4V8PBA

T.thermophila 60s ribosomal subunit in complex with initiation factor 6.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
257
structure length
257
Chain Sequence
GRVIRAQRKGRANGVYKSHKSGRIAPAQYRVYDFAERQGYIRGCIRDIVHEPGRGAPLAEVAFRDPYRYKTNKEHFIAAEGQYSGQYVYCGLKAQIAVGNVLPINRIPEGTVVCNVEEKVGDRGTFSRASGCYATIIGHSEDGDKTRIRLPSGARKTIPGSCRATVGIVAGGGRTDKPILKAGNQFHKYARKRKSWPRVRGVAMNPVDHPHGGGNHQHIGHPATVSKWASAGQKVGLRAARRTGLVRGGQKEKMAMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 26S RRNA
publication title Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.
pubmed doi rcsb
total genus 41
structure length 257
sequence length 257
chains with identical sequence CA, EA, GA
ec nomenclature
pdb deposition date 2011-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
BA PF00181 Ribosomal_L2 Ribosomal Proteins L2, RNA binding domain
BA PF03947 Ribosomal_L2_C Ribosomal Proteins L2, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...