4UGPA

Structure of bacillus subtilis nitric oxide synthase in complex with n',n'-(((2r)-3-aminopropane-1,2-diyl)bis(oxymethanediylbenzene-3,1- diyl))dithiophene-2-carboximidamide
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
362
structure length
362
Chain Sequence
EEKEILWNEAKAFIAACYQELGKAAEVKDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPPEEKGEKQVEIWNHQLIRYAGYESDGERIGDPASCSLTAACEELGWRGERTDFDLLPLIFRMKGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDKPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitor Bound Crystal Structures of Bacterial Nitric Oxide Synthase.
pubmed doi rcsb
molecule keywords NITRIC OXIDE SYNTHASE OXYGENASE
molecule tags Oxidoreductase
source organism Bacillus subtilis
total genus 123
structure length 362
sequence length 362
ec nomenclature ec 1.14.14.47: Nitric-oxide synthase (flavodoxin).
pdb deposition date 2015-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02898 NO_synthase Nitric oxide synthase, oxygenase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.340.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase; Chain A, domain 1 Nitric Oxide Synthase; Chain A, domain 1 4ugpA01
3.90.440.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase;Heme Domain; Chain A, domain 2 Nitric Oxide Synthase;Heme Domain;Chain A domain 2 4ugpA02
3.90.1230.10 Alpha Beta Alpha-Beta Complex Bovine Endothelial Nitric Oxide Synthase Heme Domain; Chain: A,domain 3 Nitric Oxide Synthase; Chain A, domain 3 4ugpA03
3JX0A 5G6LA 4D3OA 2G6HA 3NLEA 1FOIA 4UGQA 4KCNA 3NLNA 3UFTA 2AN2A 3NLJA 3EBDA 3JWWA 3E67A 5FVSA 4KCSA 3HSNA 4K5GA 3JWUA 3NLWA 4CWZA 5FVOA 5ADCA 1K2RA 5G6KA 4CAMA 4CAQA 1RS8A 3TYNA 4KCQA 4JS9A 1M7ZA 1I83A 4UGYA 1NSEA 4K5JA 4UGFA 4D3BA 4D32A 4D3VA 4UGHA 3JWZA 4UG5A 4UGLA 5AGMA 1M9KA 4D3IA 1K2SA 4UGRA 1M8HA 3JT7A 4D30A 4UGXA 1M9MA 4D1NA 3NLTA 1P6HA 4D34A 1RS6A 3JX5A 3SVQA 1RS9A 3HSPA 4UHAA 1DWXA 4UGVA 5G6FA 4CUMA 2G6OA 1QW5A 1Q2OA 4UGDA 1D1XA 3N6AA 3JWSA 1ZZTA 3JT9A 7NSEA 4D7HA 2AN0A 1P6LA 4UH6A 4CAPA 4FW0A 3N69A 4FVXA 3N60A 4D3MA 4CX4A 4UGMA 3PNGA 2NOSA 4CUNA 4UPNA 3N5TA 5G6MA 4K5HA 4UGKA 2G6MA 2OROA 3B3OA 5FVYA 3UFQA 1DD7A 3TYMA 1VAFA 1M8DA 4D1OA 1D1YA 3EJ8A 2AMOA 3E7TA 3PNHA 3N5YA 2G6KA 2G6JA 4D7JA 2ORSA 5ADKA 4V3VA 1FOJA 4CTQA 1DMJA 5AD4A 3NLMA 4UGNA 5ADMA 4JSLA 5FJ2A 3N6GA 4K5EA 4D3KA 1DWWA 3N5SA 4UGIA 4UGBA 1P6NA 2HX3A 4C39A 3NODA 4CWYA 3E65A 3NLQA 4IMSA 4UG7A 5G6PA 3N5RA 4UH3A 3DWJA 1JWJA 4V3XA 4K5KA 4KCRA 4UGEA 1DM6A 4UH5A 1DMIA 1P6IA 3N68A 1DM8A 5FJ3A 3UFWA 2ORTA 4NOSA 3NNYA 3EAIA 2G6LA 4JSHA 5AD6A 4CWXA 3JX6A 5G6CA 3N5QA 3RQMA 4IMTA 4FVZA 4UPOA 3JT5A 5ADFA 4CX7A 3E7MA 4K5FA 3NLHA 4UGGA 4KCPA 5FW0A 5AGKA 5G68A 4D3AA 5G6QA 1R35A 2G6NA 3NLZA 3N62A 3E6TA 4KCKA 5FVQA 4FVWA 4UGSA 5FVUA 4CX5A 4V3UA 4CWVA 5FVZA 4D38A 1M7VA 4UH0A 1NODA 3B3MA 5G66A 4CTRA 5AGLA 3N63A 3EBFA 1ED6A 4EUXA 2FLQA 3DQTA 5G0NA 3E7SB 3JWYA 4CTUA 3UFSA 3NLOA 4UPPA 4UH9A 3DQSA 4UH1A 3NNZA 3JX2A 3UFPA 4D1PA 3SVPA 1D1WA 3JX4A 3PNFA 4D2YA 3HSOA 5ADNA 1P6JA 1M00A 3JWTA 4D37A 4CARA 4JSIA 4UGOA 4CU1B 1MMWA 4C3AA 3E6LA 1QW6A 4UH4A 4KCMA 3TYLA 5NSEA 4UGWA 3NOSA 1D0OA 3RQNA 5AGOA 3TYOA 3N6CA 2NSEA 3E7GA 5ADEA 4CDTA 4D7IA 4D35A 3JWXA 1M8IA 2ORRA 3E68A 3JT4A 1MJTA 4D33A 5ADBA 1ED4A 3E7IA 3RQOA 4UH2A 5G0PA 1ZZQA 4KCLA 3RQKA 3B3PA 5G6DA 3NLVA 1ZZRA 4KCIA 5AD5A 3DQRA 5ADGA 4K5DA 4UGCA 4UGUA 4FVYA 4CTTA 1D0CA 3JT8A 4UPRA 5ADLA 6NSEA 4UGAA 4CX0A 1NOCA 4KCHA 4D7OA 3JT3A 2HX2A 4JSJA 4CTWA 4D3UA 1DM7A 1ZZUA 3N6BA 4KCJA 4JSFA 3NQSA 1QW4A 3JTAA 5G0OA 5FVRA 4JSGA 8NSEA 1DMKA 3Q99A 5FVXA 4CTXA 1P6KA 4V3ZA 4JSKA 4CTYA 3N66A 1RS7A 5FVVA 9NSEA 3N5PA 3N6FA 4LWBA 1DF1A 5AD9A 4UG8A 2ORQA 5G69A 2G6IA 3RQPA 3N5VA 3Q9AA 3N64A 4KCOA 4NSEA 1P6MA 4CAOA 1FOPA 1K2UA 2NODA 3JX1A 4JSEA 5G6JA 4K5IA 4CANA 2ORPA 3NLYA 3NSEA 4LUWA 3NLRA 5G6IA 4V3WA 4D3JA 3NLDA 4JSMA 4IMWA 1M9JA 4CX3A 3E6NA 3JT6A 4V3YA 4CVGA 5AGPA 4CFTB 1DWVA 2FC1A 4UCHA 4UG9A 2NSIA 1LZZA 3N6EA 5ADJA 3RQJA 4CTVA 3NLGA 4GQEA 1D1VA 1ZVIA 4CX1A 1JWKA 5G6HA 3NLKA 4UQRA 5FVWA 3PNEA 4LWAA 4LUXA 5ADAA 3B3NA 1ZZSA 5FVPA 4UGJA 4UG6A 4CTZA 1OM5A 4CULA 4IMUA 4UPMA 5G6BA 5G6OA 4CFTA 5G6NA 2BHJA 4UPTA 4UGZA 1M9QA 3E7SA 4UPQA 1VAGA 3NLPA 1FOOA 2FBZX 4D2ZA 3N6DA 3N61A 4IMXA 5G67A 3NLUA 3N65A 1M9RA 3N67A 4CU0A 1NSIA 5G6EA 4D31A 4CWWA 4D39A 3NW2A 5G65A 4D3TA 3RQLA 3N5ZA 4CU1A 1M9TA 3UFVA 5FVTA 3N2RA 5G6GA 4UQSA 2FC2A 3EAHA 3E6OA 1N2NA 3N5XA 3NM0A 4D36A 1K2TA 4CX6A 1QWCA 1QOMA 3N5WA 3JX3A 1FOLA 5AD8A 1ED5A 4UPSA 5ADDA 1NOSA 4UGPA 4UH8A 1M8EA 4UH7A 3NLXA 1ZVLA 1OM4A 4D3NA 2Y37A 3NLIA 1LZXA 2HX4A 4CTPA 5AD7A 1MMVA 3JWVA 3NLFA 4UGTA 3FC5A 5ADIA 4CX2A 5G6AA 3UFUA 3UFRA 5AGNA 3UFOA
chains in the Genus database with same CATH superfamily
3JX0A 5G6LA 4D3OA 2G6HA 3NLEA 1FOIA 4UGQA 4KCNA 3NLNA 3UFTA 2AN2A 3NLJA 3EBDA 3JWWA 3E67A 5FVSA 4KCSA 3HSNA 4K5GA 3JWUA 3NLWA 4CWZA 5FVOA 5ADCA 1K2RA 5G6KA 4CAMA 4CAQA 1RS8A 3TYNA 4KCQA 4JS9A 1M7ZA 1I83A 4UGYA 1NSEA 4K5JA 4UGFA 4D3BA 4D32A 4D3VA 4UGHA 3JWZA 4UG5A 4UGLA 5AGMA 1M9KA 4D3IA 1K2SA 4UGRA 1M8HA 3JT7A 4D30A 4UGXA 1M9MA 4D1NA 3NLTA 1P6HA 4D34A 1RS6A 3JX5A 3SVQA 1RS9A 3HSPA 4UHAA 1DWXA 4UGVA 5G6FA 4CUMA 2G6OA 1QW5A 1Q2OA 4UGDA 1D1XA 3N6AA 3JWSA 1ZZTA 3JT9A 7NSEA 4D7HA 2AN0A 1P6LA 4UH6A 4CAPA 4FW0A 3N69A 4FVXA 3N60A 4D3MA 4CX4A 4UGMA 3PNGA 2NOSA 4CUNA 4UPNA 3N5TA 5G6MA 4K5HA 4UGKA 2G6MA 2OROA 3B3OA 5FVYA 3UFQA 1DD7A 3TYMA 1VAFA 1M8DA 4D1OA 1D1YA 3EJ8A 2AMOA 3E7TA 3PNHA 3N5YA 2G6KA 2G6JA 4D7JA 2ORSA 5ADKA 4V3VA 1FOJA 4CTQA 1DMJA 5AD4A 3NLMA 4UGNA 5ADMA 4JSLA 5FJ2A 3N6GA 4K5EA 4D3KA 1DWWA 3N5SA 4UGIA 4UGBA 1P6NA 2HX3A 4C39A 3NODA 4CWYA 3E65A 3NLQA 4IMSA 4UG7A 5G6PA 3N5RA 4UH3A 3DWJA 1JWJA 4V3XA 4K5KA 4KCRA 4UGEA 1DM6A 4UH5A 1DMIA 1P6IA 3N68A 1DM8A 5FJ3A 3UFWA 2ORTA 4NOSA 3NNYA 3EAIA 2G6LA 4JSHA 5AD6A 4CWXA 3JX6A 5G6CA 3N5QA 3RQMA 4IMTA 4FVZA 4UPOA 3JT5A 5ADFA 4CX7A 3E7MA 4K5FA 3NLHA 4UGGA 4KCPA 5FW0A 5AGKA 5G68A 4D3AA 5G6QA 1R35A 2G6NA 3NLZA 3N62A 3E6TA 4KCKA 5FVQA 4FVWA 4UGSA 5FVUA 4CX5A 4V3UA 4CWVA 5FVZA 4D38A 1M7VA 4UH0A 1NODA 3B3MA 5G66A 4CTRA 5AGLA 3N63A 3EBFA 1ED6A 4EUXA 2FLQA 3DQTA 5G0NA 3E7SB 3JWYA 4CTUA 3UFSA 3NLOA 4UPPA 4UH9A 3DQSA 4UH1A 3NNZA 3JX2A 3UFPA 4D1PA 3SVPA 1D1WA 3JX4A 3PNFA 4D2YA 3HSOA 5ADNA 1P6JA 1M00A 3JWTA 4D37A 4CARA 4JSIA 4UGOA 4CU1B 1MMWA 4C3AA 3E6LA 1QW6A 4UH4A 4KCMA 3TYLA 5NSEA 4UGWA 3NOSA 1D0OA 3RQNA 5AGOA 3TYOA 3N6CA 2NSEA 3E7GA 5ADEA 4CDTA 4D7IA 4D35A 3JWXA 1M8IA 2ORRA 3E68A 3JT4A 1MJTA 4D33A 5ADBA 1ED4A 3E7IA 3RQOA 4UH2A 5G0PA 1ZZQA 4KCLA 3RQKA 3B3PA 5G6DA 3NLVA 1ZZRA 4KCIA 5AD5A 3DQRA 5ADGA 4K5DA 4UGCA 4UGUA 4FVYA 4CTTA 1D0CA 3JT8A 4UPRA 5ADLA 6NSEA 4UGAA 4CX0A 1NOCA 4KCHA 4D7OA 3JT3A 2HX2A 4JSJA 4CTWA 4D3UA 1DM7A 1ZZUA 3N6BA 4KCJA 4JSFA 3NQSA 1QW4A 3JTAA 5G0OA 5FVRA 4JSGA 8NSEA 1DMKA 3Q99A 5FVXA 4CTXA 1P6KA 4V3ZA 4JSKA 4CTYA 3N66A 1RS7A 5FVVA 9NSEA 3N5PA 3N6FA 4LWBA 1DF1A 5AD9A 4UG8A 2ORQA 5G69A 2G6IA 3RQPA 3N5VA 3Q9AA 3N64A 4KCOA 4NSEA 1P6MA 4CAOA 1FOPA 1K2UA 2NODA 3JX1A 4JSEA 5G6JA 4K5IA 4CANA 2ORPA 3NLYA 3NSEA 4LUWA 3NLRA 5G6IA 4V3WA 4D3JA 3NLDA 4JSMA 4IMWA 1M9JA 4CX3A 3E6NA 3JT6A 4V3YA 4CVGA 5AGPA 4CFTB 1DWVA 2FC1A 4UCHA 4UG9A 2NSIA 1LZZA 3N6EA 5ADJA 3RQJA 4CTVA 3NLGA 4GQEA 1D1VA 1ZVIA 4CX1A 1JWKA 5G6HA 3NLKA 4UQRA 5FVWA 3PNEA 4LWAA 4LUXA 5ADAA 3B3NA 1ZZSA 5FVPA 4UGJA 4UG6A 4CTZA 1OM5A 4CULA 4IMUA 4UPMA 5G6BA 5G6OA 4CFTA 5G6NA 2BHJA 4UPTA 4UGZA 1M9QA 3E7SA 4UPQA 1VAGA 3NLPA 1FOOA 2FBZX 4D2ZA 3N6DA 3N61A 4IMXA 5G67A 3NLUA 3N65A 1M9RA 3N67A 4CU0A 1NSIA 5G6EA 4D31A 4CWWA 4D39A 3NW2A 5G65A 4D3TA 3RQLA 3N5ZA 4CU1A 1M9TA 3UFVA 5FVTA 3N2RA 5G6GA 4UQSA 2FC2A 3EAHA 3E6OA 1N2NA 3N5XA 3NM0A 4D36A 1K2TA 4CX6A 1QWCA 1QOMA 3N5WA 3JX3A 1FOLA 5AD8A 1ED5A 4UPSA 5ADDA 1NOSA 4UGPA 4UH8A 1M8EA 4UH7A 3NLXA 1ZVLA 1OM4A 4D3NA 2Y37A 3NLIA 1LZXA 2HX4A 4CTPA 5AD7A 1MMVA 3JWVA 3NLFA 4UGTA 3FC5A 5ADIA 4CX2A 5G6AA 3UFUA 3UFRA 5AGNA 3UFOA
chains in the Genus database with same CATH topology
3JX0A 5G6LA 4D3OA 2G6HA 3NLEA 1FOIA 4UGQA 4KCNA 3NLNA 3UFTA 2AN2A 3NLJA 3EBDA 3JWWA 3E67A 5FVSA 4KCSA 3HSNA 4K5GA 3JWUA 3NLWA 4CWZA 5FVOA 5ADCA 1K2RA 5G6KA 4CAMA 4CAQA 1RS8A 3TYNA 4KCQA 4JS9A 1M7ZA 1I83A 4UGYA 1NSEA 4K5JA 4UGFA 4D3BA 4D32A 4D3VA 4UGHA 3JWZA 4UG5A 4UGLA 5AGMA 1M9KA 4D3IA 1K2SA 4UGRA 1M8HA 3JT7A 4D30A 4UGXA 1M9MA 4D1NA 3NLTA 1P6HA 4D34A 1RS6A 3JX5A 3SVQA 1RS9A 3HSPA 4UHAA 1DWXA 4UGVA 5G6FA 4CUMA 2G6OA 1QW5A 1Q2OA 4UGDA 1D1XA 3N6AA 3JWSA 1ZZTA 3JT9A 7NSEA 4D7HA 2AN0A 1P6LA 4UH6A 4CAPA 4FW0A 3N69A 4FVXA 3N60A 4D3MA 4CX4A 4UGMA 3PNGA 2NOSA 4CUNA 4UPNA 3N5TA 5G6MA 4K5HA 4UGKA 2G6MA 2OROA 3B3OA 5FVYA 3UFQA 1DD7A 3TYMA 1VAFA 1M8DA 4D1OA 1D1YA 3EJ8A 2AMOA 3E7TA 3PNHA 3N5YA 2G6KA 2G6JA 4D7JA 2ORSA 5ADKA 4V3VA 1FOJA 4CTQA 1DMJA 5AD4A 3NLMA 4UGNA 5ADMA 4JSLA 5FJ2A 3N6GA 4K5EA 4D3KA 1DWWA 3N5SA 4UGIA 4UGBA 1P6NA 2HX3A 4C39A 3NODA 4CWYA 3E65A 3NLQA 4IMSA 4UG7A 5G6PA 3N5RA 4UH3A 3DWJA 1JWJA 4V3XA 4K5KA 4KCRA 4UGEA 1DM6A 4UH5A 1DMIA 1P6IA 3N68A 1DM8A 5FJ3A 3UFWA 2ORTA 4NOSA 3NNYA 3EAIA 2G6LA 4JSHA 5AD6A 4CWXA 3JX6A 5G6CA 3N5QA 3RQMA 4IMTA 4FVZA 4UPOA 3JT5A 5ADFA 4CX7A 3E7MA 4K5FA 3NLHA 4UGGA 4KCPA 5FW0A 5AGKA 5G68A 4D3AA 5G6QA 1R35A 2G6NA 3NLZA 3N62A 3E6TA 4KCKA 5FVQA 4FVWA 4UGSA 5FVUA 4CX5A 4V3UA 4CWVA 5FVZA 4D38A 1M7VA 4UH0A 1NODA 3B3MA 5G66A 4CTRA 5AGLA 3N63A 3EBFA 1ED6A 4EUXA 2FLQA 3DQTA 5G0NA 3E7SB 3JWYA 4CTUA 3UFSA 3NLOA 4UPPA 4UH9A 3DQSA 4UH1A 3NNZA 3JX2A 3UFPA 4D1PA 3SVPA 1D1WA 3JX4A 3PNFA 4D2YA 3HSOA 5ADNA 1P6JA 1M00A 3JWTA 4D37A 4CARA 4JSIA 4UGOA 4CU1B 1MMWA 4C3AA 3E6LA 1QW6A 4UH4A 4KCMA 3TYLA 5NSEA 4UGWA 3NOSA 1D0OA 3RQNA 5AGOA 3TYOA 3N6CA 2NSEA 3E7GA 5ADEA 4CDTA 4D7IA 4D35A 3JWXA 1M8IA 2ORRA 3E68A 3JT4A 1MJTA 4D33A 5ADBA 1ED4A 3E7IA 3RQOA 4UH2A 5G0PA 1ZZQA 4KCLA 3RQKA 3B3PA 5G6DA 3NLVA 1ZZRA 4KCIA 5AD5A 3DQRA 5ADGA 4K5DA 4UGCA 4UGUA 4FVYA 4CTTA 1D0CA 3JT8A 4UPRA 5ADLA 6NSEA 4UGAA 4CX0A 1NOCA 4KCHA 4D7OA 3JT3A 2HX2A 4JSJA 4CTWA 4D3UA 1DM7A 1ZZUA 3N6BA 4KCJA 4JSFA 3NQSA 1QW4A 3JTAA 5G0OA 5FVRA 4JSGA 8NSEA 1DMKA 3Q99A 5FVXA 4CTXA 1P6KA 4V3ZA 4JSKA 4CTYA 3N66A 1RS7A 5FVVA 9NSEA 3N5PA 3N6FA 4LWBA 1DF1A 5AD9A 4UG8A 2ORQA 5G69A 2G6IA 3RQPA 3N5VA 3Q9AA 3N64A 4KCOA 4NSEA 1P6MA 4CAOA 1FOPA 1K2UA 2NODA 3JX1A 4JSEA 5G6JA 4K5IA 4CANA 2ORPA 3NLYA 3NSEA 4LUWA 3NLRA 5G6IA 4V3WA 4D3JA 3NLDA 4JSMA 4IMWA 1M9JA 4CX3A 3E6NA 3JT6A 4V3YA 4CVGA 5AGPA 4CFTB 1DWVA 2FC1A 4UCHA 4UG9A 2NSIA 1LZZA 3N6EA 5ADJA 3RQJA 4CTVA 3NLGA 4GQEA 1D1VA 1ZVIA 4CX1A 1JWKA 5G6HA 3NLKA 4UQRA 5FVWA 3PNEA 4LWAA 4LUXA 5ADAA 3B3NA 1ZZSA 5FVPA 4UGJA 4UG6A 4CTZA 1OM5A 4CULA 4IMUA 4UPMA 5G6BA 5G6OA 4CFTA 5G6NA 2BHJA 4UPTA 4UGZA 1M9QA 3E7SA 4UPQA 1VAGA 3NLPA 1FOOA 2FBZX 4D2ZA 3N6DA 3N61A 4IMXA 5G67A 3NLUA 3N65A 1M9RA 3N67A 4CU0A 1NSIA 5G6EA 4D31A 4CWWA 4D39A 3NW2A 5G65A 4D3TA 3RQLA 3N5ZA 4CU1A 1M9TA 3UFVA 5FVTA 3N2RA 5G6GA 4UQSA 2FC2A 3EAHA 3E6OA 1N2NA 3N5XA 3NM0A 4D36A 1K2TA 4CX6A 1QWCA 1QOMA 3N5WA 3JX3A 1FOLA 5AD8A 1ED5A 4UPSA 5ADDA 1NOSA 4UGPA 4UH8A 1M8EA 4UH7A 3NLXA 1ZVLA 1OM4A 4D3NA 2Y37A 3NLIA 1LZXA 2HX4A 4CTPA 5AD7A 1MMVA 3JWVA 3NLFA 4UGTA 3FC5A 5ADIA 4CX2A 5G6AA 3UFUA 3UFRA 5AGNA 3UFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JX0 A;  5G6L A;  4D3O A;  2G6H A;  3NLE A;  1FOI A;  4UGQ A;  4KCN A;  3NLN A;  3UFT A;  2AN2 A;  3NLJ A;  3EBD A;  3JWW A;  3E67 A;  5FVS A;  4KCS A;  3HSN A;  4K5G A;  3JWU A;  3NLW A;  4CWZ A;  5FVO A;  5ADC A;  1K2R A;  5G6K A;  4CAM A;  4CAQ A;  1RS8 A;  3TYN A;  4KCQ A;  4JS9 A;  1M7Z A;  1I83 A;  4UGY A;  1NSE A;  4K5J A;  4UGF A;  4D3B A;  4D32 A;  4D3V A;  4UGH A;  3JWZ A;  4UG5 A;  4UGL A;  5AGM A;  1M9K A;  4D3I A;  1K2S A;  4UGR A;  1M8H A;  3JT7 A;  4D30 A;  4UGX A;  1M9M A;  4D1N A;  3NLT A;  1P6H A;  4D34 A;  1RS6 A;  3JX5 A;  3SVQ A;  1RS9 A;  3HSP A;  4UHA A;  1DWX A;  4UGV A;  5G6F A;  4CUM A;  2G6O A;  1QW5 A;  1Q2O A;  4UGD A;  1D1X A;  3N6A A;  3JWS A;  1ZZT A;  3JT9 A;  7NSE A;  4D7H A;  2AN0 A;  1P6L A;  4UH6 A;  4CAP A;  4FW0 A;  3N69 A;  4FVX A;  3N60 A;  4D3M A;  4CX4 A;  4UGM A;  3PNG A;  2NOS A;  4CUN A;  4UPN A;  3N5T A;  5G6M A;  4K5H A;  4UGK A;  2G6M A;  2ORO A;  3B3O A;  5FVY A;  3UFQ A;  1DD7 A;  3TYM A;  1VAF A;  1M8D A;  4D1O A;  1D1Y A;  3EJ8 A;  2AMO A;  3E7T A;  3PNH A;  3N5Y A;  2G6K A;  2G6J A;  4D7J A;  2ORS A;  5ADK A;  4V3V A;  1FOJ A;  4CTQ A;  1DMJ A;  5AD4 A;  3NLM A;  4UGN A;  5ADM A;  4JSL A;  5FJ2 A;  3N6G A;  4K5E A;  4D3K A;  1DWW A;  3N5S A;  4UGI A;  4UGB A;  1P6N A;  2HX3 A;  4C39 A;  3NOD A;  4CWY A;  3E65 A;  3NLQ A;  4IMS A;  4UG7 A;  5G6P A;  3N5R A;  4UH3 A;  3DWJ A;  1JWJ A;  4V3X A;  4K5K A;  4KCR A;  4UGE A;  1DM6 A;  4UH5 A;  1DMI A;  1P6I A;  3N68 A;  1DM8 A;  5FJ3 A;  3UFW A;  2ORT A;  4NOS A;  3NNY A;  3EAI A;  2G6L A;  4JSH A;  5AD6 A;  4CWX A;  3JX6 A;  5G6C A;  3N5Q A;  3RQM A;  4IMT A;  4FVZ A;  4UPO A;  3JT5 A;  5ADF A;  4CX7 A;  3E7M A;  4K5F A;  3NLH A;  4UGG A;  4KCP A;  5FW0 A;  5AGK A;  5G68 A;  4D3A A;  5G6Q A;  1R35 A;  2G6N A;  3NLZ A;  3N62 A;  3E6T A;  4KCK A;  5FVQ A;  4FVW A;  4UGS A;  5FVU A;  4CX5 A;  4V3U A;  4CWV A;  5FVZ A;  4D38 A;  1M7V A;  4UH0 A;  1NOD A;  3B3M A;  5G66 A;  4CTR A;  5AGL A;  3N63 A;  3EBF A;  1ED6 A;  4EUX A;  2FLQ A;  3DQT A;  5G0N A;  3E7S B;  3JWY A;  4CTU A;  3UFS A;  3NLO A;  4UPP A;  4UH9 A;  3DQS A;  4UH1 A;  3NNZ A;  3JX2 A;  3UFP A;  4D1P A;  3SVP A;  1D1W A;  3JX4 A;  3PNF A;  4D2Y A;  3HSO A;  5ADN A;  1P6J A;  1M00 A;  3JWT A;  4D37 A;  4CAR A;  4JSI A;  4UGO A;  4CU1 B;  1MMW A;  4C3A A;  3E6L A;  1QW6 A;  4UH4 A;  4KCM A;  3TYL A;  5NSE A;  4UGW A;  3NOS A;  1D0O A;  3RQN A;  5AGO A;  3TYO A;  3N6C A;  2NSE A;  3E7G A;  5ADE A;  4CDT A;  4D7I A;  4D35 A;  3JWX A;  1M8I A;  2ORR A;  3E68 A;  3JT4 A;  1MJT A;  4D33 A;  5ADB A;  1ED4 A;  3E7I A;  3RQO A;  4UH2 A;  5G0P A;  1ZZQ A;  4KCL A;  3RQK A;  3B3P A;  5G6D A;  3NLV A;  1ZZR A;  4KCI A;  5AD5 A;  3DQR A;  5ADG A;  4K5D A;  4UGC A;  4UGU A;  4FVY A;  4CTT A;  1D0C A;  3JT8 A;  4UPR A;  5ADL A;  6NSE A;  4UGA A;  4CX0 A;  1NOC A;  4KCH A;  4D7O A;  3JT3 A;  2HX2 A;  4JSJ A;  4CTW A;  4D3U A;  1DM7 A;  1ZZU A;  3N6B A;  4KCJ A;  4JSF A;  3NQS A;  1QW4 A;  3JTA A;  5G0O A;  5FVR A;  4JSG A;  8NSE A;  1DMK A;  3Q99 A;  5FVX A;  4CTX A;  1P6K A;  4V3Z A;  4JSK A;  4CTY A;  3N66 A;  1RS7 A;  5FVV A;  9NSE A;  3N5P A;  3N6F A;  4LWB A;  1DF1 A;  5AD9 A;  4UG8 A;  2ORQ A;  5G69 A;  2G6I A;  3RQP A;  3N5V A;  3Q9A A;  3N64 A;  4KCO A;  4NSE A;  1P6M A;  4CAO A;  1FOP A;  1K2U A;  2NOD A;  3JX1 A;  4JSE A;  5G6J A;  4K5I A;  4CAN A;  2ORP A;  3NLY A;  3NSE A;  4LUW A;  3NLR A;  5G6I A;  4V3W A;  4D3J A;  3NLD A;  4JSM A;  4IMW A;  1M9J A;  4CX3 A;  3E6N A;  3JT6 A;  4V3Y A;  4CVG A;  5AGP A;  4CFT B;  1DWV A;  2FC1 A;  4UCH A;  4UG9 A;  2NSI A;  1LZZ A;  3N6E A;  5ADJ A;  3RQJ A;  4CTV A;  3NLG A;  4GQE A;  1D1V A;  1ZVI A;  4CX1 A;  1JWK A;  5G6H A;  3NLK A;  4UQR A;  5FVW A;  3PNE A;  4LWA A;  4LUX A;  5ADA A;  3B3N A;  1ZZS A;  5FVP A;  4UGJ A;  4UG6 A;  4CTZ A;  1OM5 A;  4CUL A;  4IMU A;  4UPM A;  5G6B A;  5G6O A;  4CFT A;  5G6N A;  2BHJ A;  4UPT A;  4UGZ A;  1M9Q A;  3E7S A;  4UPQ A;  1VAG A;  3NLP A;  1FOO A;  2FBZ X;  4D2Z A;  3N6D A;  3N61 A;  4IMX A;  5G67 A;  3NLU A;  3N65 A;  1M9R A;  3N67 A;  4CU0 A;  1NSI A;  5G6E A;  4D31 A;  4CWW A;  4D39 A;  3NW2 A;  5G65 A;  4D3T A;  3RQL A;  3N5Z A;  4CU1 A;  1M9T A;  3UFV A;  5FVT A;  3N2R A;  5G6G A;  4UQS A;  2FC2 A;  3EAH A;  3E6O A;  1N2N A;  3N5X A;  3NM0 A;  4D36 A;  1K2T A;  4CX6 A;  1QWC A;  1QOM A;  3N5W A;  3JX3 A;  1FOL A;  5AD8 A;  1ED5 A;  4UPS A;  5ADD A;  1NOS A;  4UGP A;  4UH8 A;  1M8E A;  4UH7 A;  3NLX A;  1ZVL A;  1OM4 A;  4D3N A;  2Y37 A;  3NLI A;  1LZX A;  2HX4 A;  4CTP A;  5AD7 A;  1MMV A;  3JWV A;  3NLF A;  4UGT A;  3FC5 A;  5ADI A;  4CX2 A;  5G6A A;  3UFU A;  3UFR A;  5AGN A;  3UFO A; 
#chains in the Genus database with same CATH topology
 3JX0 A;  5G6L A;  4D3O A;  2G6H A;  3NLE A;  1FOI A;  4UGQ A;  4KCN A;  3NLN A;  3UFT A;  2AN2 A;  3NLJ A;  3EBD A;  3JWW A;  3E67 A;  5FVS A;  4KCS A;  3HSN A;  4K5G A;  3JWU A;  3NLW A;  4CWZ A;  5FVO A;  5ADC A;  1K2R A;  5G6K A;  4CAM A;  4CAQ A;  1RS8 A;  3TYN A;  4KCQ A;  4JS9 A;  1M7Z A;  1I83 A;  4UGY A;  1NSE A;  4K5J A;  4UGF A;  4D3B A;  4D32 A;  4D3V A;  4UGH A;  3JWZ A;  4UG5 A;  4UGL A;  5AGM A;  1M9K A;  4D3I A;  1K2S A;  4UGR A;  1M8H A;  3JT7 A;  4D30 A;  4UGX A;  1M9M A;  4D1N A;  3NLT A;  1P6H A;  4D34 A;  1RS6 A;  3JX5 A;  3SVQ A;  1RS9 A;  3HSP A;  4UHA A;  1DWX A;  4UGV A;  5G6F A;  4CUM A;  2G6O A;  1QW5 A;  1Q2O A;  4UGD A;  1D1X A;  3N6A A;  3JWS A;  1ZZT A;  3JT9 A;  7NSE A;  4D7H A;  2AN0 A;  1P6L A;  4UH6 A;  4CAP A;  4FW0 A;  3N69 A;  4FVX A;  3N60 A;  4D3M A;  4CX4 A;  4UGM A;  3PNG A;  2NOS A;  4CUN A;  4UPN A;  3N5T A;  5G6M A;  4K5H A;  4UGK A;  2G6M A;  2ORO A;  3B3O A;  5FVY A;  3UFQ A;  1DD7 A;  3TYM A;  1VAF A;  1M8D A;  4D1O A;  1D1Y A;  3EJ8 A;  2AMO A;  3E7T A;  3PNH A;  3N5Y A;  2G6K A;  2G6J A;  4D7J A;  2ORS A;  5ADK A;  4V3V A;  1FOJ A;  4CTQ A;  1DMJ A;  5AD4 A;  3NLM A;  4UGN A;  5ADM A;  4JSL A;  5FJ2 A;  3N6G A;  4K5E A;  4D3K A;  1DWW A;  3N5S A;  4UGI A;  4UGB A;  1P6N A;  2HX3 A;  4C39 A;  3NOD A;  4CWY A;  3E65 A;  3NLQ A;  4IMS A;  4UG7 A;  5G6P A;  3N5R A;  4UH3 A;  3DWJ A;  1JWJ A;  4V3X A;  4K5K A;  4KCR A;  4UGE A;  1DM6 A;  4UH5 A;  1DMI A;  1P6I A;  3N68 A;  1DM8 A;  5FJ3 A;  3UFW A;  2ORT A;  4NOS A;  3NNY A;  3EAI A;  2G6L A;  4JSH A;  5AD6 A;  4CWX A;  3JX6 A;  5G6C A;  3N5Q A;  3RQM A;  4IMT A;  4FVZ A;  4UPO A;  3JT5 A;  5ADF A;  4CX7 A;  3E7M A;  4K5F A;  3NLH A;  4UGG A;  4KCP A;  5FW0 A;  5AGK A;  5G68 A;  4D3A A;  5G6Q A;  1R35 A;  2G6N A;  3NLZ A;  3N62 A;  3E6T A;  4KCK A;  5FVQ A;  4FVW A;  4UGS A;  5FVU A;  4CX5 A;  4V3U A;  4CWV A;  5FVZ A;  4D38 A;  1M7V A;  4UH0 A;  1NOD A;  3B3M A;  5G66 A;  4CTR A;  5AGL A;  3N63 A;  3EBF A;  1ED6 A;  4EUX A;  2FLQ A;  3DQT A;  5G0N A;  3E7S B;  3JWY A;  4CTU A;  3UFS A;  3NLO A;  4UPP A;  4UH9 A;  3DQS A;  4UH1 A;  3NNZ A;  3JX2 A;  3UFP A;  4D1P A;  3SVP A;  1D1W A;  3JX4 A;  3PNF A;  4D2Y A;  3HSO A;  5ADN A;  1P6J A;  1M00 A;  3JWT A;  4D37 A;  4CAR A;  4JSI A;  4UGO A;  4CU1 B;  1MMW A;  4C3A A;  3E6L A;  1QW6 A;  4UH4 A;  4KCM A;  3TYL A;  5NSE A;  4UGW A;  3NOS A;  1D0O A;  3RQN A;  5AGO A;  3TYO A;  3N6C A;  2NSE A;  3E7G A;  5ADE A;  4CDT A;  4D7I A;  4D35 A;  3JWX A;  1M8I A;  2ORR A;  3E68 A;  3JT4 A;  1MJT A;  4D33 A;  5ADB A;  1ED4 A;  3E7I A;  3RQO A;  4UH2 A;  5G0P A;  1ZZQ A;  4KCL A;  3RQK A;  3B3P A;  5G6D A;  3NLV A;  1ZZR A;  4KCI A;  5AD5 A;  3DQR A;  5ADG A;  4K5D A;  4UGC A;  4UGU A;  4FVY A;  4CTT A;  1D0C A;  3JT8 A;  4UPR A;  5ADL A;  6NSE A;  4UGA A;  4CX0 A;  1NOC A;  4KCH A;  4D7O A;  3JT3 A;  2HX2 A;  4JSJ A;  4CTW A;  4D3U A;  1DM7 A;  1ZZU A;  3N6B A;  4KCJ A;  4JSF A;  3NQS A;  1QW4 A;  3JTA A;  5G0O A;  5FVR A;  4JSG A;  8NSE A;  1DMK A;  3Q99 A;  5FVX A;  4CTX A;  1P6K A;  4V3Z A;  4JSK A;  4CTY A;  3N66 A;  1RS7 A;  5FVV A;  9NSE A;  3N5P A;  3N6F A;  4LWB A;  1DF1 A;  5AD9 A;  4UG8 A;  2ORQ A;  5G69 A;  2G6I A;  3RQP A;  3N5V A;  3Q9A A;  3N64 A;  4KCO A;  4NSE A;  1P6M A;  4CAO A;  1FOP A;  1K2U A;  2NOD A;  3JX1 A;  4JSE A;  5G6J A;  4K5I A;  4CAN A;  2ORP A;  3NLY A;  3NSE A;  4LUW A;  3NLR A;  5G6I A;  4V3W A;  4D3J A;  3NLD A;  4JSM A;  4IMW A;  1M9J A;  4CX3 A;  3E6N A;  3JT6 A;  4V3Y A;  4CVG A;  5AGP A;  4CFT B;  1DWV A;  2FC1 A;  4UCH A;  4UG9 A;  2NSI A;  1LZZ A;  3N6E A;  5ADJ A;  3RQJ A;  4CTV A;  3NLG A;  4GQE A;  1D1V A;  1ZVI A;  4CX1 A;  1JWK A;  5G6H A;  3NLK A;  4UQR A;  5FVW A;  3PNE A;  4LWA A;  4LUX A;  5ADA A;  3B3N A;  1ZZS A;  5FVP A;  4UGJ A;  4UG6 A;  4CTZ A;  1OM5 A;  4CUL A;  4IMU A;  4UPM A;  5G6B A;  5G6O A;  4CFT A;  5G6N A;  2BHJ A;  4UPT A;  4UGZ A;  1M9Q A;  3E7S A;  4UPQ A;  1VAG A;  3NLP A;  1FOO A;  2FBZ X;  4D2Z A;  3N6D A;  3N61 A;  4IMX A;  5G67 A;  3NLU A;  3N65 A;  1M9R A;  3N67 A;  4CU0 A;  1NSI A;  5G6E A;  4D31 A;  4CWW A;  4D39 A;  3NW2 A;  5G65 A;  4D3T A;  3RQL A;  3N5Z A;  4CU1 A;  1M9T A;  3UFV A;  5FVT A;  3N2R A;  5G6G A;  4UQS A;  2FC2 A;  3EAH A;  3E6O A;  1N2N A;  3N5X A;  3NM0 A;  4D36 A;  1K2T A;  4CX6 A;  1QWC A;  1QOM A;  3N5W A;  3JX3 A;  1FOL A;  5AD8 A;  1ED5 A;  4UPS A;  5ADD A;  1NOS A;  4UGP A;  4UH8 A;  1M8E A;  4UH7 A;  3NLX A;  1ZVL A;  1OM4 A;  4D3N A;  2Y37 A;  3NLI A;  1LZX A;  2HX4 A;  4CTP A;  5AD7 A;  1MMV A;  3JWV A;  3NLF A;  4UGT A;  3FC5 A;  5ADI A;  4CX2 A;  5G6A A;  3UFU A;  3UFR A;  5AGN A;  3UFO A; 
#chains in the Genus database with same CATH homology
 3JX0 A;  5G6L A;  4D3O A;  2G6H A;  3NLE A;  1FOI A;  4UGQ A;  4KCN A;  3NLN A;  3UFT A;  2AN2 A;  3NLJ A;  3EBD A;  3JWW A;  3E67 A;  5FVS A;  4KCS A;  3HSN A;  4K5G A;  3JWU A;  3NLW A;  4CWZ A;  5FVO A;  5ADC A;  1K2R A;  5G6K A;  4CAM A;  4CAQ A;  1RS8 A;  3TYN A;  4KCQ A;  4JS9 A;  1M7Z A;  1I83 A;  4UGY A;  1NSE A;  4K5J A;  4UGF A;  4D3B A;  4D32 A;  4D3V A;  4UGH A;  3JWZ A;  4UG5 A;  4UGL A;  5AGM A;  1M9K A;  4D3I A;  1K2S A;  4UGR A;  1M8H A;  3JT7 A;  4D30 A;  4UGX A;  1M9M A;  4D1N A;  3NLT A;  1P6H A;  4D34 A;  1RS6 A;  3JX5 A;  3SVQ A;  1RS9 A;  3HSP A;  4UHA A;  1DWX A;  4UGV A;  5G6F A;  4CUM A;  2G6O A;  1QW5 A;  1Q2O A;  4UGD A;  1D1X A;  3N6A A;  3JWS A;  1ZZT A;  3JT9 A;  7NSE A;  4D7H A;  2AN0 A;  1P6L A;  4UH6 A;  4CAP A;  4FW0 A;  3N69 A;  4FVX A;  3N60 A;  4D3M A;  4CX4 A;  4UGM A;  3PNG A;  2NOS A;  4CUN A;  4UPN A;  3N5T A;  5G6M A;  4K5H A;  4UGK A;  2G6M A;  2ORO A;  3B3O A;  5FVY A;  3UFQ A;  1DD7 A;  3TYM A;  1VAF A;  1M8D A;  4D1O A;  1D1Y A;  3EJ8 A;  2AMO A;  3E7T A;  3PNH A;  3N5Y A;  2G6K A;  2G6J A;  4D7J A;  2ORS A;  5ADK A;  4V3V A;  1FOJ A;  4CTQ A;  1DMJ A;  5AD4 A;  3NLM A;  4UGN A;  5ADM A;  4JSL A;  5FJ2 A;  3N6G A;  4K5E A;  4D3K A;  1DWW A;  3N5S A;  4UGI A;  4UGB A;  1P6N A;  2HX3 A;  4C39 A;  3NOD A;  4CWY A;  3E65 A;  3NLQ A;  4IMS A;  4UG7 A;  5G6P A;  3N5R A;  4UH3 A;  3DWJ A;  1JWJ A;  4V3X A;  4K5K A;  4KCR A;  4UGE A;  1DM6 A;  4UH5 A;  1DMI A;  1P6I A;  3N68 A;  1DM8 A;  5FJ3 A;  3UFW A;  2ORT A;  4NOS A;  3NNY A;  3EAI A;  2G6L A;  4JSH A;  5AD6 A;  4CWX A;  3JX6 A;  5G6C A;  3N5Q A;  3RQM A;  4IMT A;  4FVZ A;  4UPO A;  3JT5 A;  5ADF A;  4CX7 A;  3E7M A;  4K5F A;  3NLH A;  4UGG A;  4KCP A;  5FW0 A;  5AGK A;  5G68 A;  4D3A A;  5G6Q A;  1R35 A;  2G6N A;  3NLZ A;  3N62 A;  3E6T A;  4KCK A;  5FVQ A;  4FVW A;  4UGS A;  5FVU A;  4CX5 A;  4V3U A;  4CWV A;  5FVZ A;  4D38 A;  1M7V A;  4UH0 A;  1NOD A;  3B3M A;  5G66 A;  4CTR A;  5AGL A;  3N63 A;  3EBF A;  1ED6 A;  4EUX A;  2FLQ A;  3DQT A;  5G0N A;  3E7S B;  3JWY A;  4CTU A;  3UFS A;  3NLO A;  4UPP A;  4UH9 A;  3DQS A;  4UH1 A;  3NNZ A;  3JX2 A;  3UFP A;  4D1P A;  3SVP A;  1D1W A;  3JX4 A;  3PNF A;  4D2Y A;  3HSO A;  5ADN A;  1P6J A;  1M00 A;  3JWT A;  4D37 A;  4CAR A;  4JSI A;  4UGO A;  4CU1 B;  1MMW A;  4C3A A;  3E6L A;  1QW6 A;  4UH4 A;  4KCM A;  3TYL A;  5NSE A;  4UGW A;  3NOS A;  1D0O A;  3RQN A;  5AGO A;  3TYO A;  3N6C A;  2NSE A;  3E7G A;  5ADE A;  4CDT A;  4D7I A;  4D35 A;  3JWX A;  1M8I A;  2ORR A;  3E68 A;  3JT4 A;  1MJT A;  4D33 A;  5ADB A;  1ED4 A;  3E7I A;  3RQO A;  4UH2 A;  5G0P A;  1ZZQ A;  4KCL A;  3RQK A;  3B3P A;  5G6D A;  3NLV A;  1ZZR A;  4KCI A;  5AD5 A;  3DQR A;  5ADG A;  4K5D A;  4UGC A;  4UGU A;  4FVY A;  4CTT A;  1D0C A;  3JT8 A;  4UPR A;  5ADL A;  6NSE A;  4UGA A;  4CX0 A;  1NOC A;  4KCH A;  4D7O A;  3JT3 A;  2HX2 A;  4JSJ A;  4CTW A;  4D3U A;  1DM7 A;  1ZZU A;  3N6B A;  4KCJ A;  4JSF A;  3NQS A;  1QW4 A;  3JTA A;  5G0O A;  5FVR A;  4JSG A;  8NSE A;  1DMK A;  3Q99 A;  5FVX A;  4CTX A;  1P6K A;  4V3Z A;  4JSK A;  4CTY A;  3N66 A;  1RS7 A;  5FVV A;  9NSE A;  3N5P A;  3N6F A;  4LWB A;  1DF1 A;  5AD9 A;  4UG8 A;  2ORQ A;  5G69 A;  2G6I A;  3RQP A;  3N5V A;  3Q9A A;  3N64 A;  4KCO A;  4NSE A;  1P6M A;  4CAO A;  1FOP A;  1K2U A;  2NOD A;  3JX1 A;  4JSE A;  5G6J A;  4K5I A;  4CAN A;  2ORP A;  3NLY A;  3NSE A;  4LUW A;  3NLR A;  5G6I A;  4V3W A;  4D3J A;  3NLD A;  4JSM A;  4IMW A;  1M9J A;  4CX3 A;  3E6N A;  3JT6 A;  4V3Y A;  4CVG A;  5AGP A;  4CFT B;  1DWV A;  2FC1 A;  4UCH A;  4UG9 A;  2NSI A;  1LZZ A;  3N6E A;  5ADJ A;  3RQJ A;  4CTV A;  3NLG A;  4GQE A;  1D1V A;  1ZVI A;  4CX1 A;  1JWK A;  5G6H A;  3NLK A;  4UQR A;  5FVW A;  3PNE A;  4LWA A;  4LUX A;  5ADA A;  3B3N A;  1ZZS A;  5FVP A;  4UGJ A;  4UG6 A;  4CTZ A;  1OM5 A;  4CUL A;  4IMU A;  4UPM A;  5G6B A;  5G6O A;  4CFT A;  5G6N A;  2BHJ A;  4UPT A;  4UGZ A;  1M9Q A;  3E7S A;  4UPQ A;  1VAG A;  3NLP A;  1FOO A;  2FBZ X;  4D2Z A;  3N6D A;  3N61 A;  4IMX A;  5G67 A;  3NLU A;  3N65 A;  1M9R A;  3N67 A;  4CU0 A;  1NSI A;  5G6E A;  4D31 A;  4CWW A;  4D39 A;  3NW2 A;  5G65 A;  4D3T A;  3RQL A;  3N5Z A;  4CU1 A;  1M9T A;  3UFV A;  5FVT A;  3N2R A;  5G6G A;  4UQS A;  2FC2 A;  3EAH A;  3E6O A;  1N2N A;  3N5X A;  3NM0 A;  4D36 A;  1K2T A;  4CX6 A;  1QWC A;  1QOM A;  3N5W A;  3JX3 A;  1FOL A;  5AD8 A;  1ED5 A;  4UPS A;  5ADD A;  1NOS A;  4UGP A;  4UH8 A;  1M8E A;  4UH7 A;  3NLX A;  1ZVL A;  1OM4 A;  4D3N A;  2Y37 A;  3NLI A;  1LZX A;  2HX4 A;  4CTP A;  5AD7 A;  1MMV A;  3JWV A;  3NLF A;  4UGT A;  3FC5 A;  5ADI A;  4CX2 A;  5G6A A;  3UFU A;  3UFR A;  5AGN A;  3UFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...