4UOOA

Structure of lipoteichoic acid synthase ltas from listeria monocytogenes
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
Knots found
sequence length
415
structure length
414
Chain Sequence
b'VTEVLNYTKSKYAAPNPEYFGKAKGKNVIYIHLESFQQFLVNYKLNGEEVTPFINSFFKDQNTLSFTNFFHQTGQGKADSEMLLENSLYGLPQGSAFTTKGQNTYESASAILGQQGYTSAVFHGNYKSFWNRDEIYKQFGYDNFFDASYYDMNEADVSNYGLKDKPFFKESEEYLSSLQQPFYTKFITLTNHFPYPIDEKDASIAPATTGDSSVDTYFQTARYLDESVKSFVDYLKKSGLYDNSVIIMYGDHYGISDNHEEAMTKILGKDYNTFENAQAQRVPLMIHVPGVQGGVQEQYGGQVDLLPTLLHLLGVDNKEYLQFGTDLLSKDHKQLVPFRNGDYITPTYSMIGGNMYNQQTGEPIATETKEMKETKEKVAKELELSDSVLQGDLLRFYAPDGFKKVDPSKYNYNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPOTEICHOIC ACID SYNTHASE
publication title Structural and mechanistic insight into the Listeria monocytogenes two-enzyme lipoteichoic acid synthesis system.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
total genus 149
structure length 414
sequence length 415
chains with identical sequence B, C, D, E
other databases KnotProt 2.0: S +31
ec nomenclature ec 2.7.8.-:
pdb deposition date 2014-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4uooA02
3UN5A 1EI6A 4KAYA 3T02A 3NKPA 2W8DA 1KHNA 5L0KA 1AJAA 3IGYB 3DYCA 2W5QA 3KD8A 1KH9A 1B8JA 1ED8A 3BDFA 5AJ9A 5EGEA 3OT9A 5LIAA 1N2LA 3M8YA 2ANHA 1P49A 1ALJA 4UPIA 3M7VA 4YR1A 4LREA 4LRCA 2W8SA 2W5TA 3NKQA 1SHNA 2ZKTA 2GSUA 1EW8A 1Y6VA 3TX0A 4ZG7A 3WBHA 5GOVA 3SZZA 3TG0A 3NKNA 2RH6A 1URBA 1O98A 4MIVA 3NKRA 4KM4A 1HJKA 1N2KA 4FDJA 4CYSA 3LXQA 3NKOA 4UPKA 4UPHA 3UO0A 4ZG9A 4FDIA 1ALKA 5KXAA 3E2DA 4GTWA 1KHKA 2GSNA 1KH4A 1E2SP 3WAXA 4QAXA 4LRDA 2W5SA 3BDGB 5LRNA 2X98A 5DLWA 3MK0A 2W5RA 3IDDA 5LRMA 4LR2A 3Q3QA 1KHJA 2XR9A 1AJBA 1URAA 1AUKA 1EW2A 2G9YA 3NKMA 4KJDA 4CXSA 1E1ZP 2VQRA 5C66A 4LR8A 1O99A 2D1GA 3A52A 4N7TA 4NWXA 3UNYA 1EW9A 4GTYA 4CXUA 4B56A 5DLVA 4LRAA 3M8WA 4NWJA 4CYRA 3T01A 4GTXA 2IUCB 1E33P 3M8ZA 1ELYA 2GA3A 1ALHA 2GLQA 2IFYA 3B5QA 5DLTA 4ZG6A 4KAVA 3UN2A 3UN3A 4LR7A 3IGZB 4UPLA 5L0BA 4MHXA 4CXKA 5L0EA 4LRBA 3CMRA 2W5VA 3SZYA 4ZGAA 2QZUA 1ALIA 1EQJA 1HQAA 1KH7A 1E3CP 1AJCA 5HRTA 1AJDA 4LRFA 1ZEFA 5INHA 1ANIA 3T00A 4LQYA 4UOOA 3ED4A 1KH5A 1FSUA 1ELXA 3WAWA 2GSOA 3TWZA 5GRRA 2XRGA 5LQQA 3NVLA 1K7HA 5K4PA 5EGHA 1ZEDA 4KJGA 1HDHA 1ANJA 1SHQA 2IUCA 3MK2A 4GTZA 3MK1A 4MY4A 4TN0A 3WAVA 1EJJA 2W5XA 3BDGA 5TJ3A 1ZEBA 1KHLA 2W5WA 1ELZA 4UORA 1Y7AA 5IJSA 4UOPA 3BDHA 3DPCA 3WAYA 4LR9A 1ED9A 5IJQA
chains in the Genus database with same CATH superfamily
3UN5A 1EI6A 4KAYA 3T02A 3NKPA 2W8DA 1KHNA 5L0KA 1AJAA 3IGYB 3DYCA 2W5QA 3KD8A 1KH9A 1B8JA 1ED8A 3BDFA 5AJ9A 5EGEA 3OT9A 5LIAA 1N2LA 3M8YA 2ANHA 1P49A 1ALJA 4UPIA 3M7VA 4YR1A 4LREA 4LRCA 2W8SA 2W5TA 3NKQA 1SHNA 2ZKTA 2GSUA 1EW8A 1Y6VA 3TX0A 4ZG7A 3WBHA 5GOVA 3SZZA 3TG0A 3NKNA 2RH6A 1URBA 1O98A 4MIVA 3NKRA 4KM4A 1HJKA 1N2KA 4FDJA 4CYSA 3LXQA 3NKOA 4UPKA 4UPHA 3UO0A 4ZG9A 4FDIA 1ALKA 5KXAA 3E2DA 4GTWA 1KHKA 2GSNA 1KH4A 1E2SP 3WAXA 4QAXA 4LRDA 2W5SA 3BDGB 5LRNA 2X98A 5DLWA 3MK0A 2W5RA 3IDDA 5LRMA 4LR2A 3Q3QA 1KHJA 2XR9A 1AJBA 1URAA 1AUKA 1EW2A 2G9YA 3NKMA 4KJDA 4CXSA 1E1ZP 2VQRA 5C66A 4LR8A 1O99A 2D1GA 3A52A 4N7TA 4NWXA 3UNYA 1EW9A 4GTYA 4CXUA 4B56A 5DLVA 4LRAA 3M8WA 4NWJA 4CYRA 3T01A 4GTXA 2IUCB 1E33P 3M8ZA 1ELYA 2GA3A 1ALHA 2GLQA 2IFYA 3B5QA 5DLTA 4ZG6A 4KAVA 3UN2A 3UN3A 4LR7A 3IGZB 4UPLA 5L0BA 4MHXA 4CXKA 5L0EA 4LRBA 3CMRA 2W5VA 3SZYA 4ZGAA 2QZUA 1ALIA 1EQJA 1HQAA 1KH7A 1E3CP 1AJCA 5HRTA 1AJDA 4LRFA 1ZEFA 5INHA 1ANIA 3T00A 4LQYA 4UOOA 3ED4A 1KH5A 1FSUA 1ELXA 3WAWA 2GSOA 3TWZA 5GRRA 2XRGA 5LQQA 3NVLA 1K7HA 5K4PA 5EGHA 1ZEDA 4KJGA 1HDHA 1ANJA 1SHQA 2IUCA 3MK2A 4GTZA 3MK1A 4MY4A 4TN0A 3WAVA 1EJJA 2W5XA 3BDGA 5TJ3A 1ZEBA 1KHLA 2W5WA 1ELZA 4UORA 1Y7AA 5IJSA 4UOPA 3BDHA 3DPCA 3WAYA 4LR9A 1ED9A 5IJQA
chains in the Genus database with same CATH topology
3UN5A 1EI6A 4KAYA 3T02A 3NKPA 2W8DA 1KHNA 5L0KA 1AJAA 3IGYB 3DYCA 2W5QA 3KD8A 1KH9A 1B8JA 1ED8A 3BDFA 5AJ9A 5EGEA 3OT9A 5LIAA 1N2LA 3M8YA 2ANHA 1P49A 1ALJA 4UPIA 3M7VA 4YR1A 4LREA 4LRCA 2W8SA 2W5TA 3NKQA 1SHNA 2ZKTA 2GSUA 1EW8A 1Y6VA 3TX0A 4ZG7A 3WBHA 5GOVA 3SZZA 3TG0A 3NKNA 2RH6A 1URBA 1O98A 4MIVA 3NKRA 4KM4A 1HJKA 1N2KA 4FDJA 4CYSA 3LXQA 3NKOA 4UPKA 4UPHA 3UO0A 4ZG9A 4FDIA 1ALKA 5KXAA 3E2DA 4GTWA 1KHKA 2GSNA 1KH4A 1E2SP 3WAXA 4QAXA 4LRDA 2W5SA 3BDGB 5LRNA 2X98A 5DLWA 3MK0A 2W5RA 3IDDA 5LRMA 4LR2A 3Q3QA 1KHJA 2XR9A 1AJBA 1URAA 1AUKA 1EW2A 2G9YA 3NKMA 4KJDA 4CXSA 1E1ZP 2VQRA 5C66A 4LR8A 1O99A 2D1GA 3A52A 4N7TA 4NWXA 3UNYA 1EW9A 4GTYA 4CXUA 4B56A 5DLVA 4LRAA 3M8WA 4NWJA 4CYRA 3T01A 4GTXA 2IUCB 1E33P 3M8ZA 1ELYA 2GA3A 1ALHA 2GLQA 2IFYA 3B5QA 5DLTA 4ZG6A 4KAVA 3UN2A 3UN3A 4LR7A 3IGZB 4UPLA 5L0BA 4MHXA 4CXKA 5L0EA 4LRBA 3CMRA 2W5VA 3SZYA 4ZGAA 2QZUA 1ALIA 1EQJA 1HQAA 1KH7A 1E3CP 1AJCA 5HRTA 1AJDA 4LRFA 1ZEFA 5INHA 1ANIA 3T00A 4LQYA 4UOOA 3ED4A 1KH5A 1FSUA 1ELXA 3WAWA 2GSOA 3TWZA 5GRRA 2XRGA 5LQQA 3NVLA 1K7HA 5K4PA 5EGHA 1ZEDA 4KJGA 1HDHA 1ANJA 1SHQA 2IUCA 3MK2A 4GTZA 3MK1A 4MY4A 4TN0A 3WAVA 1EJJA 2W5XA 3BDGA 5TJ3A 1ZEBA 1KHLA 2W5WA 1ELZA 4UORA 1Y7AA 5IJSA 4UOPA 3BDHA 3DPCA 3WAYA 4LR9A 1ED9A 5IJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UN5 A;  1EI6 A;  4KAY A;  3T02 A;  3NKP A;  2W8D A;  1KHN A;  5L0K A;  1AJA A;  3IGY B;  3DYC A;  2W5Q A;  3KD8 A;  1KH9 A;  1B8J A;  1ED8 A;  3BDF A;  5AJ9 A;  5EGE A;  3OT9 A;  5LIA A;  1N2L A;  3M8Y A;  2ANH A;  1P49 A;  1ALJ A;  4UPI A;  3M7V A;  4YR1 A;  4LRE A;  4LRC A;  2W8S A;  2W5T A;  3NKQ A;  1SHN A;  2ZKT A;  2GSU A;  1EW8 A;  1Y6V A;  3TX0 A;  4ZG7 A;  3WBH A;  5GOV A;  3SZZ A;  3TG0 A;  3NKN A;  2RH6 A;  1URB A;  1O98 A;  4MIV A;  3NKR A;  4KM4 A;  1HJK A;  1N2K A;  4FDJ A;  4CYS A;  3LXQ A;  3NKO A;  4UPK A;  4UPH A;  3UO0 A;  4ZG9 A;  4FDI A;  1ALK A;  5KXA A;  3E2D A;  4GTW A;  1KHK A;  2GSN A;  1KH4 A;  1E2S P;  3WAX A;  4QAX A;  4LRD A;  2W5S A;  3BDG B;  5LRN A;  2X98 A;  5DLW A;  3MK0 A;  2W5R A;  3IDD A;  5LRM A;  4LR2 A;  3Q3Q A;  1KHJ A;  2XR9 A;  1AJB A;  1URA A;  1AUK A;  1EW2 A;  2G9Y A;  3NKM A;  4KJD A;  4CXS A;  1E1Z P;  2VQR A;  5C66 A;  4LR8 A;  1O99 A;  2D1G A;  3A52 A;  4N7T A;  4NWX A;  3UNY A;  1EW9 A;  4GTY A;  4CXU A;  4B56 A;  5DLV A;  4LRA A;  3M8W A;  4NWJ A;  4CYR A;  3T01 A;  4GTX A;  2IUC B;  1E33 P;  3M8Z A;  1ELY A;  2GA3 A;  1ALH A;  2GLQ A;  2IFY A;  3B5Q A;  5DLT A;  4ZG6 A;  4KAV A;  3UN2 A;  3UN3 A;  4LR7 A;  3IGZ B;  4UPL A;  5L0B A;  4MHX A;  4CXK A;  5L0E A;  4LRB A;  3CMR A;  2W5V A;  3SZY A;  4ZGA A;  2QZU A;  1ALI A;  1EQJ A;  1HQA A;  1KH7 A;  1E3C P;  1AJC A;  5HRT A;  1AJD A;  4LRF A;  1ZEF A;  5INH A;  1ANI A;  3T00 A;  4LQY A;  4UOO A;  3ED4 A;  1KH5 A;  1FSU A;  1ELX A;  3WAW A;  2GSO A;  3TWZ A;  5GRR A;  2XRG A;  5LQQ A;  3NVL A;  1K7H A;  5K4P A;  5EGH A;  1ZED A;  4KJG A;  1HDH A;  1ANJ A;  1SHQ A;  2IUC A;  3MK2 A;  4GTZ A;  3MK1 A;  4MY4 A;  4TN0 A;  3WAV A;  1EJJ A;  2W5X A;  3BDG A;  5TJ3 A;  1ZEB A;  1KHL A;  2W5W A;  1ELZ A;  4UOR A;  1Y7A A;  5IJS A;  4UOP A;  3BDH A;  3DPC A;  3WAY A;  4LR9 A;  1ED9 A;  5IJQ A; 
#chains in the Genus database with same CATH topology
 3UN5 A;  1EI6 A;  4KAY A;  3T02 A;  3NKP A;  2W8D A;  1KHN A;  5L0K A;  1AJA A;  3IGY B;  3DYC A;  2W5Q A;  3KD8 A;  1KH9 A;  1B8J A;  1ED8 A;  3BDF A;  5AJ9 A;  5EGE A;  3OT9 A;  5LIA A;  1N2L A;  3M8Y A;  2ANH A;  1P49 A;  1ALJ A;  4UPI A;  3M7V A;  4YR1 A;  4LRE A;  4LRC A;  2W8S A;  2W5T A;  3NKQ A;  1SHN A;  2ZKT A;  2GSU A;  1EW8 A;  1Y6V A;  3TX0 A;  4ZG7 A;  3WBH A;  5GOV A;  3SZZ A;  3TG0 A;  3NKN A;  2RH6 A;  1URB A;  1O98 A;  4MIV A;  3NKR A;  4KM4 A;  1HJK A;  1N2K A;  4FDJ A;  4CYS A;  3LXQ A;  3NKO A;  4UPK A;  4UPH A;  3UO0 A;  4ZG9 A;  4FDI A;  1ALK A;  5KXA A;  3E2D A;  4GTW A;  1KHK A;  2GSN A;  1KH4 A;  1E2S P;  3WAX A;  4QAX A;  4LRD A;  2W5S A;  3BDG B;  5LRN A;  2X98 A;  5DLW A;  3MK0 A;  2W5R A;  3IDD A;  5LRM A;  4LR2 A;  3Q3Q A;  1KHJ A;  2XR9 A;  1AJB A;  1URA A;  1AUK A;  1EW2 A;  2G9Y A;  3NKM A;  4KJD A;  4CXS A;  1E1Z P;  2VQR A;  5C66 A;  4LR8 A;  1O99 A;  2D1G A;  3A52 A;  4N7T A;  4NWX A;  3UNY A;  1EW9 A;  4GTY A;  4CXU A;  4B56 A;  5DLV A;  4LRA A;  3M8W A;  4NWJ A;  4CYR A;  3T01 A;  4GTX A;  2IUC B;  1E33 P;  3M8Z A;  1ELY A;  2GA3 A;  1ALH A;  2GLQ A;  2IFY A;  3B5Q A;  5DLT A;  4ZG6 A;  4KAV A;  3UN2 A;  3UN3 A;  4LR7 A;  3IGZ B;  4UPL A;  5L0B A;  4MHX A;  4CXK A;  5L0E A;  4LRB A;  3CMR A;  2W5V A;  3SZY A;  4ZGA A;  2QZU A;  1ALI A;  1EQJ A;  1HQA A;  1KH7 A;  1E3C P;  1AJC A;  5HRT A;  1AJD A;  4LRF A;  1ZEF A;  5INH A;  1ANI A;  3T00 A;  4LQY A;  4UOO A;  3ED4 A;  1KH5 A;  1FSU A;  1ELX A;  3WAW A;  2GSO A;  3TWZ A;  5GRR A;  2XRG A;  5LQQ A;  3NVL A;  1K7H A;  5K4P A;  5EGH A;  1ZED A;  4KJG A;  1HDH A;  1ANJ A;  1SHQ A;  2IUC A;  3MK2 A;  4GTZ A;  3MK1 A;  4MY4 A;  4TN0 A;  3WAV A;  1EJJ A;  2W5X A;  3BDG A;  5TJ3 A;  1ZEB A;  1KHL A;  2W5W A;  1ELZ A;  4UOR A;  1Y7A A;  5IJS A;  4UOP A;  3BDH A;  3DPC A;  3WAY A;  4LR9 A;  1ED9 A;  5IJQ A; 
#chains in the Genus database with same CATH homology
 3UN5 A;  1EI6 A;  4KAY A;  3T02 A;  3NKP A;  2W8D A;  1KHN A;  5L0K A;  1AJA A;  3IGY B;  3DYC A;  2W5Q A;  3KD8 A;  1KH9 A;  1B8J A;  1ED8 A;  3BDF A;  5AJ9 A;  5EGE A;  3OT9 A;  5LIA A;  1N2L A;  3M8Y A;  2ANH A;  1P49 A;  1ALJ A;  4UPI A;  3M7V A;  4YR1 A;  4LRE A;  4LRC A;  2W8S A;  2W5T A;  3NKQ A;  1SHN A;  2ZKT A;  2GSU A;  1EW8 A;  1Y6V A;  3TX0 A;  4ZG7 A;  3WBH A;  5GOV A;  3SZZ A;  3TG0 A;  3NKN A;  2RH6 A;  1URB A;  1O98 A;  4MIV A;  3NKR A;  4KM4 A;  1HJK A;  1N2K A;  4FDJ A;  4CYS A;  3LXQ A;  3NKO A;  4UPK A;  4UPH A;  3UO0 A;  4ZG9 A;  4FDI A;  1ALK A;  5KXA A;  3E2D A;  4GTW A;  1KHK A;  2GSN A;  1KH4 A;  1E2S P;  3WAX A;  4QAX A;  4LRD A;  2W5S A;  3BDG B;  5LRN A;  2X98 A;  5DLW A;  3MK0 A;  2W5R A;  3IDD A;  5LRM A;  4LR2 A;  3Q3Q A;  1KHJ A;  2XR9 A;  1AJB A;  1URA A;  1AUK A;  1EW2 A;  2G9Y A;  3NKM A;  4KJD A;  4CXS A;  1E1Z P;  2VQR A;  5C66 A;  4LR8 A;  1O99 A;  2D1G A;  3A52 A;  4N7T A;  4NWX A;  3UNY A;  1EW9 A;  4GTY A;  4CXU A;  4B56 A;  5DLV A;  4LRA A;  3M8W A;  4NWJ A;  4CYR A;  3T01 A;  4GTX A;  2IUC B;  1E33 P;  3M8Z A;  1ELY A;  2GA3 A;  1ALH A;  2GLQ A;  2IFY A;  3B5Q A;  5DLT A;  4ZG6 A;  4KAV A;  3UN2 A;  3UN3 A;  4LR7 A;  3IGZ B;  4UPL A;  5L0B A;  4MHX A;  4CXK A;  5L0E A;  4LRB A;  3CMR A;  2W5V A;  3SZY A;  4ZGA A;  2QZU A;  1ALI A;  1EQJ A;  1HQA A;  1KH7 A;  1E3C P;  1AJC A;  5HRT A;  1AJD A;  4LRF A;  1ZEF A;  5INH A;  1ANI A;  3T00 A;  4LQY A;  4UOO A;  3ED4 A;  1KH5 A;  1FSU A;  1ELX A;  3WAW A;  2GSO A;  3TWZ A;  5GRR A;  2XRG A;  5LQQ A;  3NVL A;  1K7H A;  5K4P A;  5EGH A;  1ZED A;  4KJG A;  1HDH A;  1ANJ A;  1SHQ A;  2IUC A;  3MK2 A;  4GTZ A;  3MK1 A;  4MY4 A;  4TN0 A;  3WAV A;  1EJJ A;  2W5X A;  3BDG A;  5TJ3 A;  1ZEB A;  1KHL A;  2W5W A;  1ELZ A;  4UOR A;  1Y7A A;  5IJS A;  4UOP A;  3BDH A;  3DPC A;  3WAY A;  4LR9 A;  1ED9 A;  5IJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...