HXSA 3IEEA 4HWHA 4ZI2D 1WR0A 1HCIA 3UTKA 2B76A 4GIWA 2KT9A 4TUYE 3CKDA 3ABVA 3I0QA 5LHIB 2XAJB 5CA0E 3UQ7A 3Q5XA 3LBXA 3T1YT 2X9XA 4HKAA 3GWHA 2YEVC 4PK5A 2FJAA 5HXEA 3EI0A 2XM1A 5FVKA 2VWAA 3CX8B 3N2GE 1HNXT 2KMFA 1HS7A 3GA8A 5ABHA 2X66A 4ZOLE 5JDNA 3SOLA 1FJGT 2QVAA 4JEHB 5HEJA 4H63H 4DR1T 3ZPOA 3TB3A 1IJ6A 4X1IE 1W0BA 2H89A 1XNQT 2VASA 3I1AA 3PUVF 3U78A 2UXXB 4ZI3D 1XWMA 5BR8T 3TLVA 3NKZA 3R6NA 4QXBB 3RHWA 3WAJA 4CXYA 4DR4T 2L9QA 1BR4A 2WBLA 4JBWF 5JDMA 2VK9A 3KBUA 3HKDE 1WCRA 4U2YA 2E9XA 3CQXC 3UUXB 3AEGA 2WWVA 2ODUA 3ZT5A 3KBTA 4CI1B 2UUBT 3PUQA 3N9MA 1DU2A 3BK9A 2MYSA 4EB6E 5CFBA 2EHOB 2FUPA 4H63V 2WZHA 2WY2A 3RC8A 3Q2MA 3ZN1B 1IAPA 2LSIA 3EAMA 3QB5A 4AI6A 3JADA 5FXVA 2BG9E 2ES0A 2H3RA 3ETUA 1KNRA 3RIUC 3PUZF 4YXDA
chains in the Genus database with same CATH topology
4H9PC 3MZKB 1HG5A 2YK0A 2NW9A 5JR9C 3SRZA 2NOXA 4QWNB 3QUJA 5FXZA 3AA0B 3KVBA 1XD3A 3OKQA 2PFVA 3B57A 4O2BE 4O8SA 4QX8B 3CMLA 3DP7A 4NUUA 2CXDA 2C0SA 2PG8A 3AA1B 2IC9A 2IC6A 5LA6E 3V5UA 4GOUA 4TZ4C 3N2OA 3IF8B 3RYCE 3ANWA 4ADZA 4AQFC 4OYJA 2V7KA 2D5UA 3CWZB 2W62A 5JREA 3KW5A 1MMAA 4X1YE 3MXZA 1HTJF 2BZBA 3NBXX 3ZJ2A 1V9DA 5EK3A 1LVFA 5DQWA 3PUAA 3ETVA 5BMVE 4DO0A 2LE8A 3O4XE 5H6QB 5JDLA 5LJNA 1D0ZA 1EZ3A 3ANWB 4I50E 4ISTA 5HWXA 4C90A 3NRXA 3RKOA 2IW5B 4JKJA 3P7IA 4FJOA 3F57A 5JVDE 4CI2B 4EOZB 5LG4A 2LSKA 4DMWA 4EYYR 3ZCIA 2XAQB 3JC6D 2DCFA 2XUEA 2VKHA 5TAOA 4AKHA 4UV8B 2LT3A 4QHOA 2DWKA 2Q9QD 2G0UA 3RPUA 2XHEB 2CLYC 1G73A 3LK3B 5A1LA 4QXHB 3ZYLA 4UF0B 3BQIA 3O1HA 2XAFB 3K3NA 4QXCB 3J7Yq 4JEUB 3N9PA 2ODVA 3N2KE 4O4LE 2MTQA 3RYHE 5L3EB 4OK0A 2H7OA 2HPJA 4QX7B 4H9QC 3KVFA 4PFPA 5EK2A 4CQIA 3AAIA 3C4XA 2E8IA 3R84B 3HR0A 3Q5WA 2C5KT 4P0AA 3GN5A 2YU1A 4UVAB 3LK42 3HKEE 2NTYA 4AKGA 2VKJA 4ILUA 1NAFA 4AKRB 2EHOA 1IJ5A 4YJ3E 2X67A 4H9OC 3O9XA 3D0TA 2K9AA 4XAXB 1BR1A 2MBGA 1WLXA 2WMOA 4G63A 5FY1A 4YLHA 2W00A 5J2UE 2E9XD 5L2LA 4CI3B 2BVLA 3A5XA 3MA9A 3ZMSB 3VKHA 5F8PA 5JH7E 3KFWX 4PJNA 3UFEA 3EVYA 2LHRA 2YU2A 3GN5B 4NUVA 5J2TE 1MIWA 3LJCA 4UEMA 3OBVE 4X1KE 4ASKA 5HXHA 3J9X1 2GK9A 2A72A 5LGTB 5JDHA 1ZEEA 4DMVA 3C4ZA 3RYFE 3H3AA 3PU8A 4ZHQE 1FMWA 3EUHA 2JPFA 4KBMB 4PJJA 1G8XA 3LG7A 2CCQA 3I9YA 4MALA 2WAUA 3AAAB 1D0YA 3KINB 3LK2B 5E0OA 5IHYA 2ZLYA 3UUNA 3ZJ1A 2WSSV 3FBZA 3DTOA 3VU7H 3MKDA 2L3LA 1BR0A 1ZHCA 2W63A 3F31A 3IBPA 3JC6C 4IE0A 5JRCA 2V7MA 3PUGA 5J1GA 5M4YA 2CXLA 3UULA 4IE6A 2Q9QC 3PE0A 2KLQA 4ZS3A 2C5IT 4TX5A 2XQYA 2CWYA 4YHJA 3RYIE 5JDFA 2CXFA 1VRBA 2A3DA 2KWIB 3N5LA 3E0ZA 4HFVA 5EK4A 3ZMVB 5LJMA 3L09A 1D1AA 1MMDA 3DJBA 3N9QA 2ZM2A 5C8YE 3B13A 4EXTA 3VKGA 2CA5A 2JJ9A 4PNIA 2CM0A 2X68A 3AAEB 3L3PA 3M65A 2WMNA 3UT5E 3KV9A 5LHGB 4PFOA 2DHRA 4DBRA 1U5PA 4C91A 1D1CA 2KWHA 4I55E 4MFRA 4CXXA 4O4IE 3F2EA 3N9LA 2E9XC 2CLYB 3LBXB 2H7VC 3QK6A 4EZ4A 3E22E 3N9OA 4UVBB 3TKLB 4BJNA 3I0OA 4GYRA 4L9IA 4E7ZA 5LBMA 3IRTA 4IDZA 4IG7A 1KK7A 1Y64B 1WYCA 4OFZA 1OWAA 4U72A 4G2AA 4BA9A 1IZNB 1U4QA 2N1GA 2K48A 3CPZA 3Q9DA 5HWYA 4F6RC 4PAGA 1FIOA 3RC3A 3NZQA 4DM9A 3OYZA 2LENA 3RH3A 4UF0A 3ZN0B 1SHZC 3KV6A 3KVAA 2LHNA 3HKBE 4AKIA 1MNEA 4PK4A 4KMCA 3NZPA 5FY7A 5LP6E 2XASB 5LXTE 3CQCB 1HX8A 4BAYB 4HTEA 1MMGA 2JMHA 2YINA 2D2SA 3ZYKA 5HAXA 3MJXA 5LGNB 3MK7C 2D0TA 2ZMAA 3CX6B 3H37A 5JDQA 5L3GB 1MNDA 3ZMUB 2LEHA 1UX5A 4PJLA 4H9SE 3OJAA 3ZCJA 2XAGB 4ANJA 1AJ3A 2VKOA 4GYSA 4UELA 2IAKA 2HPLA 2QA7A 3FHNA 4DBQA 4Z8XA 3LFMA 3KDSE 1O3XA 3NRYA 3HKCE 2DNXA 5EZYE 3PURA 4U74A 4FI5A 4ZS2A 4KUMB 3AVRA 4O2AE 3UUMA 4H9NC 4WBNE 3IHRA 1YKEB 4CZZB 4N78D 5IYZE 2WWUA 3S4UA 4GK5E 4IGUA 1WR6A 2Q9QB 4TN7B 1LRZA 2NWBA 2QGSA 1HF8A 4P09A 3RX6A 2A2FX 2KZ7B 3EDUA 3WI3A 5JR9A 3FB2A 2C5JA 4WBOA 4WW0A 4JLEA 2HH7A 2EHOD 5CB4E 4HEAA 3HL6A 2X9WA 4PJMA 3C98B 3WAKA 3C50A 3FBLA 5KX5E 4P0BA 4IE7A 3C64A 2DI4A 4GK0E 3P8CD 3PUSA 4AQFA 4CXWA 5L3BB 5JR9B 1MIYA 3CX7B 3C51A 3O1JA 4MBQA 2X9HA 2NW8A 5GONE 2LM9A 4IE4A 5HXCA 4AQGA 3GMIA 3ZEFB 3KV5A 2J1DG 4PW8A 4EAHA 1LKXA 2BVMA 2LOSA 3ZLIA 1FMVA 2JMKA 1QSDA 2E9XB 5HXSA 5LGUB 2CE7A 1ZV4X 3IEEA 4ZI2D 1OXZA 3BQKA 4JUYA 3U3IA 5FMNA 4ISSA 1HCIA 3UTKA 4GIWA 2KT9A 2WM9A 1YW0A 3O1IA 4YJ2E 2ZM8A 2CWOA 4TUYE 3CKDA 2NTXA 2X0LB 3I0QA 4WNKA 4I6NA 3K8PC 5LHIB 1LVKA 1BR2A 1NWMX 1FEWA 2XAJB 5H6RB 1MIVA 5CA0E 3Q5XA 3LBXA 2LJLA 3KV4A 2X9XA 4HKAA 2X9YA 3GWHA 1UCHA 2YEVC 2PBIA 4PK5A 1QUUA 3VHLA 2V7LA 3AB3B 5HXEA 2P9BA 4MLKA 2W61A 3T8OA 2V1DB 1Z0PA 3K3OA 4H9RC 5DABA 2K5BB 3ESLA 3C4WA 4UV9B 1H7CA 4PK6A 5JQGE 1S94A 2MOZA 3A7SA 2V7JA 4OHFA 3MACA 5HYAA 2VWAA 3CX8B 2BDEA 3N2GE 1X79A 2JRKA 1YKHB 2LSJA 3ZC0A 2EHOC 4ERRA 3QC9A 5LBQB 2ACXA 3AVSA 2N9DA 3OYXA 2KMFA 1HS7A 5FNVE 2X51A 4B6XA 5FY0A 1D1BA 3GA8A 2VL8A 2RA1A 2KNDA 5LNKA 2X66A 3FXEB 4ZOLE 5JDNA 3SOLA 1YD8G 1S35A 2M67A 2ETLA 3CVRA 3BQLA 1WRDA 4HN9A 4JEHB 5DQVA 3RRWA 4I43B 2NP9A 3I9WA 4H63H 4V1Av 2V7IA 3HA4A 3PU3A 3ZPOA 4ZI2C 4IHJE 3TB3A 1IJ6A 2D0UA 4X1IE 5FYMA 5JDGA 4DVDA 3AA7B 5KDMC 3ZYMA 4IE5A 4I4TE 5DJQC 3N9NA 4O4JE 4TV9E 1CUNA 1VOMA 2Q9QA 2Y8DA 5LYJE 2VASA 3I1AA 2DWGA 3U78A 2LSYA 2UXXB 4ZI3D 3CQGB 2PJQA 1D0XA 1ZKEA 3R6NA 3PDYA 4QXBB 5CA1E 4M1PA 2LSGA 2XAHB 3WAJA 4J2CA 4CXYA 2SPCA 4L5GA 4IIJE 2L9QA 1BR4A 3SWHA 1MMNA 5LCYA 3ZMTB 2K24A 3IFWA 3K3QC 1UCUA 5LOVE 1UX4A 2WBLA 2JQQA 3FXDB 5JDMA 1E1HB 2VK9A 4EIWA 3KBUA 3ONXA 3W15B 5ADXL 3PTRB 3HKDE 1B7TA 5HXRA 2E9XA 2I59A 3CQXC 1WYBA 3EDVA 3UUXB 4AKLA 4L0RA 2N2NA 5ETWA 5FP3A 4EZHA 2ODUA 3KBTA 5KMGP 4HGAA 4CI1B 2VKDA 4HE8A 3PUQA 3N9MA 3HI2A 4K0UA 1T98A 4O4HE 4X20E 2Y6XA 3ZMZB 1KNZA 3BK9A 3RISA 2V26A 4UIGA 4QKNA 4ZI7E 2MYSA 4YFSA 3RIIA 4EB6E 2EHOB 3RRCA 4UXNB 5L3FB 4DNDA 4AXPA 4H63V 2KXPB 2B1EA 3RC8A 3SS1A 4E7SA 2CMRA 2NW7A 4OYKA 4XBFB 5FXXA 3V5SA 2L8KA 1US7B 3Q2MA 4UVCB 1HG2A 3ZN1B 4BJMA 1IAPA 2KINB 5L3CB 5FXWA 4ZI3C 5AFUL 2DLRA 5LHHB 2Y48B 4TV8E 2CEAA 2LSIA 3AA6B 4EYUA 2W0GA 4A56A 2LOPA 2VB6A 4KP3C 1HFAA 4AI6A 2Z6EA 2RP4A 5L3DB 2UXNB 5FXVA 4MHCA 1SA0E 2ES0A 2H3RA 3E08A 3ETUA 2OA5A 3ZC1A 5F3JA 2XTLA 5JRCB 4XZCA 1CMXA 2ZM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TB3 A;  1UCH A;  1XD3 A;  4UEL A;  3IFW A;  4DM9 A;  2LEN A;  3RIS A;  2ETL A;  4JKJ A;  3KVF A;  3RII A;  4UEM A;  3A7S A;  3KW5 A;  4I6N A;  1CMX A;  4IG7 A;  3IHR A;  3IRT A; 
#chains in the Genus database with same CATH topology
 3MZK B;  1HG5 A;  3AEF A;  2NOX A;  3SRZ A;  4QWN B;  2JQ9 A;  5FXZ A;  3KVB A;  4QX8 B;  5LA6 E;  2IC9 A;  2LRK A;  3PJA J;  3IF8 B;  5L47 A;  3NWI A;  2D5U A;  5JRE A;  3KW5 A;  2UXC T;  3MXZ A;  3UU6 A;  5BMV E;  5JDL A;  1D0Z A;  4I50 E;  4U7Y A;  2IW5 B;  2XY8 B;  2XAQ B;  3PUY F;  3CIR A;  5TAO A;  1KNP A;  4AKH A;  4UV8 B;  1XMQ T;  4A97 A;  5A1L A;  3ZYL A;  4UF0 B;  2XAF B;  2ODV A;  4O4L E;  5AQI B;  4OK0 A;  2D9D A;  3AE9 A;  5ABG A;  2XJ7 A;  4PFP A;  4CQI A;  3C4X A;  5AQL B;  2E8I A;  3RF1 A;  4X65 T;  3HR0 A;  4EEB A;  3AEA A;  4UVA B;  3LK4 2;  2VKJ A;  2X67 A;  1NEN A;  4H9O C;  3QOF A;  2WMO A;  4G63 A;  5FY1 A;  4YLH A;  1M7K A;  2E9X D;  2BVL A;  5F8P A;  4PJN A;  2LHR A;  2X0Y A;  5J2T E;  1Z8U A;  3LJC A;  3P4R A;  3AE6 A;  5LGT B;  5JDH A;  1QLB A;  3C4Z A;  3H3A A;  4ZHQ E;  3EUH A;  2JPF A;  1SE7 A;  2VQE T;  3I9Y A;  3LK2 B;  2WSS V;  3DTO A;  3MKD A;  1BR0 A;  1ZHC A;  4IE0 A;  3UUL A;  4IE6 A;  4IDP A;  3PE0 A;  2CWY A;  4LF6 T;  3LSV A;  4NXM T;  5JDF A;  5LMU T;  2WU2 A;  1VRB A;  3N5L A;  3E0Z A;  3ZMV B;  5LJM A;  1MMD A;  3N9Q A;  5C8Y E;  3UU3 A;  4EXT A;  2ZM6 T;  2CA5 A;  3VRA A;  4PNI A;  3AAE B;  5LHG B;  1ZP0 A;  2WMN A;  3KV9 A;  4PFO A;  2J4G A;  4MFR A;  4CXX A;  3AXJ B;  1HX1 B;  4ILC A;  3LBX B;  2H7V C;  4A98 A;  3I0O A;  3TLT A;  4TNV A;  1KK7 A;  4G2A A;  1U4Q A;  3Q9D A;  2K48 A;  4X64 T;  4PAG A;  3RC3 A;  4DM9 A;  3KV6 A;  4AKI A;  2V5D A;  3CQC B;  4BAY B;  3MK7 C;  3CX6 B;  3H37 A;  1MND A;  4H9S E;  1I94 T;  4UEL A;  5HCJ A;  2A9U A;  4DUZ T;  2QA7 A;  3ZKR A;  2E2A A;  2UU9 T;  4ZS2 A;  3AVR A;  4ZZC A;  1YKE B;  4CZZ B;  4IGU A;  1WR6 A;  4TN7 B;  2QGS A;  1UK5 A;  4WW0 A;  4JLE A;  3SFE A;  5CB4 E;  4LF5 T;  3HL6 A;  5LMN T;  4P0B A;  3P8C D;  5JR9 B;  3AE8 A;  2XQ5 A;  3RIF A;  3ONL C;  5GON E;  2LM9 A;  4IE4 A;  1OED A;  4AQG A;  3RIA A;  2BVM A;  4DR3 T;  2E9X B;  2FJB A;  2WM9 A;  3O1I A;  2ZM8 A;  4WNK A;  1FEW A;  1MIV A;  3KV4 A;  4ILB A;  3K1S A;  2X9Y A;  4TNW A;  2PBI A;  1QUU A;  2V7L A;  4MLK A;  2V1D B;  1Z0P A;  4H9R C;  5DAB A;  3ESL A;  4HFI A;  4PK6 A;  5JQG E;  3AE2 A;  5AQU B;  3MAC A;  2BDE A;  1X79 A;  3QC9 A;  5LBQ B;  2ACX A;  4KI0 F;  2N9D A;  5FNV E;  5FY0 A;  1D1B A;  4NXN T;  2KND A;  2F4V T;  2R6G F;  3FZF B;  2M67 A;  4LMK A;  3UUB A;  2ETL A;  2AE9 A;  4OX9 T;  2HN2 A;  5DQV A;  3I9W A;  4V1A v;  3HA4 A;  3PU3 A;  4IHJ E;  2D0U A;  2W4X A;  3ZYM A;  5DJQ C;  3N9N A;  4TV9 E;  2XQ6 A;  2Y8D A;  2MAW A;  4YSY A;  1ZKE A;  4M1P A;  2LSG A;  3VR9 A;  3QNU A;  2K24 A;  3IFW A;  3AE3 A;  2BKN A;  2JQQ A;  2HN1 A;  1I6Z A;  2YDQ A;  3PUW F;  4EIW A;  2M6I A;  1HNW T;  3AED A;  1WYB A;  2QRX A;  5HEO A;  4AKL A;  4L0R A;  2N2N A;  5FP3 A;  1GQE A;  2UUA T;  4HGA A;  4WZX A;  2VKD A;  4HE8 A;  3HI2 A;  4K0U A;  1T98 A;  2Y6X A;  4UIG A;  4ZI7 E;  3RII A;  4AXP A;  4YHH T;  2B1E A;  3H3M A;  3SS1 A;  4E7S A;  2CMR A;  4OYK A;  2WQY A;  2KIN B;  2Y48 B;  2CEA A;  4IL9 A;  4X62 T;  1HFA A;  3Q5E A;  2RP4 A;  5L3D B;  2WS3 A;  1Y01 A;  4DV4 T;  2NR4 A;  2XTL A;  4XZC A;  1CMX A;  2LKH A;  2BS4 A;  2YK0 A;  2NW9 A;  1YQ3 A;  3QUJ A;  3AA0 B;  3OKQ A;  5LB7 B;  2PFV A;  4U33 A;  2C0S A;  2PG8 A;  3V5U A;  4TZ4 C;  3N2O A;  3RYC E;  4ADZ A;  4OYJ A;  2W62 A;  4X1Y E;  1T8B A;  2BZB A;  3NBX X;  5EK3 A;  1LVF A;  4DO0 A;  5H6Q B;  5LJN A;  4IST A;  3ANW B;  4DV1 T;  4C90 A;  2UXD T;  4HWI B;  4CI2 B;  1YXR A;  4DMW A;  3AEE A;  2VKH A;  1M62 A;  2BG9 B;  2XHE B;  2CLY C;  1G73 A;  5ABE A;  3O1H A;  2VL0 A;  3K3N A;  4JEU B;  3N2K E;  2JQK A;  2E5L T;  4DV6 T;  1KEY A;  1J1J A;  4LML A;  3Q5W A;  2C5K T;  4P0A A;  3GN5 A;  2NTY A;  4ILU A;  4YJ3 E;  3O9X A;  2MBG A;  1J5W A;  2W00 A;  2XSB A;  3A5X A;  3EVY A;  4NUV A;  3OBV E;  4X1K E;  4ASK A;  1W9R A;  5CGM A;  2GK9 A;  2A72 A;  5AQT B;  2CRB A;  5CJ5 A;  3RYF E;  1FMW A;  4KBM B;  3LG7 A;  4P1N A;  2WP9 A;  3ZJ1 A;  5E0O A;  2ZLY A;  2IDO B;  2XM2 A;  3X1D A;  2L3L A;  2W63 A;  3IBP A;  3F31 A;  3JC6 C;  4U31 A;  5J1G A;  4QH1 A;  4X66 T;  1CHU A;  4GKK T;  2WDR A;  2Q9Q C;  1JNR A;  4IRE A;  4IDN A;  2BS2 A;  2C5I T;  4TX5 A;  3RYI E;  5AQN B;  1IBM T;  2ZM2 A;  3B13 A;  2K3W A;  2X68 A;  3UT5 E;  5HEH A;  4ZZB A;  1U5P A;  4I55 E;  3N9L A;  3QK6 A;  3TKL B;  4IT4 A;  2FBW A;  5LBM A;  4IDZ A;  4OFZ A;  1OED C;  5FL1 A;  1FIO A;  3ONJ A;  2LEN A;  3ZN0 B;  3KVA A;  3NZP A;  5LP6 E;  4Z91 A;  4CN6 A;  5LGN B;  2LEH A;  1XDO A;  5AQP B;  4ANJ A;  1AJ3 A;  4JYA T;  4TWF A;  4DBQ A;  1OED E;  2BBH A;  3KDS E;  2DNX A;  4DR7 T;  5HEU A;  1UUR A;  3PUR A;  2V5C A;  4KUM B;  4O2A E;  3UUM A;  3S4U A;  2BBJ A;  1LRZ A;  2NWB A;  1HF8 A;  3G06 A;  4LFB T;  3FB2 A;  2C5J A;  3OTO T;  4HEA A;  2LLY A;  2IUB A;  3C98 B;  4ZXL A;  3C50 A;  1E2A A;  3FBL A;  5KX5 E;  3M3Z B;  2WU5 A;  1ZOY A;  1MIY A;  1UGO A;  3JCF A;  1NEK A;  4YTP A;  4PW8 A;  2LOS A;  2BKP A;  2PTF A;  1QSD A;  1ZV4 X;  1OXZ A;  3BQK A;  4JUY A;  4U2Z A;  3U3I A;  2VVS A;  2CWO A;  2X0L B;  4I6N A;  3K8P C;  1LVK A;  1BR2 A;  4QH4 A;  4CN4 A;  3VHL A;  4YY3 T;  3AB3 B;  2W61 A;  3T8O A;  3K3O A;  1L0V A;  3EHZ A;  5IUX A;  2MOZ A;  3A7S A;  2LKG A;  2LSJ A;  4Z90 A;  2RA1 A;  5LNK A;  5LG3 A;  1YD8 G;  1S35 A;  3CVR A;  1XNR T;  2W67 A;  3PUX F;  4HN9 A;  4K0K T;  2BKO A;  2V7I A;  5AQM B;  5FYM A;  5JDG A;  2WCA A;  4DVD A;  3AA7 B;  5KDM C;  4IE5 A;  1VOM A;  2Q9Q A;  4U7I A;  3TLS A;  1X9B A;  2LSY A;  3CQG B;  5JTG A;  2WB5 A;  1D0X A;  4LFA T;  3PDY A;  2SPC A;  4LMJ A;  4I0U A;  4AIS A;  3SWH A;  1MMN A;  3ZMT B;  3SFD A;  3K3Q C;  2W2U A;  2CBI A;  1UX4 A;  2FJD A;  3P4W A;  3FZM B;  3W15 B;  4YSX A;  1B7T A;  4EED A;  3EDV A;  5HEG A;  4ILA A;  4HFB A;  4A5X A;  5ABF A;  5FL0 A;  3VRB A;  3OPC A;  1KNZ A;  4X20 E;  3ZMZ B;  2VVN A;  4YFS A;  3RRC A;  4DND A;  2WDV A;  3LDQ B;  2M6B A;  4XBF B;  4DV2 T;  1US7 B;  4BJM A;  4UVC B;  5IWA T;  3AE7 A;  2DLR A;  5LHH B;  4TV8 E;  4DID B;  3UU8 A;  4DV5 T;  3AA6 B;  4DV0 T;  2Z6E A;  1E7P A;  2UXN B;  2V6Y A;  2OA5 A;  4GKJ T;  2J47 A;  2ZM0 A;  2ACZ A;  5JR9 C;  2J62 A;  4LF7 T;  2CXD A;  2E5V A;  2YN6 A;  4TWD A;  4YTN A;  1YQ4 A;  2V7K A;  4DV7 T;  3CWZ B;  4WYV A;  1MMA A;  3ZST A;  1XDP A;  1V9D A;  2QYW A;  2LE8 A;  3O4X E;  1EZ3 A;  5HWX A;  2OLT A;  2XZE A;  3RKO A;  4JKJ A;  3P7I A;  4FJO A;  5JVD E;  4EOZ B;  2VQF T;  5HCM A;  1IBL T;  3ZCI A;  4AIU A;  3JC6 D;  4QH5 A;  2LT3 A;  2DWK A;  2Q9Q D;  2G0U A;  3RPU A;  3P4Q A;  4IDO A;  2H88 A;  3BQI A;  2UUC T;  3RYH E;  2HPJ A;  2XPK A;  4QX7 B;  4H9Q C;  2DL1 A;  1VCS A;  4AKG A;  4COF A;  1NAF A;  4AKR B;  4XAX B;  1WLX A;  3P4P A;  5AQK B;  5J2U E;  5L2L A;  5FVL A;  2BS3 A;  4CI3 B;  3ZMS B;  3T1H T;  3VKH A;  5JH7 E;  4HFC A;  2YU2 A;  2FJE A;  1MIW A;  4UEM A;  1HR0 T;  1UUS A;  2MPK A;  3J9X 1;  4JI8 T;  1ZEE A;  3TLU A;  4DMV A;  2LM2 A;  4PJJ A;  1G8X A;  2WAU A;  3AAA B;  1D0Y A;  3VU7 H;  2XSA A;  4B3M T;  1W0A A;  2V7M A;  1J5E T;  5JRC A;  5M4Y A;  1N34 T;  2KLQ A;  4NIQ A;  2KWI B;  2A3D A;  4HFV A;  5EK4 A;  4JI3 T;  3AXJ A;  1D1A A;  3DJB A;  1JNZ A;  1WFD A;  5AQR B;  5F5W A;  2CM0 A;  3M65 A;  2IIU A;  2DHR A;  4DBR A;  2KWH A;  2V6X A;  2CLY B;  3E22 E;  4BJN A;  4GYR A;  4L9I A;  4E7Z A;  4IG7 A;  3UU5 A;  4KHP T;  1Y64 B;  1WYC A;  1OWA A;  4U72 A;  4BA9 A;  5HWY A;  4JI2 T;  4JI6 T;  3OYZ A;  3RH3 A;  4LF8 T;  1SHZ C;  2XQ8 A;  2LHN A;  4X5T A;  4PK4 A;  4KMC A;  5LXT E;  3RI5 A;  4HTE A;  1MMG A;  2JMH A;  2ZMA A;  3ZMU B;  2XAG B;  2VKO A;  4GYS A;  2IAK A;  2HPL A;  4IDQ A;  4Z8X A;  3LFM A;  3NRY A;  4U74 A;  4FI5 A;  4HFH A;  5L4H A;  3IHR A;  4DR6 T;  4GK5 E;  2Q9Q B;  4P09 A;  3RX6 A;  5JR9 A;  2HH7 A;  3AEB A;  4PJM A;  3WAK A;  1N33 T;  3C64 A;  2DI4 A;  4GK0 E;  4CXW A;  5L3B B;  3CX7 B;  3C51 A;  4MBQ A;  2X9H A;  5HXC A;  2BG9 C;  3RQW A;  3P50 A;  3ZEF B;  1HNZ T;  1LKX A;  5LGU B;  2CE7 A;  3FZL B;  3A8Y C;  4ISS A;  5FMN A;  4YJ2 E;  1YW0 A;  3RGL A;  1OED B;  5ABF B;  2NTX A;  1NWM X;  2CHO A;  5H6R B;  2LJL A;  3L39 A;  1UCH A;  2JQH A;  2P9B A;  2K5B B;  1N32 T;  3C4W A;  4UV9 B;  1H7C A;  1S94 A;  4JI1 T;  2V7J A;  5AQH B;  4OHF A;  5HYA A;  4NPP A;  3IA3 A;  2JRK A;  1YKH B;  3ZC0 A;  2EHO C;  5AQO B;  4ERR A;  2OV9 A;  5KXJ A;  3AVS A;  3OYX A;  2X51 A;  4B6X A;  2VL8 A;  2V6Y B;  2I6H A;  3FXE B;  4F8H A;  4DR5 T;  4YT0 A;  3BQL A;  4CN1 A;  4Q25 A;  1WRD A;  3RRW A;  4I43 B;  2NP9 A;  3NVO A;  5FKY A;  4ZI2 C;  4B3T T;  1N36 T;  4I4T E;  4O4J E;  1CUN A;  3QB5 K;  5LYJ E;  2DWG A;  2PJQ A;  5CA1 E;  2XAH B;  4J2C A;  4L5G A;  2IHR 1;  4HFD A;  4IIJ E;  5LCY A;  1UCU A;  5LOV E;  3FXD B;  1E1H B;  2KSR A;  3ONX A;  5ADX L;  3ZSS A;  3PTR B;  2CPT A;  5HXR A;  2I59 A;  4TWH A;  3UQ4 A;  5ETW A;  4EZH A;  3JAE A;  1SUM B;  5KMG P;  4DV3 T;  3UU4 A;  4O4H E;  3RIS A;  2V26 A;  4QKN A;  4HWD A;  2XQA A;  2UXB T;  5L3F B;  4UXN B;  2KXP B;  2IML A;  2NW7 A;  5FXX A;  3V5S A;  3RKG A;  2L8K A;  1HG2 A;  5L3C B;  5FXW A;  4ZI3 C;  5AFU L;  5AQG B;  1KFY A;  4JI0 T;  4EYU A;  2W0G A;  4A56 A;  4JI4 T;  2LOP A;  2VB6 A;  4KP3 C;  2XQ3 A;  4MHC A;  1SA0 E;  1VCT A;  3E08 A;  3ZC1 A;  5F3J A;  5JRC B;  4ZEY A;  4H9P C;  4HFE A;  2YOE A;  1XD3 A;  5C2T A;  3B57 A;  4O2B E;  4O8S A;  3CML A;  3DP7 A;  4NUU A;  3AA1 B;  2IC6 A;  4GOU A;  2VUR A;  3ANW A;  4AQF C;  3RLF F;  1R8I A;  3Q5D A;  1XZY A;  1HTJ F;  3B5M A;  3ZJ2 A;  5DQW A;  3PUA A;  2CHN A;  2BG9 A;  3ETV A;  4LFC T;  3NRX A;  3F57 A;  5LG4 A;  1T72 A;  2LSK A;  4EYY R;  3TLW A;  2DCF A;  2XUE A;  5AQF B;  4QHO A;  5J0Z A;  2RPA A;  4YSZ A;  3LK3 B;  3A7M A;  4QXH B;  2XQ9 A;  4EV6 A;  3J7Y q;  4QXC B;  3N9P A;  2MTQ A;  5L3E B;  1KF6 A;  2H7O A;  3PV0 F;  3KVF A;  5EK2 A;  4U3C A;  3AAI A;  1T7S A;  1XMO T;  3R84 B;  4LF4 T;  2YU1 A;  3RQU A;  3HKE E;  3RIU A;  3AE4 A;  3FZK B;  2EHO A;  1IJ5 A;  4KX6 A;  3D0T A;  2K9A A;  4EGW A;  1BR1 A;  3MA9 A;  4UR9 A;  3KFW X;  3UFE A;  3GN5 B;  3L8R A;  5HXH A;  3VR8 A;  3PU8 A;  2CCQ A;  4KHZ F;  4MAL A;  5IHY A;  3KIN B;  3UUN A;  3FBZ A;  2JIW A;  3ZT6 A;  3PUG A;  1W09 A;  2CXL A;  3EAB A;  2YDR A;  4ZS3 A;  3AEC A;  4YTM A;  2XQY A;  4JV5 T;  4IL4 A;  3PJA A;  3CK6 A;  4YHJ A;  2CXF A;  2W66 A;  3L09 A;  3ZT7 A;  3VKG A;  2JJ9 A;  3L3P A;  5AQV B;  4JI7 T;  3OVU A;  4C91 A;  1D1C A;  4O4I E;  3F2E A;  2E9X C;  4EZ4 A;  2V8S V;  3N9O A;  4UVB B;  2YKS A;  3IRT A;  4JI5 T;  2CBJ A;  1IZN B;  2N1G A;  3CPZ A;  4F6R C;  5AQS B;  2X0H A;  3NZQ A;  2HHH T;  4UF0 A;  3P4S A;  3HKB E;  1MNE A;  1IBK T;  4DUY T;  5FY7 A;  2XAS B;  3UFG A;  1HX8 A;  2YIN A;  2D2S A;  3ZYK A;  5HAX A;  3AE5 A;  3MJX A;  2D0T A;  2LRL A;  5JDQ A;  5L3G B;  1UX5 A;  4PJL A;  5AQJ B;  3OJA A;  3ZCJ A;  3FZH B;  5AQQ B;  4HWF A;  3FHN A;  1O3X A;  3HKC E;  2XQ4 A;  2WZI A;  2AXD S;  5EZY E;  2I0M A;  4HWC A;  4DR2 T;  4H9N C;  4WBN E;  4N78 D;  5IYZ E;  2WWU A;  5L4E A;  4LF9 T;  2YDS A;  3WI3 A;  2A2F X;  2KZ7 B;  3EDU A;  4WBO A;  2EHO D;  2WDQ A;  4AQY T;  5C3J A;  2X9W A;  2XQ7 A;  4B3S T;  4IE7 A;  3PUS A;  4AQF A;  3AE1 A;  4B3R T;  3O1J A;  2NW8 A;  3JAF A;  3GMI A;  3KV5 A;  2J1D G;  4EAH A;  3ZLI A;  2JMK A;  1FMV A;  5HXS A;  3IEE A;  4HWH A;  4ZI2 D;  1WR0 A;  1HCI A;  3UTK A;  2B76 A;  4GIW A;  2KT9 A;  4TUY E;  3CKD A;  3ABV A;  3I0Q A;  5LHI B;  2XAJ B;  5CA0 E;  3UQ7 A;  3Q5X A;  3LBX A;  3T1Y T;  2X9X A;  4HKA A;  3GWH A;  2YEV C;  4PK5 A;  2FJA A;  5HXE A;  3EI0 A;  2XM1 A;  5FVK A;  2VWA A;  3CX8 B;  3N2G E;  1HNX T;  2KMF A;  1HS7 A;  3GA8 A;  5ABH A;  2X66 A;  4ZOL E;  5JDN A;  3SOL A;  1FJG T;  2QVA A;  4JEH B;  5HEJ A;  4H63 H;  4DR1 T;  3ZPO A;  3TB3 A;  1IJ6 A;  4X1I E;  1W0B A;  2H89 A;  1XNQ T;  2VAS A;  3I1A A;  3PUV F;  3U78 A;  2UXX B;  4ZI3 D;  1XWM A;  5BR8 T;  3TLV A;  3NKZ A;  3R6N A;  4QXB B;  3RHW A;  3WAJ A;  4CXY A;  4DR4 T;  2L9Q A;  1BR4 A;  2WBL A;  4JBW F;  5JDM A;  2VK9 A;  3KBU A;  3HKD E;  1WCR A;  4U2Y A;  2E9X A;  3CQX C;  3UUX B;  3AEG A;  2WWV A;  2ODU A;  3ZT5 A;  3KBT A;  4CI1 B;  2UUB T;  3PUQ A;  3N9M A;  1DU2 A;  3BK9 A;  2MYS A;  4EB6 E;  5CFB A;  2EHO B;  2FUP A;  4H63 V;  2WZH A;  2WY2 A;  3RC8 A;  3Q2M A;  3ZN1 B;  1IAP A;  2LSI A;  3EAM A;  3QB5 A;  4AI6 A;  3JAD A;  5FXV A;  2BG9 E;  2ES0 A;  2H3R A;  3ETU A;  1KNR A;  3RIU C;  3PUZ F;  4YXD A; 
#chains in the Genus database with same CATH homology
 4H9P C;  3MZK B;  1HG5 A;  2YK0 A;  2NW9 A;  5JR9 C;  3SRZ A;  2NOX A;  4QWN B;  3QUJ A;  5FXZ A;  3AA0 B;  3KVB A;  1XD3 A;  3OKQ A;  2PFV A;  3B57 A;  4O2B E;  4O8S A;  4QX8 B;  3CML A;  3DP7 A;  4NUU A;  2CXD A;  2C0S A;  2PG8 A;  3AA1 B;  2IC9 A;  2IC6 A;  5LA6 E;  3V5U A;  4GOU A;  4TZ4 C;  3N2O A;  3IF8 B;  3RYC E;  3ANW A;  4ADZ A;  4AQF C;  4OYJ A;  2V7K A;  2D5U A;  3CWZ B;  2W62 A;  5JRE A;  3KW5 A;  1MMA A;  4X1Y E;  3MXZ A;  1HTJ F;  2BZB A;  3NBX X;  3ZJ2 A;  1V9D A;  5EK3 A;  1LVF A;  5DQW A;  3PUA A;  3ETV A;  5BMV E;  4DO0 A;  2LE8 A;  3O4X E;  5H6Q B;  5JDL A;  5LJN A;  1D0Z A;  1EZ3 A;  3ANW B;  4I50 E;  4IST A;  5HWX A;  4C90 A;  3NRX A;  3RKO A;  2IW5 B;  4JKJ A;  3P7I A;  4FJO A;  3F57 A;  5JVD E;  4CI2 B;  4EOZ B;  5LG4 A;  2LSK A;  4DMW A;  4EYY R;  3ZCI A;  2XAQ B;  3JC6 D;  2DCF A;  2XUE A;  2VKH A;  5TAO A;  4AKH A;  4UV8 B;  2LT3 A;  4QHO A;  2DWK A;  2Q9Q D;  2G0U A;  3RPU A;  2XHE B;  2CLY C;  1G73 A;  3LK3 B;  5A1L A;  4QXH B;  3ZYL A;  4UF0 B;  3BQI A;  3O1H A;  2XAF B;  3K3N A;  4QXC B;  3J7Y q;  4JEU B;  3N9P A;  2ODV A;  3N2K E;  4O4L E;  2MTQ A;  3RYH E;  5L3E B;  4OK0 A;  2H7O A;  2HPJ A;  4QX7 B;  4H9Q C;  3KVF A;  4PFP A;  5EK2 A;  4CQI A;  3AAI A;  3C4X A;  2E8I A;  3R84 B;  3HR0 A;  3Q5W A;  2C5K T;  4P0A A;  3GN5 A;  2YU1 A;  4UVA B;  3LK4 2;  3HKE E;  2NTY A;  4AKG A;  2VKJ A;  4ILU A;  1NAF A;  4AKR B;  2EHO A;  1IJ5 A;  4YJ3 E;  2X67 A;  4H9O C;  3O9X A;  3D0T A;  2K9A A;  4XAX B;  1BR1 A;  2MBG A;  1WLX A;  2WMO A;  4G63 A;  5FY1 A;  4YLH A;  2W00 A;  5J2U E;  2E9X D;  5L2L A;  4CI3 B;  2BVL A;  3A5X A;  3MA9 A;  3ZMS B;  3VKH A;  5F8P A;  5JH7 E;  3KFW X;  4PJN A;  3UFE A;  3EVY A;  2LHR A;  2YU2 A;  3GN5 B;  4NUV A;  5J2T E;  1MIW A;  3LJC A;  4UEM A;  3OBV E;  4X1K E;  4ASK A;  5HXH A;  3J9X 1;  2GK9 A;  2A72 A;  5LGT B;  5JDH A;  1ZEE A;  4DMV A;  3C4Z A;  3RYF E;  3H3A A;  3PU8 A;  4ZHQ E;  1FMW A;  3EUH A;  2JPF A;  4KBM B;  4PJJ A;  1G8X A;  3LG7 A;  2CCQ A;  3I9Y A;  4MAL A;  2WAU A;  3AAA B;  1D0Y A;  3KIN B;  3LK2 B;  5E0O A;  5IHY A;  2ZLY A;  3UUN A;  3ZJ1 A;  2WSS V;  3FBZ A;  3DTO A;  3VU7 H;  3MKD A;  2L3L A;  1BR0 A;  1ZHC A;  2W63 A;  3F31 A;  3IBP A;  3JC6 C;  4IE0 A;  5JRC A;  2V7M A;  3PUG A;  5J1G A;  5M4Y A;  2CXL A;  3UUL A;  4IE6 A;  2Q9Q C;  3PE0 A;  2KLQ A;  4ZS3 A;  2C5I T;  4TX5 A;  2XQY A;  2CWY A;  4YHJ A;  3RYI E;  5JDF A;  2CXF A;  1VRB A;  2A3D A;  2KWI B;  3N5L A;  3E0Z A;  4HFV A;  5EK4 A;  3ZMV B;  5LJM A;  3L09 A;  1D1A A;  1MMD A;  3DJB A;  3N9Q A;  2ZM2 A;  5C8Y E;  3B13 A;  4EXT A;  3VKG A;  2CA5 A;  2JJ9 A;  4PNI A;  2CM0 A;  2X68 A;  3AAE B;  3L3P A;  3M65 A;  2WMN A;  3UT5 E;  3KV9 A;  5LHG B;  4PFO A;  2DHR A;  4DBR A;  1U5P A;  4C91 A;  1D1C A;  2KWH A;  4I55 E;  4MFR A;  4CXX A;  4O4I E;  3F2E A;  3N9L A;  2E9X C;  2CLY B;  3LBX B;  2H7V C;  3QK6 A;  4EZ4 A;  3E22 E;  3N9O A;  4UVB B;  3TKL B;  4BJN A;  3I0O A;  4GYR A;  4L9I A;  4E7Z A;  5LBM A;  3IRT A;  4IDZ A;  4IG7 A;  1KK7 A;  1Y64 B;  1WYC A;  4OFZ A;  1OWA A;  4U72 A;  4G2A A;  4BA9 A;  1IZN B;  1U4Q A;  2N1G A;  2K48 A;  3CPZ A;  3Q9D A;  5HWY A;  4F6R C;  4PAG A;  1FIO A;  3RC3 A;  3NZQ A;  4DM9 A;  3OYZ A;  2LEN A;  3RH3 A;  4UF0 A;  3ZN0 B;  1SHZ C;  3KV6 A;  3KVA A;  2LHN A;  3HKB E;  4AKI A;  1MNE A;  4PK4 A;  4KMC A;  3NZP A;  5FY7 A;  5LP6 E;  2XAS B;  5LXT E;  3CQC B;  1HX8 A;  4BAY B;  4HTE A;  1MMG A;  2JMH A;  2YIN A;  2D2S A;  3ZYK A;  5HAX A;  3MJX A;  5LGN B;  3MK7 C;  2D0T A;  2ZMA A;  3CX6 B;  3H37 A;  5JDQ A;  5L3G B;  1MND A;  3ZMU B;  2LEH A;  1UX5 A;  4PJL A;  4H9S E;  3OJA A;  3ZCJ A;  2XAG B;  4ANJ A;  1AJ3 A;  2VKO A;  4GYS A;  4UEL A;  2IAK A;  2HPL A;  2QA7 A;  3FHN A;  4DBQ A;  4Z8X A;  3LFM A;  3KDS E;  1O3X A;  3NRY A;  3HKC E;  2DNX A;  5EZY E;  3PUR A;  4U74 A;  4FI5 A;  4ZS2 A;  4KUM B;  3AVR A;  4O2A E;  3UUM A;  4H9N C;  4WBN E;  3IHR A;  1YKE B;  4CZZ B;  4N78 D;  5IYZ E;  2WWU A;  3S4U A;  4GK5 E;  4IGU A;  1WR6 A;  2Q9Q B;  4TN7 B;  1LRZ A;  2NWB A;  2QGS A;  1HF8 A;  4P09 A;  3RX6 A;  2A2F X;  2KZ7 B;  3EDU A;  3WI3 A;  5JR9 A;  3FB2 A;  2C5J A;  4WBO A;  4WW0 A;  4JLE A;  2HH7 A;  2EHO D;  5CB4 E;  4HEA A;  3HL6 A;  2X9W A;  4PJM A;  3C98 B;  3WAK A;  3C50 A;  3FBL A;  5KX5 E;  4P0B A;  4IE7 A;  3C64 A;  2DI4 A;  4GK0 E;  3P8C D;  3PUS A;  4AQF A;  4CXW A;  5L3B B;  5JR9 B;  1MIY A;  3CX7 B;  3C51 A;  3O1J A;  4MBQ A;  2X9H A;  2NW8 A;  5GON E;  2LM9 A;  4IE4 A;  5HXC A;  4AQG A;  3GMI A;  3ZEF B;  3KV5 A;  2J1D G;  4PW8 A;  4EAH A;  1LKX A;  2BVM A;  2LOS A;  3ZLI A;  1FMV A;  2JMK A;  1QSD A;  2E9X B;  5HXS A;  5LGU B;  2CE7 A;  1ZV4 X;  3IEE A;  4ZI2 D;  1OXZ A;  3BQK A;  4JUY A;  3U3I A;  5FMN A;  4ISS A;  1HCI A;  3UTK A;  4GIW A;  2KT9 A;  2WM9 A;  1YW0 A;  3O1I A;  4YJ2 E;  2ZM8 A;  2CWO A;  4TUY E;  3CKD A;  2NTX A;  2X0L B;  3I0Q A;  4WNK A;  4I6N A;  3K8P C;  5LHI B;  1LVK A;  1BR2 A;  1NWM X;  1FEW A;  2XAJ B;  5H6R B;  1MIV A;  5CA0 E;  3Q5X A;  3LBX A;  2LJL A;  3KV4 A;  2X9X A;  4HKA A;  2X9Y A;  3GWH A;  1UCH A;  2YEV C;  2PBI A;  4PK5 A;  1QUU A;  3VHL A;  2V7L A;  3AB3 B;  5HXE A;  2P9B A;  4MLK A;  2W61 A;  3T8O A;  2V1D B;  1Z0P A;  3K3O A;  4H9R C;  5DAB A;  2K5B B;  3ESL A;  3C4W A;  4UV9 B;  1H7C A;  4PK6 A;  5JQG E;  1S94 A;  2MOZ A;  3A7S A;  2V7J A;  4OHF A;  3MAC A;  5HYA A;  2VWA A;  3CX8 B;  2BDE A;  3N2G E;  1X79 A;  2JRK A;  1YKH B;  2LSJ A;  3ZC0 A;  2EHO C;  4ERR A;  3QC9 A;  5LBQ B;  2ACX A;  3AVS A;  2N9D A;  3OYX A;  2KMF A;  1HS7 A;  5FNV E;  2X51 A;  4B6X A;  5FY0 A;  1D1B A;  3GA8 A;  2VL8 A;  2RA1 A;  2KND A;  5LNK A;  2X66 A;  3FXE B;  4ZOL E;  5JDN A;  3SOL A;  1YD8 G;  1S35 A;  2M67 A;  2ETL A;  3CVR A;  3BQL A;  1WRD A;  4HN9 A;  4JEH B;  5DQV A;  3RRW A;  4I43 B;  2NP9 A;  3I9W A;  4H63 H;  4V1A v;  2V7I A;  3HA4 A;  3PU3 A;  3ZPO A;  4ZI2 C;  4IHJ E;  3TB3 A;  1IJ6 A;  2D0U A;  4X1I E;  5FYM A;  5JDG A;  4DVD A;  3AA7 B;  5KDM C;  3ZYM A;  4IE5 A;  4I4T E;  5DJQ C;  3N9N A;  4O4J E;  4TV9 E;  1CUN A;  1VOM A;  2Q9Q A;  2Y8D A;  5LYJ E;  2VAS A;  3I1A A;  2DWG A;  3U78 A;  2LSY A;  2UXX B;  4ZI3 D;  3CQG B;  2PJQ A;  1D0X A;  1ZKE A;  3R6N A;  3PDY A;  4QXB B;  5CA1 E;  4M1P A;  2LSG A;  2XAH B;  3WAJ A;  4J2C A;  4CXY A;  2SPC A;  4L5G A;  4IIJ E;  2L9Q A;  1BR4 A;  3SWH A;  1MMN A;  5LCY A;  3ZMT B;  2K24 A;  3IFW A;  3K3Q C;  1UCU A;  5LOV E;  1UX4 A;  2WBL A;  2JQQ A;  3FXD B;  5JDM A;  1E1H B;  2VK9 A;  4EIW A;  3KBU A;  3ONX A;  3W15 B;  5ADX L;  3PTR B;  3HKD E;  1B7T A;  5HXR A;  2E9X A;  2I59 A;  3CQX C;  1WYB A;  3EDV A;  3UUX B;  4AKL A;  4L0R A;  2N2N A;  5ETW A;  5FP3 A;  4EZH A;  2ODU A;  3KBT A;  5KMG P;  4HGA A;  4CI1 B;  2VKD A;  4HE8 A;  3PUQ A;  3N9M A;  3HI2 A;  4K0U A;  1T98 A;  4O4H E;  4X20 E;  2Y6X A;  3ZMZ B;  1KNZ A;  3BK9 A;  3RIS A;  2V26 A;  4UIG A;  4QKN A;  4ZI7 E;  2MYS A;  4YFS A;  3RII A;  4EB6 E;  2EHO B;  3RRC A;  4UXN B;  5L3F B;  4DND A;  4AXP A;  4H63 V;  2KXP B;  2B1E A;  3RC8 A;  3SS1 A;  4E7S A;  2CMR A;  2NW7 A;  4OYK A;  4XBF B;  5FXX A;  3V5S A;  2L8K A;  1US7 B;  3Q2M A;  4UVC B;  1HG2 A;  3ZN1 B;  4BJM A;  1IAP A;  2KIN B;  5L3C B;  5FXW A;  4ZI3 C;  5AFU L;  2DLR A;  5LHH B;  2Y48 B;  4TV8 E;  2CEA A;  2LSI A;  3AA6 B;  4EYU A;  2W0G A;  4A56 A;  2LOP A;  2VB6 A;  4KP3 C;  1HFA A;  4AI6 A;  2Z6E A;  2RP4 A;  5L3D B;  2UXN B;  5FXV A;  4MHC A;  1SA0 E;  2ES0 A;  2H3R A;  3E08 A;  3ETU A;  2OA5 A;  3ZC1 A;  5F3J A;  2XTL A;  5JRC B;  4XZC A;  1CMX A;  2ZM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...