4UF7A

Ghanaian henipavirus (gh-m74a) attachment glycoprotein in complex with human ephrinb2
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
417
structure length
417
Chain Sequence
GPSPCRNFSSVPTIYYYRIPGLYNRTALDERCILNPRLTISSTKFAYVHSEYDKNCTRGFKYYELMTFGEILEGPEKEPRMFSRSFYSPTNAVNYHSCTPIVTVNEGYFLCLECTSSDPLYKANLSNSTFHLVILRHNKDEKIVSMPSFNLSTDQEYVQIIPAEGGGTAESGNLYFPCIGRLLHKRVTHPLCKKSNCSRTDDESCLKSYYNQGSPQHQVVNCLIRIRNAQRDNPTWDVITVDLTNTYPGSRSRIFGSFSKPMLYQSSVSWHTLLQVAEITDLDKYQLDWLDTPYISRPGGSECPFGNYCPTVCWEGTYNDVYSLTPNNDLFVTVYLKSEQVAENPYFAIFSRDQILKEFPLDAWISSARTTTISCFMFNNEIWCIAALEITRLNDDIIRPIYYSFWLPTDCRTPYPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Recognition of Human Ephrinb2 Cell Surface Receptor by an Emergent African Henipavirus.
pubmed doi rcsb
molecule keywords GLYCOPROTEIN
molecule tags Viral protein/immune system
source organism Bat paramyxovirus eid_hel/gh-m74a/gha/2009
total genus 101
structure length 417
sequence length 417
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.10 Mainly Beta 6 Propeller Neuraminidase Neuraminidase 4uf7A00
4MWWA 1N1TA 2AEQA 4XIOA 4HZXA 4YW1A 2VW1A 4M3MA 5HX0A 3W09A 1MZ5A 4MZAA 4QN6A 3GVJA 4HZYA 4HZVA 1INWA 1F8CA 4J9TA 4HZZA 3BEQA 1MS8A 1NCCN 2YA6A 2HTRA 4QN4A 1F8DA 4MWUA 4MJVA 1IVEA 1NN2A 4QNPA 4X6KA 2AH2A 2YA4A 5HUKA 3SALA 4HIZA 4FPJA 5F9TA 2W38A 4K1JA 3TI4A 2HTWA 4XOGA 2VSKA 4GZXA 4XJAA 2QWKA 4XE9A 4YW4A 3K39A 4FVKA 2QWIA 1IVFA 7NN9A 4YZ2A 2VWDA 3O9JA 2ZB5A 1IVGA 2HU4A 4KS1A 1DIMA 3TIBA 4GEZA 1N1SA 2FHRA 2QWCA 4XJ8A 2XZIA 2F25A 3CYEA 2F0ZA 3K37A 4H52A 4CPZA 1MS4A 2F27A 4X47A 4MWXA 4FP2A 2AGSA 1NMBN 1MS9A 4KS4A 1NSBA 3GVLA 3NN9A 2W5NA 4WA3A 3H6JA 2VW2A 1VCUA 1NNAA 4FPFA 2XZJA 1SO7A 2C4LA 4K1KA 5HUMA 4XJQA 4MWVA 1USRA 3ALXA 2SIMA 1W1XA 4B7MA 1W0OA 2YA5A 2SILA 4GZTA 4FP3A 1W8NA 2HT8A 4GZSA 1E8TA 4QN7A 1SNTA 1NNCA 4M4VA 2A75A 4M4NA 1V0EA 1MS0A 2XZKA 4B7JA 2YDTA 1V3BA 1Z50A 1V3EA 2F13A 4K3YA 1INFA 1A4GA 2ZB6A 4CPOA 1INVA 4GZOA 2QWDA 2HT5A 1IVCA 4XYXA 3NSSA 4FOYA 1BJIA 4FPLA 4UF7A 2YDPA 4B7RA 2BERA 2VVZA 4XILA 2QWBA 4FOQA 1WCQA 1V3DA 1W8OA 4MX0A 1MS1A 3H71A 3JU4A 4QN3A 2QWJA 2YA7A 2W5OA 1W20A 1KITA 2VK6A 3A72A 3TI5A 4CPYA 2HTVA 4WA5A 2HT7A 4FPGA 1L7FA 3K38A 4YW2A 4MC7A 3TIAA 2BF6A 4FQ4A 1S0IA 4D8SA 2AEPA 3B7EA 3GVKA 3INBA 4XJZA 3H72A 4NCSA 1NNBA 4XMIA 1DILA 2QWEA 4M4UA 1MWEA 2VK5A 4XJWA 4DGRA 1Z4ZA 1SLLA 3TI3A 1S0JA 4FZHA 1WCSA 1F8EA 1MS5A 4GZPA 4MZEA 4Q6KA 2RKCA 4K1IA 3CL2A 1L7HA 4CPLA 4FPYA 1NSDA 1A14N 4FOVA 3K36A 2F29A 2JKBA 2VK7A 1INYA 1XOGA 1EUTA 4X49A 2X9MA 1E8VA 4GDIA 1NSCA 4YZ4A 1W0PA 2F24A 2F28A 2HU0A 1INGA 5NN9A 4FJ6A 4NN9A 4JF7A 1MS3A 1N1VA 4WA4A 4GDJA 4MJUA 1EUUA 2BATA 1V3CA 2QWGA 4XJUA 1NCDN 1Z4YA 2F12A 3CL0A 1Z4WA 4GZWA 3TICA 3SANA 1N1YA 4KS2A 3K3AA 4WEGA 1IVDA 1XOEA 4X4AA 1B9TA 1NCAN 3OPZA 3SILA 1E8UA 4MWLA 2F11A 4FOWA 4CPMA 4FPKA 3TI8A 2QWAA 1Z4VA 4MWJA 4QN5A 4FPHA 3SLIA 4SLIA 4KS5A 1EUSA 5JYYA 1NCBN 1INXA 4XHBA 4YZ5A 4H53A 3D12A 5HUGA 1A4QA 4MWYA 1F8BA 3PJQA 2CMLA 1SLIA 1B9SA 2B8HA 4XJ9A 1MZ6A 2BZDA 2XCYA 1NMAN 4FPEA 1INHA 1USXA 6NN9A 1MR5A 1B9VA 1V0ZA 4XIKA 2F26A 4I00A 2HTQA 2HTUA 4CPNA 3D11A 2C4AA 5B2DA 1L7GA 4GZQA 2YA8A 1Z4XA 2VW0A 3A71A 4YZ3A 4XJRA 4BBWA 4NC5A 4B7QA 4FPCA 4WEFA 5M1ZA 4HZWA 4GB1A 4B7NA 4GJTA 2W20A 3TI6A 4YW3A 3O9KA 4MWQA 3T1EA 4XMAA 1V0FA 1V2IA 2QWFA 3ALWA 4XHXA 2QWHA 2HTYA 1EURA 1VCJA 3CKZA 4K1HA 4FPOB 4YW5A 4YZ1A 1IVBA 1NMCA 4MWRA 2VSMA 5B2CA 2SLIA 3B69A 5HUNA 2F10A 4KS3A 3H73A 1W21A
chains in the Genus database with same CATH superfamily
4MWWA 3TC9A 1N1TA 2IAPA 3II7A 2AEQA 1H6LA 4XIOA 4HZXA 4YW1A 2VW1A 4M3MA 4D52C 5HX0A 3W09A 1MZ5A 2H2UA 4MZAA 4QN6A 3GVJA 4HZYA 4HZVA 1INWA 3WWAA 4L7BA 1F8CA 4J9TA 4HZZA 3BEQA 2GVVA 1MS8A 1NCCN 3V64C 3FVZA 2YA6A 2P4OA 2HQSA 2HTRA 4QN4A 1F8DA 4MWUA 4MJVA 1IVEA 1NN2A 4QNPA 1E1AA 4X6KA 1SUUA 2AH2A 4HHQA 1ZGKA 2YA4A 5HUKA 2ISMA 3SALA 4HIZA 4FPJA 3E5ZA 5F9TA 2W38A 4K1JA 3TI4A 4O5TA 3WN7A 2HTWA 4XOGA 2VSKA 4GZXA 4XJAA 2QWKA 4XE9A 3SREA 4YW4A 1WP5A 5GTQA 3S8ZA 5EO8A 3K39A 3KYAA 4FVKA 2QWIA 4YY8A 4AGTA 1IVFA 5GX1A 3LI4A 3KGGA 7NN9A 4YZ2A 2VWDA 2IAWA 3O9JA 4XMBA 2ZB5A 2FPCA 1IVGA 3SRGA 2HU4A 4GNAA 4KS1A 1DIMA 4G3NA 3TIBA 4GEZA 2IARA 1N1SA 2FHRA 2QWCA 3Q6PA 2IAOA 4XJ8A 5H47A 2XZIA 2POOA 2F25A 3CYEA 2F0ZA 3K37A 4H52A 4CPZA 3O4PA 3HLHA 1MS4A 2F27A 2DSOA 2ZWAA 4X47A 2OJHA 4MWXA 4FP2A 4ASCA 2AGSA 4ZGCA 5CGJA 1NMBN 1MS9A 3ZGDA 4KS4A 1NSBA 3GVLA 2FPBA 3Q6KA 1IUBA 2FP9A 2GVWA 3NN9A 2W5NA 4WA3A 3H6JA 2W8BA 2VW2A 5FWWA 1VCUA 1NNAA 4FPFA 2XZJA 1SO7A 2C4LA 4K1KA 5D9CA 5HUMA 4XJQA 2IAQA 4C1YB 4MWVA 1S18A 1USRA 3NO0A 2GVUA 3ALXA 4O5SA 2SIMA 1W1XA 4B7MA 1W0OA 2YA5A 2SILA 4GZTA 3V1SA 2VPJA 4IMBA 4FP3A 1W8NA 2HT8A 4GZSA 1E8TA 4QN7A 1SNTA 1NNCA 4M4VA 2A75A 4M4NA 5EX7A 1V0EA 1MS0A 2XZKA 4B7JA 2YDTA 1V3BA 1Z50A 1V3EA 2F13A 4K3YA 2DYHA 2V91A 1INFA 1A4GA 2ZB6A 4CPOA 2DG0A 1INVA 4GZOA 2QWDA 2HT5A 1IVCA 4XYXA 3NSSA 4FOYA 1BJIA 3A9HA 4FPLA 1N6DA 4UF7A 2YDPA 4B7RA 2BERA 2VVZA 4XILA 2QWBA 4FOQA 1PJXA 1WCQA 1V3DA 3UC1A 1W8OA 3VNHA 4MX0A 1MS1A 3H71A 3JU4A 4D52B 4QN3A 2QWJA 1S1DA 1CVMA 2YA7A 4PWZA 3ADEA 2W5OA 1QBIA 5FNRA 2ZZKA 1W20A 1KITA 2VK6A 3A72A 3TI5A 4CPYA 2HTVA 3ZGCA 5GX2A 4WA5A 2HT7A 4GN7A 3S2KA 5FZNA 4FPGA 1L7FA 1CRZA 2FLUX 3K38A 4YW2A 4MC7A 5GX4A 3TIAA 2BF6A 4FQ4A 1S0IA 1RWIA 4D8SA 4UOUA 2AEPA 3B7EA 3GVKA 5FNSA 3INBA 1CQ1A 4XJZA 3FW0A 3VNGA 1QLGA 3WW9A 3H72A 4NCSA 1NNBA 4XMIA 2W8BB 1DILA 2QWEA 4M4UA 1MWEA 2VK5A 3HLIA 4XJWA 4DGRA 1Z4ZA 2IAVA 1SLLA 3TI3A 1S0JA 4FZHA 1WCSA 1F8EA 1MS5A 2XN4A 4GZPA 4MZEA 1N7DA 4Q6KA 1X2JA 2RKCA 4K1IA 3CL2A 1L7HA 4CPLA 3U0SA 3LI5A 1N6FA 4FPYA 1NSDA 1A14N 2GHSA 4FOVA 4AGIA 1K32A 3K36A 4HW6A 2F29A 3L6VA 1V04A 2JKBA 5FZJA 2VK7A 1INYA 1XOGA 1EUTA 4X49A 2X9MA 1E8VA 4GDIA 1NSCA 4YZ4A 1W0PA 4R40A 2F24A 2F28A 2HU0A 1INGA 5NN9A 3A9GA 4FJ6A 4NN9A 3AMSA 4JF7A 1MS3A 1N1VA 4WA4A 2ZW9A 3S8VA 4GDJA 4MJUA 3V65B 4D4UA 2IASA 1EUUA 2BATA 1V3CA 2Z32A 2QWGA 4IFJA 2WOZA 4A0PA 4XJUA 4AH4A 1X2RA 1NCDN 1ZI0A 1Z4YA 2F12A 4L7CA 3CL0A 4JMLA 1Z4WA 2IAXA 1Q7FA 3HRPA 4IFLX 4GZWA 3TICA 3SANA 1N1YA 3IAXA 4KS2A 1POOA 5GX5A 3K3AA 3Q6TA 4WEGA 4C1YA 1IVDA 1XOEA 4X4AA 1B9TA 4GNCA 2IVZA 1IJQA 2H2NA 1NCAN 3G4HA 3S94A 3OPZA 3SILA 1E8UA 4MWLA 4ZLRA 2F11A 4FOWA 2QE8A 2IATA 4CPMA 4FPKA 3TI8A 2FP8A 2QWAA 1Z4VA 4CSDA 4MWJA 4QN5A 4FPHA 3SLIA 4SLIA 4KS5A 1EUSA 5JYYA 1NCBN 1INXA 4XHBA 4CH9A 4YZ5A 4H53A 3D12A 5HUGA 1A4QA 4MWYA 1F8BA 3SOBB 4IYGA 3PJQA 3DR2A 4HHOA 2CMLA 1OFZA 1SLIA 4IFNX 3SOQA 1B9SA 2B8HA 4XJ9A 1MZ6A 2VAQA 2BZDA 2XCYA 4GN9A 1IUCA 3WDZA 4D52A 1NMAN 4FPEA 1INHA 4GN8A 1USXA 2GVXA 6NN9A 1MR5A 1B9VA 2IAUA 1V0ZA 1RWLA 4XIKA 4AHAA 2F26A 4I00A 2DG1A 4DG6A 2HTQA 2HTUA 4CPNA 3D11A 2C4AA 1NPEA 5FNUA 1L7GA 4GZQA 5B2DA 2YA8A 1Z4XA 2VW0A 3A71A 4YZ3A 4XJRA 1C5KA 4BBWA 4NC5A 4B7QA 4FPCA 4WEFA 5M1ZA 4HZWA 4Q1UA 1N6EA 4GB1A 4B7NA 2G8SA 4ZY3A 4CHBA 1U6DX 4GJTA 2W20A 4IN4A 3TI6A 4YW3A 3O9KA 4MWQA 4IQKA 3T1EA 1C9UA 4XMAA 1V0FA 1V2IA 2QWFA 3ALWA 4XHXA 3AMRA 3DASA 4L7DA 1CRUA 4GNBA 5D9DA 3LI3A 2QWHA 5GX3A 2HTYA 1EURA 5FNQA 1VCJA 4N1BA 3BYCA 3SOVA 5F72C 3CKZA 4K1HA 3I1CA 5D9BA 4FPOB 4YW5A 5EO7A 4YZ1A 1IVBA 1NMCA 5FNTA 4MWRA 2VSMA 5B2CA 3G4EA 2SLIA 3B69A 5HUNA 2F10A 4KS3A 3H73A 1W21A 3P5BL
chains in the Genus database with same CATH topology
4MWWA 1N1TA 2AEQA 4XIOA 4HZXA 4YW1A 2VW1A 4M3MA 5HX0A 3W09A 1MZ5A 2H2UA 4MZAA 4QN6A 3GVJA 4HZYA 4HZVA 1INWA 1F8CA 4J9TA 4HZZA 3BEQA 1MS8A 1NCCN 2YA6A 2HTRA 4QN4A 1F8DA 4MWUA 4MJVA 1IVEA 1NN2A 4QNPA 4X6KA 2AH2A 2YA4A 5HUKA 3SALA 4HIZA 4FPJA 5F9TA 2W38A 4K1JA 3TI4A 2HTWA 4XOGA 2VSKA 4GZXA 4XJAA 2QWKA 4XE9A 4YW4A 3K39A 4FVKA 2QWIA 1IVFA 7NN9A 4YZ2A 2VWDA 3O9JA 2ZB5A 1IVGA 2HU4A 4KS1A 1DIMA 3TIBA 4GEZA 1N1SA 2FHRA 2QWCA 4XJ8A 2XZIA 2F25A 3CYEA 2F0ZA 3K37A 4H52A 4CPZA 1MS4A 2F27A 4X47A 4MWXA 4FP2A 2AGSA 1NMBN 1MS9A 4KS4A 1NSBA 3GVLA 3NN9A 2W5NA 4WA3A 3H6JA 2VW2A 1VCUA 1NNAA 4FPFA 2XZJA 1SO7A 2C4LA 4K1KA 5HUMA 4XJQA 4MWVA 1S18A 1USRA 3ALXA 2SIMA 1W1XA 4B7MA 1W0OA 2YA5A 2SILA 4GZTA 4FP3A 1W8NA 2HT8A 4GZSA 1E8TA 4QN7A 1SNTA 1NNCA 4M4VA 2A75A 4M4NA 1V0EA 1MS0A 2XZKA 4B7JA 2YDTA 1V3BA 1Z50A 1V3EA 2F13A 4K3YA 1INFA 1A4GA 2ZB6A 4CPOA 1INVA 4GZOA 2QWDA 2HT5A 1IVCA 4XYXA 3NSSA 4FOYA 1BJIA 4FPLA 4UF7A 2YDPA 4B7RA 2BERA 2VVZA 4XILA 2QWBA 4FOQA 1WCQA 1V3DA 1W8OA 4MX0A 1MS1A 3H71A 3JU4A 4QN3A 2QWJA 1S1DA 2YA7A 2W5OA 1W20A 1KITA 2VK6A 3A72A 3TI5A 4CPYA 2HTVA 4WA5A 2HT7A 4FPGA 1L7FA 3K38A 4YW2A 4MC7A 3TIAA 2BF6A 4FQ4A 1S0IA 4D8SA 2AEPA 3B7EA 3GVKA 3INBA 4XJZA 3H72A 4NCSA 1NNBA 4XMIA 1DILA 2QWEA 4M4UA 1MWEA 2VK5A 4XJWA 4DGRA 1Z4ZA 1SLLA 3TI3A 1S0JA 4FZHA 1WCSA 1F8EA 1MS5A 4GZPA 4MZEA 4Q6KA 2RKCA 4K1IA 3CL2A 1L7HA 4CPLA 4FPYA 1NSDA 1A14N 4FOVA 3K36A 2F29A 2JKBA 2VK7A 1INYA 1XOGA 1EUTA 4X49A 2X9MA 1E8VA 4GDIA 1NSCA 4YZ4A 1W0PA 2F24A 2F28A 2HU0A 1INGA 5NN9A 4FJ6A 4NN9A 4JF7A 1MS3A 1N1VA 4WA4A 4GDJA 4MJUA 1EUUA 2BATA 1V3CA 2QWGA 4XJUA 1NCDN 1Z4YA 2F12A 3CL0A 1Z4WA 4GZWA 3TICA 3SANA 1N1YA 4KS2A 3K3AA 4WEGA 1IVDA 1XOEA 4X4AA 1B9TA 2H2NA 1NCAN 3OPZA 3SILA 1E8UA 4MWLA 2F11A 4FOWA 4CPMA 4FPKA 3TI8A 2QWAA 1Z4VA 4MWJA 4QN5A 4FPHA 3SLIA 4SLIA 4KS5A 1EUSA 5JYYA 1NCBN 1INXA 4XHBA 4YZ5A 4H53A 3D12A 5HUGA 1A4QA 4MWYA 1F8BA 3PJQA 2CMLA 1SLIA 1B9SA 2B8HA 4XJ9A 1MZ6A 2BZDA 2XCYA 1NMAN 4FPEA 1INHA 1USXA 6NN9A 1MR5A 1B9VA 1V0ZA 4XIKA 2F26A 4I00A 2HTQA 2HTUA 4CPNA 3D11A 2C4AA 5B2DA 1L7GA 4GZQA 2YA8A 1Z4XA 2VW0A 3A71A 4YZ3A 4XJRA 4BBWA 4NC5A 4B7QA 4FPCA 4WEFA 5M1ZA 4HZWA 4GB1A 4B7NA 4GJTA 2W20A 3TI6A 4YW3A 3O9KA 4MWQA 3T1EA 4XMAA 1V0FA 1V2IA 2QWFA 3ALWA 4XHXA 2QWHA 2HTYA 1EURA 1VCJA 3CKZA 4K1HA 4FPOB 4YW5A 4YZ1A 1IVBA 1NMCA 4MWRA 2VSMA 5B2CA 2SLIA 3B69A 5HUNA 2F10A 4KS3A 3H73A 1W21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MWW A;  1N1T A;  2AEQ A;  4XIO A;  4HZX A;  4YW1 A;  2VW1 A;  4M3M A;  5HX0 A;  3W09 A;  1MZ5 A;  4MZA A;  4QN6 A;  3GVJ A;  4HZY A;  4HZV A;  1INW A;  1F8C A;  4J9T A;  4HZZ A;  3BEQ A;  1MS8 A;  1NCC N;  2YA6 A;  2HTR A;  4QN4 A;  1F8D A;  4MWU A;  4MJV A;  1IVE A;  1NN2 A;  4QNP A;  4X6K A;  2AH2 A;  2YA4 A;  5HUK A;  3SAL A;  4HIZ A;  4FPJ A;  5F9T A;  2W38 A;  4K1J A;  3TI4 A;  2HTW A;  4XOG A;  2VSK A;  4GZX A;  4XJA A;  2QWK A;  4XE9 A;  4YW4 A;  3K39 A;  4FVK A;  2QWI A;  1IVF A;  7NN9 A;  4YZ2 A;  2VWD A;  3O9J A;  2ZB5 A;  1IVG A;  2HU4 A;  4KS1 A;  1DIM A;  3TIB A;  4GEZ A;  1N1S A;  2FHR A;  2QWC A;  4XJ8 A;  2XZI A;  2F25 A;  3CYE A;  2F0Z A;  3K37 A;  4H52 A;  4CPZ A;  1MS4 A;  2F27 A;  4X47 A;  4MWX A;  4FP2 A;  2AGS A;  1NMB N;  1MS9 A;  4KS4 A;  1NSB A;  3GVL A;  3NN9 A;  2W5N A;  4WA3 A;  3H6J A;  2VW2 A;  1VCU A;  1NNA A;  4FPF A;  2XZJ A;  1SO7 A;  2C4L A;  4K1K A;  5HUM A;  4XJQ A;  4MWV A;  1USR A;  3ALX A;  2SIM A;  1W1X A;  4B7M A;  1W0O A;  2YA5 A;  2SIL A;  4GZT A;  4FP3 A;  1W8N A;  2HT8 A;  4GZS A;  1E8T A;  4QN7 A;  1SNT A;  1NNC A;  4M4V A;  2A75 A;  4M4N A;  1V0E A;  1MS0 A;  2XZK A;  4B7J A;  2YDT A;  1V3B A;  1Z50 A;  1V3E A;  2F13 A;  4K3Y A;  1INF A;  1A4G A;  2ZB6 A;  4CPO A;  1INV A;  4GZO A;  2QWD A;  2HT5 A;  1IVC A;  4XYX A;  3NSS A;  4FOY A;  1BJI A;  4FPL A;  4UF7 A;  2YDP A;  4B7R A;  2BER A;  2VVZ A;  4XIL A;  2QWB A;  4FOQ A;  1WCQ A;  1V3D A;  1W8O A;  4MX0 A;  1MS1 A;  3H71 A;  3JU4 A;  4QN3 A;  2QWJ A;  2YA7 A;  2W5O A;  1W20 A;  1KIT A;  2VK6 A;  3A72 A;  3TI5 A;  4CPY A;  2HTV A;  4WA5 A;  2HT7 A;  4FPG A;  1L7F A;  3K38 A;  4YW2 A;  4MC7 A;  3TIA A;  2BF6 A;  4FQ4 A;  1S0I A;  4D8S A;  2AEP A;  3B7E A;  3GVK A;  3INB A;  4XJZ A;  3H72 A;  4NCS A;  1NNB A;  4XMI A;  1DIL A;  2QWE A;  4M4U A;  1MWE A;  2VK5 A;  4XJW A;  4DGR A;  1Z4Z A;  1SLL A;  3TI3 A;  1S0J A;  4FZH A;  1WCS A;  1F8E A;  1MS5 A;  4GZP A;  4MZE A;  4Q6K A;  2RKC A;  4K1I A;  3CL2 A;  1L7H A;  4CPL A;  4FPY A;  1NSD A;  1A14 N;  4FOV A;  3K36 A;  2F29 A;  2JKB A;  2VK7 A;  1INY A;  1XOG A;  1EUT A;  4X49 A;  2X9M A;  1E8V A;  4GDI A;  1NSC A;  4YZ4 A;  1W0P A;  2F24 A;  2F28 A;  2HU0 A;  1ING A;  5NN9 A;  4FJ6 A;  4NN9 A;  4JF7 A;  1MS3 A;  1N1V A;  4WA4 A;  4GDJ A;  4MJU A;  1EUU A;  2BAT A;  1V3C A;  2QWG A;  4XJU A;  1NCD N;  1Z4Y A;  2F12 A;  3CL0 A;  1Z4W A;  4GZW A;  3TIC A;  3SAN A;  1N1Y A;  4KS2 A;  3K3A A;  4WEG A;  1IVD A;  1XOE A;  4X4A A;  1B9T A;  1NCA N;  3OPZ A;  3SIL A;  1E8U A;  4MWL A;  2F11 A;  4FOW A;  4CPM A;  4FPK A;  3TI8 A;  2QWA A;  1Z4V A;  4MWJ A;  4QN5 A;  4FPH A;  3SLI A;  4SLI A;  4KS5 A;  1EUS A;  5JYY A;  1NCB N;  1INX A;  4XHB A;  4YZ5 A;  4H53 A;  3D12 A;  5HUG A;  1A4Q A;  4MWY A;  1F8B A;  3PJQ A;  2CML A;  1SLI A;  1B9S A;  2B8H A;  4XJ9 A;  1MZ6 A;  2BZD A;  2XCY A;  1NMA N;  4FPE A;  1INH A;  1USX A;  6NN9 A;  1MR5 A;  1B9V A;  1V0Z A;  4XIK A;  2F26 A;  4I00 A;  2HTQ A;  2HTU A;  4CPN A;  3D11 A;  2C4A A;  5B2D A;  1L7G A;  4GZQ A;  2YA8 A;  1Z4X A;  2VW0 A;  3A71 A;  4YZ3 A;  4XJR A;  4BBW A;  4NC5 A;  4B7Q A;  4FPC A;  4WEF A;  5M1Z A;  4HZW A;  4GB1 A;  4B7N A;  4GJT A;  2W20 A;  3TI6 A;  4YW3 A;  3O9K A;  4MWQ A;  3T1E A;  4XMA A;  1V0F A;  1V2I A;  2QWF A;  3ALW A;  4XHX A;  2QWH A;  2HTY A;  1EUR A;  1VCJ A;  3CKZ A;  4K1H A;  4FPO B;  4YW5 A;  4YZ1 A;  1IVB A;  1NMC A;  4MWR A;  2VSM A;  5B2C A;  2SLI A;  3B69 A;  5HUN A;  2F10 A;  4KS3 A;  3H73 A;  1W21 A; 
#chains in the Genus database with same CATH topology
 4MWW A;  3TC9 A;  1N1T A;  2IAP A;  3II7 A;  2AEQ A;  1H6L A;  4XIO A;  4HZX A;  4YW1 A;  2VW1 A;  4M3M A;  4D52 C;  5HX0 A;  3W09 A;  1MZ5 A;  2H2U A;  4MZA A;  4QN6 A;  3GVJ A;  4HZY A;  4HZV A;  1INW A;  3WWA A;  4L7B A;  1F8C A;  4J9T A;  4HZZ A;  3BEQ A;  2GVV A;  1MS8 A;  1NCC N;  3V64 C;  3FVZ A;  2YA6 A;  2P4O A;  2HQS A;  2HTR A;  4QN4 A;  1F8D A;  4MWU A;  4MJV A;  1IVE A;  1NN2 A;  4QNP A;  1E1A A;  4X6K A;  1SUU A;  2AH2 A;  4HHQ A;  1ZGK A;  2YA4 A;  5HUK A;  2ISM A;  3SAL A;  4HIZ A;  4FPJ A;  3E5Z A;  5F9T A;  2W38 A;  4K1J A;  3TI4 A;  4O5T A;  3WN7 A;  2HTW A;  4XOG A;  2VSK A;  4GZX A;  4XJA A;  2QWK A;  4XE9 A;  3SRE A;  4YW4 A;  1WP5 A;  5GTQ A;  3S8Z A;  5EO8 A;  3K39 A;  3KYA A;  4FVK A;  2QWI A;  4YY8 A;  4AGT A;  1IVF A;  5GX1 A;  3LI4 A;  3KGG A;  7NN9 A;  4YZ2 A;  2VWD A;  2IAW A;  3O9J A;  4XMB A;  2ZB5 A;  2FPC A;  1IVG A;  3SRG A;  2HU4 A;  4GNA A;  4KS1 A;  1DIM A;  4G3N A;  3TIB A;  4GEZ A;  2IAR A;  1N1S A;  2FHR A;  2QWC A;  3Q6P A;  2IAO A;  4XJ8 A;  5H47 A;  2XZI A;  2POO A;  2F25 A;  3CYE A;  2F0Z A;  3K37 A;  4H52 A;  4CPZ A;  3O4P A;  3HLH A;  1MS4 A;  2F27 A;  2DSO A;  2ZWA A;  4X47 A;  2OJH A;  4MWX A;  4FP2 A;  4ASC A;  2AGS A;  4ZGC A;  5CGJ A;  1NMB N;  1MS9 A;  3ZGD A;  4KS4 A;  1NSB A;  3GVL A;  2FPB A;  3Q6K A;  1IUB A;  2FP9 A;  2GVW A;  3NN9 A;  2W5N A;  4WA3 A;  3H6J A;  2W8B A;  2VW2 A;  5FWW A;  1VCU A;  1NNA A;  4FPF A;  2XZJ A;  1SO7 A;  2C4L A;  4K1K A;  5D9C A;  5HUM A;  4XJQ A;  2IAQ A;  4C1Y B;  4MWV A;  1S18 A;  1USR A;  3NO0 A;  2GVU A;  3ALX A;  4O5S A;  2SIM A;  1W1X A;  4B7M A;  1W0O A;  2YA5 A;  2SIL A;  4GZT A;  3V1S A;  2VPJ A;  4IMB A;  4FP3 A;  1W8N A;  2HT8 A;  4GZS A;  1E8T A;  4QN7 A;  1SNT A;  1NNC A;  4M4V A;  2A75 A;  4M4N A;  5EX7 A;  1V0E A;  1MS0 A;  2XZK A;  4B7J A;  2YDT A;  1V3B A;  1Z50 A;  1V3E A;  2F13 A;  4K3Y A;  2DYH A;  2V91 A;  1INF A;  1A4G A;  2ZB6 A;  4CPO A;  2DG0 A;  1INV A;  4GZO A;  2QWD A;  2HT5 A;  1IVC A;  4XYX A;  3NSS A;  4FOY A;  1BJI A;  3A9H A;  4FPL A;  1N6D A;  4UF7 A;  2YDP A;  4B7R A;  2BER A;  2VVZ A;  4XIL A;  2QWB A;  4FOQ A;  1PJX A;  1WCQ A;  1V3D A;  3UC1 A;  1W8O A;  3VNH A;  4MX0 A;  1MS1 A;  3H71 A;  3JU4 A;  4D52 B;  4QN3 A;  2QWJ A;  1S1D A;  1CVM A;  2YA7 A;  4PWZ A;  3ADE A;  2W5O A;  1QBI A;  5FNR A;  2ZZK A;  1W20 A;  1KIT A;  2VK6 A;  3A72 A;  3TI5 A;  4CPY A;  2HTV A;  3ZGC A;  5GX2 A;  4WA5 A;  2HT7 A;  4GN7 A;  3S2K A;  5FZN A;  4FPG A;  1L7F A;  1CRZ A;  2FLU X;  3K38 A;  4YW2 A;  4MC7 A;  5GX4 A;  3TIA A;  2BF6 A;  4FQ4 A;  1S0I A;  1RWI A;  4D8S A;  4UOU A;  2AEP A;  3B7E A;  3GVK A;  5FNS A;  3INB A;  1CQ1 A;  4XJZ A;  3FW0 A;  3VNG A;  1QLG A;  3WW9 A;  3H72 A;  4NCS A;  1NNB A;  4XMI A;  2W8B B;  1DIL A;  2QWE A;  4M4U A;  1MWE A;  2VK5 A;  3HLI A;  4XJW A;  4DGR A;  1Z4Z A;  2IAV A;  1SLL A;  3TI3 A;  1S0J A;  4FZH A;  1WCS A;  1F8E A;  1MS5 A;  2XN4 A;  4GZP A;  4MZE A;  1N7D A;  4Q6K A;  1X2J A;  2RKC A;  4K1I A;  3CL2 A;  1L7H A;  4CPL A;  3U0S A;  3LI5 A;  1N6F A;  4FPY A;  1NSD A;  1A14 N;  2GHS A;  4FOV A;  4AGI A;  1K32 A;  3K36 A;  4HW6 A;  2F29 A;  3L6V A;  1V04 A;  2JKB A;  5FZJ A;  2VK7 A;  1INY A;  1XOG A;  1EUT A;  4X49 A;  2X9M A;  1E8V A;  4GDI A;  1NSC A;  4YZ4 A;  1W0P A;  4R40 A;  2F24 A;  2F28 A;  2HU0 A;  1ING A;  5NN9 A;  3A9G A;  4FJ6 A;  4NN9 A;  3AMS A;  4JF7 A;  1MS3 A;  1N1V A;  4WA4 A;  2ZW9 A;  3S8V A;  4GDJ A;  4MJU A;  3V65 B;  4D4U A;  2IAS A;  1EUU A;  2BAT A;  1V3C A;  2Z32 A;  2QWG A;  4IFJ A;  2WOZ A;  4A0P A;  4XJU A;  4AH4 A;  1X2R A;  1NCD N;  1ZI0 A;  1Z4Y A;  2F12 A;  4L7C A;  3CL0 A;  4JML A;  1Z4W A;  2IAX A;  1Q7F A;  3HRP A;  4IFL X;  4GZW A;  3TIC A;  3SAN A;  1N1Y A;  3IAX A;  4KS2 A;  1POO A;  5GX5 A;  3K3A A;  3Q6T A;  4WEG A;  4C1Y A;  1IVD A;  1XOE A;  4X4A A;  1B9T A;  4GNC A;  2IVZ A;  1IJQ A;  2H2N A;  1NCA N;  3G4H A;  3S94 A;  3OPZ A;  3SIL A;  1E8U A;  4MWL A;  4ZLR A;  2F11 A;  4FOW A;  2QE8 A;  2IAT A;  4CPM A;  4FPK A;  3TI8 A;  2FP8 A;  2QWA A;  1Z4V A;  4CSD A;  4MWJ A;  4QN5 A;  4FPH A;  3SLI A;  4SLI A;  4KS5 A;  1EUS A;  5JYY A;  1NCB N;  1INX A;  4XHB A;  4CH9 A;  4YZ5 A;  4H53 A;  3D12 A;  5HUG A;  1A4Q A;  4MWY A;  1F8B A;  3SOB B;  4IYG A;  3PJQ A;  3DR2 A;  4HHO A;  2CML A;  1OFZ A;  1SLI A;  4IFN X;  3SOQ A;  1B9S A;  2B8H A;  4XJ9 A;  1MZ6 A;  2VAQ A;  2BZD A;  2XCY A;  4GN9 A;  1IUC A;  3WDZ A;  4D52 A;  1NMA N;  4FPE A;  1INH A;  4GN8 A;  1USX A;  2GVX A;  6NN9 A;  1MR5 A;  1B9V A;  2IAU A;  1V0Z A;  1RWL A;  4XIK A;  4AHA A;  2F26 A;  4I00 A;  2DG1 A;  4DG6 A;  2HTQ A;  2HTU A;  4CPN A;  3D11 A;  2C4A A;  1NPE A;  5FNU A;  1L7G A;  4GZQ A;  5B2D A;  2YA8 A;  1Z4X A;  2VW0 A;  3A71 A;  4YZ3 A;  4XJR A;  1C5K A;  4BBW A;  4NC5 A;  4B7Q A;  4FPC A;  4WEF A;  5M1Z A;  4HZW A;  4Q1U A;  1N6E A;  4GB1 A;  4B7N A;  2G8S A;  4ZY3 A;  4CHB A;  1U6D X;  4GJT A;  2W20 A;  4IN4 A;  3TI6 A;  4YW3 A;  3O9K A;  4MWQ A;  4IQK A;  3T1E A;  1C9U A;  4XMA A;  1V0F A;  1V2I A;  2QWF A;  3ALW A;  4XHX A;  3AMR A;  3DAS A;  4L7D A;  1CRU A;  4GNB A;  5D9D A;  3LI3 A;  2QWH A;  5GX3 A;  2HTY A;  1EUR A;  5FNQ A;  1VCJ A;  4N1B A;  3BYC A;  3SOV A;  5F72 C;  3CKZ A;  4K1H A;  3I1C A;  5D9B A;  4FPO B;  4YW5 A;  5EO7 A;  4YZ1 A;  1IVB A;  1NMC A;  5FNT A;  4MWR A;  2VSM A;  5B2C A;  3G4E A;  2SLI A;  3B69 A;  5HUN A;  2F10 A;  4KS3 A;  3H73 A;  1W21 A;  3P5B L; 
#chains in the Genus database with same CATH homology
 4MWW A;  1N1T A;  2AEQ A;  4XIO A;  4HZX A;  4YW1 A;  2VW1 A;  4M3M A;  5HX0 A;  3W09 A;  1MZ5 A;  2H2U A;  4MZA A;  4QN6 A;  3GVJ A;  4HZY A;  4HZV A;  1INW A;  1F8C A;  4J9T A;  4HZZ A;  3BEQ A;  1MS8 A;  1NCC N;  2YA6 A;  2HTR A;  4QN4 A;  1F8D A;  4MWU A;  4MJV A;  1IVE A;  1NN2 A;  4QNP A;  4X6K A;  2AH2 A;  2YA4 A;  5HUK A;  3SAL A;  4HIZ A;  4FPJ A;  5F9T A;  2W38 A;  4K1J A;  3TI4 A;  2HTW A;  4XOG A;  2VSK A;  4GZX A;  4XJA A;  2QWK A;  4XE9 A;  4YW4 A;  3K39 A;  4FVK A;  2QWI A;  1IVF A;  7NN9 A;  4YZ2 A;  2VWD A;  3O9J A;  2ZB5 A;  1IVG A;  2HU4 A;  4KS1 A;  1DIM A;  3TIB A;  4GEZ A;  1N1S A;  2FHR A;  2QWC A;  4XJ8 A;  2XZI A;  2F25 A;  3CYE A;  2F0Z A;  3K37 A;  4H52 A;  4CPZ A;  1MS4 A;  2F27 A;  4X47 A;  4MWX A;  4FP2 A;  2AGS A;  1NMB N;  1MS9 A;  4KS4 A;  1NSB A;  3GVL A;  3NN9 A;  2W5N A;  4WA3 A;  3H6J A;  2VW2 A;  1VCU A;  1NNA A;  4FPF A;  2XZJ A;  1SO7 A;  2C4L A;  4K1K A;  5HUM A;  4XJQ A;  4MWV A;  1S18 A;  1USR A;  3ALX A;  2SIM A;  1W1X A;  4B7M A;  1W0O A;  2YA5 A;  2SIL A;  4GZT A;  4FP3 A;  1W8N A;  2HT8 A;  4GZS A;  1E8T A;  4QN7 A;  1SNT A;  1NNC A;  4M4V A;  2A75 A;  4M4N A;  1V0E A;  1MS0 A;  2XZK A;  4B7J A;  2YDT A;  1V3B A;  1Z50 A;  1V3E A;  2F13 A;  4K3Y A;  1INF A;  1A4G A;  2ZB6 A;  4CPO A;  1INV A;  4GZO A;  2QWD A;  2HT5 A;  1IVC A;  4XYX A;  3NSS A;  4FOY A;  1BJI A;  4FPL A;  4UF7 A;  2YDP A;  4B7R A;  2BER A;  2VVZ A;  4XIL A;  2QWB A;  4FOQ A;  1WCQ A;  1V3D A;  1W8O A;  4MX0 A;  1MS1 A;  3H71 A;  3JU4 A;  4QN3 A;  2QWJ A;  1S1D A;  2YA7 A;  2W5O A;  1W20 A;  1KIT A;  2VK6 A;  3A72 A;  3TI5 A;  4CPY A;  2HTV A;  4WA5 A;  2HT7 A;  4FPG A;  1L7F A;  3K38 A;  4YW2 A;  4MC7 A;  3TIA A;  2BF6 A;  4FQ4 A;  1S0I A;  4D8S A;  2AEP A;  3B7E A;  3GVK A;  3INB A;  4XJZ A;  3H72 A;  4NCS A;  1NNB A;  4XMI A;  1DIL A;  2QWE A;  4M4U A;  1MWE A;  2VK5 A;  4XJW A;  4DGR A;  1Z4Z A;  1SLL A;  3TI3 A;  1S0J A;  4FZH A;  1WCS A;  1F8E A;  1MS5 A;  4GZP A;  4MZE A;  4Q6K A;  2RKC A;  4K1I A;  3CL2 A;  1L7H A;  4CPL A;  4FPY A;  1NSD A;  1A14 N;  4FOV A;  3K36 A;  2F29 A;  2JKB A;  2VK7 A;  1INY A;  1XOG A;  1EUT A;  4X49 A;  2X9M A;  1E8V A;  4GDI A;  1NSC A;  4YZ4 A;  1W0P A;  2F24 A;  2F28 A;  2HU0 A;  1ING A;  5NN9 A;  4FJ6 A;  4NN9 A;  4JF7 A;  1MS3 A;  1N1V A;  4WA4 A;  4GDJ A;  4MJU A;  1EUU A;  2BAT A;  1V3C A;  2QWG A;  4XJU A;  1NCD N;  1Z4Y A;  2F12 A;  3CL0 A;  1Z4W A;  4GZW A;  3TIC A;  3SAN A;  1N1Y A;  4KS2 A;  3K3A A;  4WEG A;  1IVD A;  1XOE A;  4X4A A;  1B9T A;  2H2N A;  1NCA N;  3OPZ A;  3SIL A;  1E8U A;  4MWL A;  2F11 A;  4FOW A;  4CPM A;  4FPK A;  3TI8 A;  2QWA A;  1Z4V A;  4MWJ A;  4QN5 A;  4FPH A;  3SLI A;  4SLI A;  4KS5 A;  1EUS A;  5JYY A;  1NCB N;  1INX A;  4XHB A;  4YZ5 A;  4H53 A;  3D12 A;  5HUG A;  1A4Q A;  4MWY A;  1F8B A;  3PJQ A;  2CML A;  1SLI A;  1B9S A;  2B8H A;  4XJ9 A;  1MZ6 A;  2BZD A;  2XCY A;  1NMA N;  4FPE A;  1INH A;  1USX A;  6NN9 A;  1MR5 A;  1B9V A;  1V0Z A;  4XIK A;  2F26 A;  4I00 A;  2HTQ A;  2HTU A;  4CPN A;  3D11 A;  2C4A A;  5B2D A;  1L7G A;  4GZQ A;  2YA8 A;  1Z4X A;  2VW0 A;  3A71 A;  4YZ3 A;  4XJR A;  4BBW A;  4NC5 A;  4B7Q A;  4FPC A;  4WEF A;  5M1Z A;  4HZW A;  4GB1 A;  4B7N A;  4GJT A;  2W20 A;  3TI6 A;  4YW3 A;  3O9K A;  4MWQ A;  3T1E A;  4XMA A;  1V0F A;  1V2I A;  2QWF A;  3ALW A;  4XHX A;  2QWH A;  2HTY A;  1EUR A;  1VCJ A;  3CKZ A;  4K1H A;  4FPO B;  4YW5 A;  4YZ1 A;  1IVB A;  1NMC A;  4MWR A;  2VSM A;  5B2C A;  2SLI A;  3B69 A;  5HUN A;  2F10 A;  4KS3 A;  3H73 A;  1W21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...