4WKRA

Larp7 wrapping up the 3' hairpin of 7sk non-coding rna (302-332)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
161
structure length
161
Chain Sequence
b'SRVKQVLADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords La-related protein 7
publication title Structural insight into the mechanism of stabilization of the 7SK small nuclear RNA by LARP7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 40
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wkrA02
2HGMA 2ZJRQ 2MQLA 2MQMA 2F9DA 2MGZA 1SJRA 1FXLA 1L3KA 3H2UB 5GMKa 1N88A 4EGLA 3CD6S 3CCJS 2M88A 1NO8A 2WBRA 4FXVA 1N52B 1WG4A 5H1SV 2JRSA 2E5HA 2OSQA 2MJNA 1WF1A 2CPZA 1JJ4A 3UCZP 1O0PA 1H2VZ 3Q2TC 2MZRA 2E5JA 3OW2R 1N8RT 3FEYB 4Z2XA 4CH1A 2MY7A 1N54B 2AYEA 2CQ1A 3CCVS 2QEXS 1B7FA 2VONA 3VF0B 1VQPS 4ED5A 2LEBA 1VC5A 1FT8A 4LIRA 2ADCA 4PR6A 1ZZFA 2DITA 4Y0FA 3G6ES 1A7GE 4BS2A 5EN1A 5HL7Q 1QM9A 1VQ5S 5LXRA 2QA4S 3CPWR 2MKCA 5D77A 1FJ7A 2XS2A 2LMIA 3V4MA 1YITS 1D8ZA 3UCUP 4QPTA 1OWXA 2E5GA 5LSOA 4IOCQ 2RUGA 2MZTA 2MJUA 1QVFR 2DHGA 2KFYA 4QU7A 2JVRA 1VQLS 2RRBA 5DM7Q 2D9OA 1YHQS 1NU4A 4UY8T 3CMES 3MOJB 2MQNA 3B4DA 2ADBA 1URNA 3CCQS 4IO9Q 2OSRA 4CIOA 3U1LA 3BEGB 2KH9A 1H2UX 2XSFA 2DNKA 1VQOS 1U1RA 1X4GA 2KI2A 4WFAQ 4TU8A 1U1LA 2DGTA 2O3DA 2RS8A 1M5PC 1WEXA 2MQQA 2MGZB 1WG1A 4IUFA 2G4BA 1UFWA 4WF9Q 2DO0A 2XS7A 2MZQA 2JVOA 2RU3A 2XNRA 2BZ2A 1YI2S 2MKSA 1WELA 2DNMA 1AUDA 1K9MT 2D9PA 1U1QA 2Q79A 2N82B 5JVHQ 1VQ9S 2KU7A 1VQMS 3CULA 1WHXA 2DHSA 2DH7A 3TP2A 1YJNS 3BO4A 2E5IA 1HD1A 2D3OR 4C7QA 5DDOC 3VALA 2J8AA 2N7CA 3EX7B 1VQ8S 3LQVA 2MKKA 1X5OA 3K0JA 1M1KT 3IRWP 2KN4A 2HGLA 4P6QA 2FC9A 3RW7A 1X4FA 1YWXA 3VAJA 2M7SA 3CMAS 2M8DB 3JB9k 2HVZA 3S7RA 3P6YC 5CXTA 3S01A 5HO4A 3BS9A 2L9WA 5GADU 2X1AA 1P1TA 3CF5Q 5IM0A 3MI7X 3CCSS 2DNPA 1U1MA 2YH0A 1SJ3P 3R1HA 1HD0A 1PGZA 2DHAA 1S72S 3R27A 2MQOA 2CQ4A 1U1KA 1WHYA 2KXFA 4OZ1A 3U1MA 5DDRC 4TLQA 2KXHA 1SJQA 2KYXA 1SJ4P 2DNLA 1CVJA 1YIJS 1R8HA 2LEAA 2K3KA 3UE2A 3EGNA 3R1LA 1KC8T 4PKDB 3UD3P 3THPA 5LXYA 5GAHU 2CQPA 1WEZA 3VAMA 2GHPA 1DRZA 2CQBA 5DDQC 1HL6A 2MHNA 2YTCA 1PO6A 5GVQA 3Q2SC 2RQ4A 3J7YU 3G96A 3BO3A 4V19X 4YB1P 3FEXB 4F25A 3P49B 3LPYA 1M5VC 2CQ2A 1FO1A 3CCUS 2DIUA 2ERRA 3VAGA 2DGSA 1KQSR 3N9UC 2CQHA 2DK2A 3S6EA 3CC7S 4M5DB 2LYVA 1KD1T 3NNCA 2DGWA 2DH8A 3P5TL 4A8XA 1DHMA 1WTBA 3VAIA 2CPEA 2DO4A 3THTA 3PIOQ 4WFBQ 2VOOA 1ZH5A 1G2EA 1R8PA 4C0OC 2KG1A 2DGUA 4WFNQ 3L3CA 3H2VE 2ZJQQ 1UP1A 3G71S 2AYBA 3G8SA 5IFMA 3VAKA 5LJ5Y 3J7ZT 5FJ4A 1FJEB 5IM0B 1OPIA 1X4DA 2MB0B 1X4AA 1WF0A 3HHNB 1VQ6S 3HI9A 1WHVA 2GO9A 3MUTP 1U1PA 1KOOA 3ZZZA 2UP1A 2MY8A 3NNHA 1H2TZ 2MKJA 3IWNC 2MSSA 3SDEA 3UD4P 3G4SS 1BY9A 2KRRA 1FHTA 3MD3A 1Q7YT 1WF2A 2E44A 3G8TA 2CPIA 3CTRA 2ZJPQ 2MSTA 4U67Q 4RU2A 4QQBA 2RNEA 1WI6A 2MPUA 5LSLA 3P3DA 2YWKA 4PRFA 2X1BA 2KRBA 2DGOA 2RS2A 2J0QD 2HZCA 2J76E 2KXNB 1S79A 3DLLQ 4WCEQ 1X5PA 1DBDA 4WIIA 3CXCR 2MZJA 1Q81T 2CPFA 1ZZNA 3CCMS 5DM6Q 2M2BA 5D78A 1IQTA 2RVJA 1UAWA 2OIHA 3CCES 3BO2A 2A3JA 1U2FA 1WG5A 1YJ9S 2MQPA 1WHWA 1X5SA 2F9JA 2FY1A 2EK1A 2I38A 2HGNA 1M5KC 1X4BA 2EVZA 1WI8A 1QVGR 3NS6A 1RK8A 2KM8B 2X1FA 5LJ3Y 4F26A 2LECA 4J5OA 2CQ3A 1F9FA 1VQNS 1VC0A 1FJCA 3G9CA 2M8HA 4ERDA 1A9NB 2PEHA 3MDFA 3B4MA 5GAEU 2CQDA 4FXWA 2RRAA 1U6BA 4TU9A 5ITHA 4YUDA 2MXYA 2MMYA 2G0CA 2JX2A 2JWNA 2CPHA 2I2YA 2XS5A 3NMRA 2M0GB 1VQKS 2KHCA 2CPDA 3SXLA 2BOPA 2DGVA 1X5TA 2OTLS 4YOEA 4LMZA 3MURP 1XN9A 2U1AA 1X4HA 3SDEB 4CQ1A 2DB1A 3UCGA 3VAFA 2MKHA 2MKIA 2MZSA 2PE8A 4WKRA 3DXBA 2CJKA 2DNQA 2L08A 1VQ7S 4ZKAA 1X4EA 1HA1A 3S8SA 4W90B 3RW6A 3MUMP 3CCLS 2LQ5A 2M9KA 3CC2S 1X4CA 2N3OA 3NNAA 2DNOA 5IQQA 2M70A 5GAGU 3ZZYA 5CA5A 1YTYA 5JVGQ 1K73T 2XNQA 2DNGA 2CQ0A 2CPXA 2K8GA 1KOHA 1DZ5A 2CQIA 4LJMA 4TU7A 2M52A 1SXLA 2CPYA 2LCWA 2U2FA 1VBZA 4W92B 3TO8A 1U1OA 1JMTA 1U1NA 2SXLA 1FNXH 1YJWS 2B0GA 5CYJA 2AYGA 3NS5A 2NLWA 1VC6A 3VAHA 2NZ4A 2DNYA 2V94A 2KVIA 2X1GA 1M5OC 2XB2D 2CPJA 4F02A 1RKJA 5MLCV 2M4MA 3ULHA 2N3LA 3SMZA 2DNRA 2FC8A 1H6KX 1UW4A 2G1DA 2KT5A 2LXUA 3MD1A 5BJRA 3I56S 1NJIT 1VQ4S 2VODA 2CQCA 3EGZA 2AYMA 3PIPQ 1JJHA 2KG0A 3UWTA 2YKAA 3US5A 3D2WA 4OZ0A 1W2BR 2DH9A 2LXIA 2VOPA 2MZ1A 2OJ3A 4IOAQ 4CH0S 1VBYA 2LKZA 1WWHA 2LA6A 1SJFA 2MYFA 2DNZA 2DGQA 1OIAA 2KM8C 2QFJA 2RT3A 1OO0B 2FPHX 3TYTA 1M90T 2DNNA 1D9AA 3CUNA 1Q82T 2CQGA 1WEYA 4Y00A 3MXHP 1VBXA 4UQTA 1Q86T 2DHXA 2AD9A 2DGXA 1X0FA 1P27B 3CCRS 2F3JA 2LA4A 3CC4S 5DETA 2L41A 2RQCA 1K8AT 2J0SD 4QU6A 2DISA 3MUVP 2HYIB 1U6FA 2OTJS 2DIVA 3I55S 2DNHA 2YH1A 4C4WA 2EK6A 1JJ2R 2FHOB 5DDPC
chains in the Genus database with same CATH superfamily
5KFUA 3L09A 3HHLB 1H72C 1SJRA 1F3FA 5IV3A 2VHGA 1RCXB 2HBQB 2EKNA 1DLOB 3OW2R 4OYAA 2W9BB 3AD8C 1NRKA 2A10A 4CLYA 2FLNA 3UDLA 3KK3B 3DLGA 1SV5B 4IH7A 1PJ7A 5A6WA 2PFFB 3EXYA 2J6SA 2P2CB 3L7PA 2YWFA 1UVJA 3CJ2A 1V3SA 2MTLA 2DR7A 1NK7A 5KG5A 4QCLA 1MW7A 1UETA 4CIOA 4OYBA 1JLEA 2BW7A 4HDHA 2CZ9A 3U27A 2ZH7A 3NGKA 3TZYA 5L8RC 2W4CA 1MN7A 1RT5A 2O01C 5GADI 1HPZB 2CNOB 3W66A 1REVB 3ZZRA 3HXMA 1GT8A 5IZHA 2V4QA 3PRBA 2VPYB 1ZPVA 2IC3B 4A46A 1CULB 2DHSA 3C15B 3TP2A 4DEZA 4EBEA 1TAUA 5F41A 3MEDB 2N7CA 2C2KB 1F3VA 3M32B 2KN4A 3GIJA 1FX4A 3FSXA 1HBMA 2FHJD 4ER8A 3RB4A 1FRMA 3T1YJ 2A2CA 1FERA 3D1HA 4YQWA 3U1NA 2Z2ZA 2F65A 4CO1A 2KXFA 4OZ1A 1NUEA 2I9SA 4DR5J 1YIJS 3OXFA 3OHBA 4B3OA 2YNGA 3UD3P 1BD6A 1HL6A 2HLUA 3JYTA 3VAGA 1UW9A 5KG4A 3MAQA 2BJ7A 3EE3A 2EFVA 1DAXA 2QSWA 2W7OA 1FCAA 1YZ7A 3ITHA 3M8QB 2GIRA 2VOOA 4C3KA 3NAIA 1PAEX 2HFOA 1VHIA 2F7VA 1TZ0A 1UP1A 5IM0B 1TL4A 1RGVA 3ENAA 3MOZA 1LW0A 1RT1B 3EZUA 2H3EB 3HI9A 4J9UE 2DY9A 4P10A 5E2QA 2GZOA 3R7BB 1XR6A 3MD3A 5C42A 1Q7YT 4QZVB 3QJPA 2ZHOA 2D41A 2MKYA 2XYHB 5F0WA 3FQKA 4ECZA 2BANB 1JXEA 4K4XA 3MMBA 2BJ8A 3S1TA 4V19J 2J76E 5C2CA 3WQPA 1RT3B 3K7RA 3HHLC 2O67A 5D78A 4NYPA 4ZCLA 2R7UA 3QRQA 1NPKA 1WG5A 2BQ3A 3TOQA 1RHKB 1SC6A 2ZUGA 5H9EK 2JHEA 3BN7A 1KQKA 3DXSX 1VQNS 1A9NB 2NYIA 1IBKJ 1G4CA 3I0RA 5JXSA 1WC0A 2BDPA 4IKAA 3G86A 4UZBA 4ANEA 1DJ0A 3KJQB 1VRTB 4NXMF 4RUAA 1U25A 4DL6A 3QIPB 4DN0A 2AU0A 1X4HA 4RUCA 2A0FB 2OD4A 1WTFA 2AEJA 3P4UB 2CG8A 5IQQA 4IFYB 2VQFF 4HI2A 2CQ0A 1XMQJ 1KOHA 1DZ5A 4JI5J 2EBGA 1HQEA 5D3GB 3H5UA 1V5VA 1FNXH 2X7IA 2YKQA 4A8FA 2XO7A 3P45B 2BA9A 2NLWA 4QJVA 2NZ4A 3B54A 2CJXB 2JEJA 4ZLPA 2IJFA 3EICA 2B9WA 3OR1A 2WSCC 4UY85 2G0IA 2DNRA 4X62F 1P9YA 2VH7A 4JI2J 2YX1A 1FFSB 3I9ZA 1FRIA 2YX7A 2OJ3A 4CYUA 3AOCA 4DQSA 3K8VA 2ZVIA 1P9QC 4J7CA 4GC7A 1JWWA 2HQFA 1U2RA 2VG6A 4G65A 1N33J 3GLJA 5HK4A 4LSNB 1M1GA 5A2QU 2F3JA 4LUBA 1REGX 2RAQA 2RHQB 3R5AA 2OTJS 2R8GA 2HHPA 4DFKA 2ZWPA 1RP5A 4F0HA 1L3KA 4WFXA 1I51B 4NL5A 2WBRA 1NK8A 1S1UA 2GFFA 2OSQA 2QZ8A 2XCAA 3PW5A 2D3O1 3A13A 2UXCJ 4LF6J 2YNFA 2VDHA 2RSQA 6FD1A 4X65F 1N34F 2XCPA 3HKZD 4ED5A 3VF0B 1B7FA 5KT4A 1VC5A 4KPYA 3PJ9A 2XLJA 1XR7A 1PYSB 1FNMA 2OO4A 3LANA 4DF4A 3G8QA 1OWXA 3FGVA 3GYNA 2BV3A 3KKFA 1LWEA 4YR3A 4OJGA 2ADBA 3CCQS 5H9FK 1KTVA 1G1XA 1KP6A 2XSFA 1SL1A 1IJFB 2DGTA 4LF5F 1N48A 1S1WA 2Y9HA 1QAXA 3HP6A 3DRYA 4FBTA 3SSRA 1JLGA 1SUQB 2RU3A 5K14B 2XNRA 1YI2S 3SV4A 2DRBA 5J2NB 4ANCA 2KU7A 3CULA 1RACB 4AL7A 1N6QA 3M30A 1FX2A 4IYQA 2J8AA 1FJGJ 4A8QA 1TK8A 4HH1A 3KLEA 2FZCB 3HVAA 3VVUA 1FDNA 1R31A 5B0FA 4ELTA 1MU2A 1HNWF 5ETKA 3D6HB 4KYZA 1DFDA 3OPKA 3GIRA 4DL0C 5CABA 3DRSA 2YTCA 3N5FA 4RW6B 3KHLA 4Y65A 4DLEA 3SBMA 1OYEA 3FEXB 3P49B 5KOXA 1RAOA 2C3PA 1YSJA 2VDIA 3NCRA 5A8WB 1WDTA 4DUYJ 2W4PA 2RQMA 2Z30B 3BYRA 2LYVA 1KD1T 3BQ1A 4HACA 1BWEA 4OHYA 4AL6A 4WBFA 4UZCA 1BQMA 2HURA 4WFBQ 2CWXA 1W25A 4URSA 5ETLA 2JNJA 3O1LA 4ILLA 2HVEA 3BB5A 2FIUA 1B3TA 2FJBB 2J9DE 2DVIA 3AXKA 5FJ4A 5B0BA 1RA6A 1UCNA 1VQ6S 1UVIA 3LAMA 3NNHA 4DFJA 3RRHA 3H4BA 1CJKA 2KRRA 2NYHA 4C0BA 1VRQC 5CZXA 4A8KA 3JAMU 5HROA 4OFZA 2OGUA 1SIZA 3PVXA 4YY3F 3V6HA 4R5PA 2OEJA 2W8KA 2CPFA 2VFRA 2YNIA 4P71A 3JAMY 4CNZA 4F3OA 4OZJA 2OPPA 2C3OA 3GJQB 2PN6A 4ZVOB 2F9JA 4PG6A 4BDPA 1LK5A 3QAUA 3IR6B 3FBEA 4FKYA 2HIQA 4ZPCA 4ZCKA 4Y3CA 2PEHA 1RT7B 2JX2A 2LDIA 3GIKA 3PW4A 3UI3A 4LR8A 4I7FA 2OELA 4LRDA 3GFXA 3RBXA 2HHQA 4F0MA 2QL7B 2MEWA 4AL5A 1NAQA 2UV8G 3M2UB 2HHHJ 3I82A 2IPOB 2OI2A 4Z7YA 1YTYA 1RTDB 4NMLA 2QYCA 1Y5NB 2ZH5A 4DMZA 1U26A 4ZPBA 1B70B 3ILJA 4I4BA 5CYJA 5E41A 4OI4A 3IS9B 4ZVFA 4QOTA 3BREA 2KZMA 5DO2A 1M5OC 1Q4RA 1N5YB 1RTZA 4ZP7A 4NLYA 1RHMB 3TWZA 2CNLB 4KQZA 3V6DA 3KK1A 3Q8UA 1PILA 3UWTA 4M8LA 3TUPA 5IC4B 1UL3A 4GKJJ 2BJ9A 4NEYA 4DV5J 1HNXJ 3T19A 2GMLA 2LA6A 3OTOJ 2F8MA 3GFYA 2UVVA 1WEYA 2GVZA 3MXHP 2BJEA 4ZIWA 1C1BA 1GMWA 3GILA 4DV4J 3RUBL 4OHXA 1KSPA 1T9XA 2HRTA 1HIYA 1JLQA 4LF8F 3Q8SB 4LF7J 3W2WB 2M88A 4PCQA 4PEOA 4L72B 3AOAA 3MM6A 1HBOA 4RWWA 3D5MA 2MJNA 4YN3B 3O6QA 2BE7D 5L9XA 3AA9A 2C42A 3P8BB 1EQ0A 1LV5A 4QW9A 4DL3A 2WB1D 2ADCA 3JQMA 4DX8H 5KFJA 1QM9A 3I4PA 5LXRA 1HNVA 4AFFA 2HHTA 4O44A 2XS2A 3JQKA 3PHEA 1N36F 1QVFR 1RQ0A 3AD7C 2AQ4A 4ZCMA 2IBKA 5KAKA 4GKKJ 2OSRA 1EARA 2B7CB 3JXOA 3UNYA 1NK6A 2WK4A 3OV7A 2XS7A 4F50A 3DRPB 2YKNA 3ENVA 3TW0A 4ZN1A 2W9AA 1YJRA 1QD1A 3QBCA 2RIJA 2DH7A 2E5IA 2D3OR 5GAHI 2ASLA 4PWDB 3RW7A 5A6PA 2HWIA 2M7SA 2XHWA 1LFPA 1KTQA 2CZVC 2EPIA 1HBUB 3J7YI 2WVFA 3PY8A 3DDIA 4HH0A 4OJHA 1XC9A 3T5KA 2GVDB 3NXZA 3MI7X 1Q16B 2Y3YA 1S72S 1F60B 2COLA 1TFWA 4KKOA 3N5BA 3ZTPA 2HHSA 2RMLA 4KGXB 4XDDA 4ECVA 1A0OB 4Y28C 1NJXA 3RB6A 4CLUA 3D28A 1NDPA 3SSQA 3TAMB 2V2ZA 2VBXA 3TR5A 1AZSA 3H8YA 4X4OA 4NWBA 2E29A 2RRNA 4F4XA 3EGWB 1O8BA 3PXGa 2CRLA 1TL3A 4DSIA 4DX5A 4DSFA 3EPIA 1P1LA 1QE1B 4DN9A 1UEUA 4TY8B 4WTOB 1S0OA 4F3MA 3LPEA 3IG1A 3AOBA 2HQIA 2ZH4A 1GMVA 1TELA 4XTTA 3QGPA 2CPIA 1UA0A 1DTQA 1WI6A 4A8OA 2ZH6A 5GMEA 4J37A 2A1BA 2ZHAA 4KHPJ 3V6JA 2XWXA 3QT6A 3MMAB 4OZ5A 1K47A 4NLTA 1DQ8A 3KHHA 3EWGA 2VZ9A 3ENQA 4DV7J 4NI2B 3CJSA 3I4HX 3M9MB 1RAGB 4ECQA 3MAAB 2DTJA 3A8IA 1QSSA 2XZWA 3D6MB 3IFEA 4EMDA 4YFUA 2MXYA 4ZVTB 3K5PA 4KV8B 4Z37A 1WC1A 4I2PA 3IGNA 4NLGA 1V3ZA 1FNOA 5HP1B 2U1AA 2XHCA 3N6MA 5A0YA 2VIHA 2MKHA 4OZ3A 4ZVHA 2CJKA 5KFNA 2XMVA 3LGNA 5K8OA 2QMWA 4DUZJ 2HVDA 2IRYA 2XBPA 5M2RA 2V4JB 1T9WA 2E1CA 1ELOA 3NNAA 2HQ3A 4OX9F 1RISA 4XO0A 4OI6A 2ZFHA 1HNIB 4TYAA 1MMLA 2V8GA 1KS2A 1U1OA 4BWMA 3T5HA 4FYVB 2AYGA 1QY7A 2Z57B 4Z7CA 3HHLA 2ROEA 2VBWA 2QLJB 5KFDA 1DQAA 2V8PA 5D4LA 2ACYA 3SCIE 3Q8VA 4MJKA 1DLOA 1UW4A 5BJRA 4OZNA 2CQCA 2V63A 3RRKA 2W9BA 3V2UC 3KK3A 1KVKA 1SV5A 3BGRB 3DKDA 1IM4A 1L3SA 4HL9A 1FRLA 1IBCB 4WWSA 3OL7A 2DHXA 3M9OB 1YGYA 3M4XA 1CBKA 2PO4A 2D69A 1XK8A 2HYIB 2PA8D 3NBPB 5EDWA 5KFWA 2QL9B 4YDDB 3FVYA 4JI7J 1KFDA 4PWUA 5IQ6A 3KJVB 4ZP6A 1HPZA 2GIQA 4FN5A 4RBUA 2CPZA 3UDVA 2E5JA 2IC3A 1CULA 3C15A 2XWYA 1RBOB 1S7IA 1NKBA 3M32A 2HHWA 3ISND 1A7GE 4KIAA 1X60A 3AH6A 5I3PA 2RF2A 1YITS 4R25A 1MMDA 5IWAJ 2VG5B 4ATNA 4DI6A 2XZDB 3M8SA 1S9GB 3EVOA 3MPWA 1JXLA 4CM2A 1HHQA 3FZBA 1Y00A 5BYRA 2V4RA 4NCBA 1YRUA 5LMUF 1NM2A 2LQJA 4ECWA 2YKPA 2G4BA 2QSFA 4UOCA 5B0DA 1R6YA 3GWCA 3GU0A 1OQ6A 2IMOA 2Q43A 2MLXA 4JYAJ 5HJYA 1YZ6A 4ZVRB 3D0IE 2FVPA 2R7VA 3H40A 2XSJB 4JV2A 4B9UA 2P9GA 3N4WA 3K0JA 2PA3A 4P6QA 2LVWA 2ZH1A 1OSDA 4WE1B 2EKYA 2YWEA 3M8QA 4L3KA 2V6AA 1FA0A 3GFHA 5CXTA 1T0TV 4B3SF 2L9WA 4CLKA 5KFYA 4JI3F 3I5CA 5IM0A 4D3GA 1U0HB 5D8HB 2XYPB 1RT1A 4TLQA 2A6OA 1TL5A 2XLKA 1Q79A 2IRUA 4CH7A 3I31A 1XMOF 2E7WA 3EJMA 2BABA 2BANA 2RQ4A 3G96A 3BKUA 3Q8QB 5L39A 1OS5A 4DR3J 4W4MA 1U24A 1K44A 4CLWA 2K2PA 3VTIA 2DK2A 3EZ5A 1CLFA 4JV5F 4ITSA 4LFAJ 4FS1A 2VPZB 5HQLA 3AXMA 1LQ9A 2V8DA 1HQUB 4NMXA 2UUWA 1TKZB 8RUCA 2L9DA 4UTGA 4ALZA 2BJ1A 1VRTA 1U1PA 3ZZZA 2D1CA 2ASDA 1AW0A 4IDKB 3PFOA 2FQQB 3OFGA 4PRFA 3R7SB 3OJUA 3V6KA 2KRBA 3NGTA 2ZZMA 2QT7A 4RR5A 1B99A 4YB5A 1IBLJ 1S79A 3TEHB 4IFYA 3ZC4A 1DBDA 1DURA 3KDOA 3BV8A 4OI1A 2OIHA 3AA8A 5D3GA 2BRKA 2NR0A 1H38A 3M05A 2EVZA 5HMXA 1Y0HA 4MK7A 3QRPA 1FFWB 2GCFA 1SQFA 4F26A 3JSRA 2CQ3A 3B4MA 2G0CA 2XULA 4NZ0A 1X5TA 4BHQA 2OTLS 3MURP 2H5JB 4PXEA 1TKXB 2MLZA 2PE8A 2GV1A 4HTJA 4NX9A 1OY9A 3BSCA 1RWKB 2BRLA 4K5RA 3MM5B 2CUYA 4LSNA 3TRGA 3TA1A 1KEKA 1NPRA 4DL2A 2XNQA 1SC1B 3D3CJ 2CPXA 3D1QA 1VBZA 4WXOA 4XPCA 2V8HA 4AQYJ 1R8BA 4USJC 2DNYA 3BDPA 4YMEA 1MROB 3ETOA 1R0BG 3HFVA 2QYGA 4F02A 1LWFB 2HBYB 2CYYA 3W2VB 5ETQA 2O5DA 4P73A 5ETVA 3NWGA 5FIIA 2ZBIA 3EGZA 4ELUA 5KFHA 2YKAA 2QA4G 4K4YA 2Y8WA 1T9UA 2LXIA 2GHWA 1RWUA 1HWUA 3IO1A 4OI0A 4WTYA 4RW7B 2VJVA 3MR2A 1SJFA 4A8SA 4MTPA 5IV4A 3NEKA 4NOHA 1NHKL 2AMCB 3DLGB 4WK3A 1Q82T 2V67A 4ECSA 1D8YA 2NXCA 3GG0A 3HSJA 4ZS6A 2AJ0A 1EKRA 1S1VB 4C4WA 5HLFB 3MEKA 2DR6A 2CADA 2ZJRQ 1JX4A 1T3OA 3QJLA 4HVZA 1U09A 1SUQA 3BGUA 5K14A 2FZGB 3CNQP 5J2NA 2B5JB 2GQCA 4AE5A 1N8RT 4M5KA 3RYLA 1KVJA 1KDNA 1Z2LA 4P2MA 1FT8A 1FVQA 2W2QP 1ZZFA 4DZDA 5HMWA 3CPWR 2W1BA 4IO1A 3FUYA 3HVWA 3KTQA 1D9DA 4PQUB 2MJUA 4LBIA 2GIFA 1NEEA 1TK5A 1TU0B 2W25A 1NSQA 4BBYA 4R0JA 4QIFA 1F9EB 1U1RA 3KUHA 4RNNA 1XBWA 5J1EA 3QNWB 3ET6B 4K7QA 1M5PC 4CLPA 1U4BA 1EP4B 5LMNJ 2FZKB 4U7CA 1J5EF 3W64A 5D0GA 4DV2J 4RW6A 3FJ2A 2YX4A 4B3OB 4OZLA 2Q79A 2YNGB 3SFUA 1HMVB 4ZP8A 1RTIB 5A8WA 1SH2A 1YJNS 5D0EA 1HD1A 1Q1KA 2ZBCA 1GH8A 3N6NA 4DV3J 2KB2A 2RJZA 4DU8A 4I67A 3KG4A 4ZVGA 4OX8A 4NXNJ 3M6UA 4R8UB 3G6XA 4ZPWR 3F0NA 1ZM3A 3PX4A 2X3DA 5E3PA 4C8KA 5KFSA 3ITHB 2ZWOA 1ZS6A 2PIIA 4JI4J 1BLUA 2UUAF 2MQOA 3M8RA 2VFTA 1N0UA 3U1MA 4FF4A 4C6AA 5T14A 2CWKA 1Y3JA 1CJUB 3IN5A 4CO0A 1F5AA 3AD9C 1FE0A 1PO6A 4YP3A 3BO3A 4KO0B 2WOMB 4O0NA 4DR7J 4YB1P 2HHVA 3LPYA 1KKHA 1S5ZA 2B9XA 4JI1J 4P2SA 1UMJA 5AXLA 2C28A 4A8XA 1JKHB 2VFUA 5HMYA 2VG7B 1GMWD 2BR0A 4C0OC 5L1IA 3W60A 4F67A 1YQHA 3JTOA 1RABB 4LFCJ 4MKVA 1RT7A 1X4AA 2YY3A 3KLIB 3FBBA 3SQGB 1KOOA 4C3LA 1H2TZ 1RAHB 4OYMA 1H74A 4AXJA 2RQKA 5IC6B 4G1PA 2WZ1A 4UOGA 4Q8FA 3T1YF 1UEVA 4QQBA 1KRPA 5E33A 1WOPA 2VPWB 2YWKA 2C3MA 1ACMB 4YR2A 1RAIB 2P9CA 2J0WA 3M2UA 1RU1A 1M5SA 1VGYA 3CXCR 3OL8A 1RTDA 2RVJA 1UAWA 2R3VA 1S0VA 4DR1J 1WHWA 1GFWB 4NLVA 1X4BA 3SIPB 5KFIA 3CJ3A 3VGUA 3IS9A 1T03B 4TQRA 1D0EA 1U6BA 2A18A 1R0CB 4GVLA 3NMRA 4CO4A 1VQKS 4MYTA 2HAFA 2Z4PA 4AD6A 4YOEA 2YKMB 4OZ2A 3EXCX 3SDEB 3CB4A 3AY0A 4GO7X 3FRZA 2L08A 2FHMA 1I1GA 1VQ7S 4ZKAA 1RDRA 1RSCA 1GQEA 1FDBA 3O44A 2DNOA 3DLHA 1Q0NA 3R2DJ 1CSJA 4M95A 2JOQA 2JC1A 3MAHA 1SXLA 2U2FA 4DQPA 1UVKA 2QJ3A 4IQMA 3OT9A 3W2WA 3DLEB 4TKTA 2R2RA 2FTRA 1RKJA 3L7UA 3ULHA 4KJIA 3EYZA 3MF5A 3W5XA 7AT1B 4RZRA 4WU2A 3EDQB 3BQ0A 3GJTB 2HEKA 2KYZA 1S1UB 2ALZA 2R4FA 1LW2B 1GEHA 4J90A 2VOPA 4DOZA 3RZAA 4ZLJA 1IBKF 2DNZA 2OEMA 4RW9B 2ZKTA 4IOBA 2V9WA 1Q86T 2ZBQA 3PCOB 5B09A 1UWAA 3PW7A 5DETA 5D4PA 3R5DA 4YHHJ 2NUUG 4OYZA 3KDNA 1FRJA 2KVQE 1YRXA 4OYWA 1NDKA 4GMKA 4EGLA 1NO8A 3DRPA 4K4VA 3ZNJ1 1XMQF 5DG7A 4JI5F 3OSPA 3LGHA 4C8LA 3NGUA 2OUGA 4DCJB 4ES3A 2E1RA 2J7KA 4PWDA 3OVBA 4PYAA 3W8PA 1HWIA 3M2RB 2QN6B 3TJAA 3ONQA 4MFBB 4CO5A 2DHGA 4JI2F 2JVRA 2GVDA 5DM7Q 1TL1B 4PXBA 4K4UA 4DR6J 2OPQB 4U8YA 1FRXA 2YNHB 1N33F 5E3CA 2EWHA 3MR5A 5E3RA 1WELA 3PX0A 1VQ9S 3TAMA 1PJ6A 3TARA 3BGOP 3GP9A 2AGPA 1TV6B 3FZ2A 2YWWA 2K06A 5KFTA 1X5OA 1X4FA 1NMEB 1HW8A 3KLVA 3CDBA 1KVIA 3TA0A 2UXCF 3HHLD 2GHVC 2WVDA 3HHKA 4LF6F 1QE1A 2AHOB 1SB6A 3P96A 2CDRB 4TY8A 3AQPA 1WOSA 2YH0A 3QAEA 1U6ZA 4FF3A 4IRDA 3H4DA 4NLOA 1S48A 2K3KA 3BJYA 4MIAA 4ETXA 1QAJA 1FKPB 3PDNA 3MMAA 4NLSA 4DQIA 2ERRA 4K0KJ 2ASYA 2C2EA 3NNCA 1FDDA 1WTBA 1VCTA 5I3UB 1EX8A 1NZAA 4WP8A 1X9WA 3QZ8A 3LA0A 4NI2A 2KO1A 5AXKA 3MAAA 3DNCA 3N0VA 2ZJQQ 1YK9A 3OTBA 5H9EJ 4ZMMA 1UWBB 5M2PA 1NSAA 3UQSA 1J5OB 4B9LA 4KV8A 1I5OB 4KPCA 1UFLA 1L3UA 4ANDA 4RNOA 3I5AA 3OQ2A 5HP1A 1S9EB 2MSSA 1RZMA 4X64F 3WDOA 4RUHA 1H73A 1RAFB 2POKA 1NJYA 2WVBA 1OY6A 2IYIA 3MPYA 3P3DA 4PAAA 2FD2A 2YPZA 4MKYA 2V4JA 4DWIA 3J7A1 4KRWA 4WCEQ 3LWLA 1HNIA 3TJ8A 1Y10A 2OLWA 3HJVA 3DU5A 1RYRA 1QVGR 1WC3A 1RK8A 1N5VA 1RB0A 2E66A 2Z56B 5GAGI 3PG9A 4DUYF 4M63A 4YUDA 4U7UK 2FLOA 5L1LA 2C3YA 3IBCB 3MMCB 8AT1B 3N79A 3CE8A 4MIWA 2JSXA 3FKBA 4B3TF 1KQGB 3HFZB 3BGRA 4OLPA 4KGVB 4B08A 3ICLA 3CCLS 3CC2S 2R7QA 3H5XA 3ADAC 3QWPA 4C8NA 4LF2A 5IT0A 1K73T 1ZPWX 4E98A 2M52A 3V4IB 3NBPA 1U1NA 2R42A 4ZOSA 3OVSA 2ZDOA 3HT3A 3OFFA 3KK2B 2IYGA 3KJVA 2E9RX 3EDRB 3SCJE 3QGIA 4HKQA 4J9RA 5I3QA 2AYMA 4CDIA 2D74B 1T9TA 1KN6A 2MZ1A 1AB8A 3CJ0A 2B6AB 1HBNB 3LF0A 1RWXB 1VBYA 3CJ4A 2KTQA 8ATCB 3QGHA 1R0AB 1BUXA 2RILA 2VG5A 4O23A 1X0FA 1VFJA 1GMUA 3WX8A 3H7HB 1ROFA 1FEHA 2YH1A 1YBAA 2FHOB 4JI8J 5DDPC 3PYFA 3KUEA 4LF9F 3GJRB 3UO0A 2DEIA 3T9ZA 2HHHF 1WC6A 2CA9A 4EYIB 1RCOB 3B6BA 4P75A 3UCZP 2UUCF 4LIWA 1IM6A 1VYAA 2GJ2A 2WBMA 4CH1A 3J80U 2XSJA 2CQ1A 3HSGA 1BC6A 3CCVS 3IM9A 1TVRB 2LEBA 1RKIA 2JLEA 1Q8BA 1YLXA 5T41A 4WE1A 3GJSB 3R2CJ 3J80Y 2XMTA 4MKAA 4X65J 2RRBA 4LRFA 4O3NA 4J9PA 2MQNA 3B4DA 1URNA 1N56A 2DR5A 1U0HA 4UF4A 3K57A 1EKSA 4GKJF 4DV5F 1T11A 1HNXF 3PYEA 2C2DA 5DLFA 4WFAQ 4FS2A 3OTOF 2MDAA 1AUDA 4JV0A 2N82B 2ZZNA 2AKWB 4EBDA 2IMWP 3K5OA 5KFQA 3MCSA 5DDOC 2GJFA 5IT9U 1EQMA 2MKKA 3O3LA 2QIFA 4B9MA 2IDEA 1NKEA 3BF4A 1HQUA 2I5JB 5IT9Y 2R8KA 3IMQJ 2H65B 4CLSA 1TKZA 4G1QB 3X3UA 2X1AA 2V34A 2R7OA 1SJ3P 1HD0A 2XYGB 2GS8A 3MPVA 4IDKA 1HNWJ 4K4ZA 2ZH3A 1D09B 2CQPA 3F41A 1WEZA 5CYMB 2MHNA 4OV1A 2OEKA 5HQMA 1VIXA 4GKKF 2LQ9A 3QATA 3TUJC 1KQSR 2CQHA 3ETMA 1KHWA 3R3TA 1AUSL 3LGMA 2CPEA 3PIOQ 1MWYA 1G2EA 3BM7A 2KJVA 4B9VA 3DOMB 1BQNB 3J7ZT 1ITPA 1NHUA 3KFWX 3KLFB 3M6WA 3ELHA 1RT6B 4L76A 1SBRA 2QG9B 5DZ7A 2FLLA 1TKXA 1RBAA 4O3PA 4I2PB 3RG6A 4DS5A 5DG9A 4B3RF 1RYSA 5ETOA 2X1BA 3CJTA 3MM5A 2J0QD 4FYXB 2EFPA 1CQMA 1HHTP 3HO1A 4J9SA 2A2DA 3D6TB 1FK9B 2F5GA 4UQGA 3NS7B 4KT0C 2AJ2A 2EXUA 4X4RA 2VF3A 1FJCA 4ID5B 1MROA 3VZIA 4EZ9A 1LWFA 2MMYA 3QT8A 3W2VA 2QO3A 1Q95G 2BOPA 4LMZA 2PMZD 3NOCA 4C8YA 4DPYA 5K20B 2CJAA 3WZ0A 4CQ1A 3MR7A 4QWEA 4RNMA 3O5TB 4WKRA 4RW7A 3PKMA 3AAWB 3S8SA 4USMA 2B9EA 2LFVA 1RA7A 1VQSA 1RHQB 1FRKA 2AIRB 4QIGA 2CFXA 1S6PB 2BQUA 2HIYA 4U6PA 1AXQA 2J7WA 2OFGX 3DN9A 4NLWA 1SC3B 4JI6J 2LCWA 1CQNA 1S1VA 5HLFA 2FB0A 4DSLA 3NS5A 4Q5VA 5CH7B 2BX6A 2PD1A 2CKWA 1PJ5A 5ETTA 4M1KA 4KHPF 2E1MC 3NY0A 3N28A 1IR2A 2QL5B 2Q1LA 3VZHA 2B5JA 4DV7F 3ZZPA 1NJIT 3MPUB 3PIPQ 3UN2A 4EBCA 3GYGA 1LWCB 3RAXA 1FI4A 3L4BC 1U2CA 3NCPA 4K2XA 2KM8C 2QFJA 1IBMJ 3QO9A 4PQUA 4M5LA 4ES1A 3CSKA 3VGTA 2Q6BA 2RF2B 2AZ1A 4QU6A 2QMXA 4HHJA 5LT5A 3G6VA 3OXLA 1M5HA 1JJ2R 1WKJA 4AT1B 1VDHA 3PW0A 1YBUA 1UA1A 3UD5A 3E2EA 4DUZF 2F8HA 3ET6A 2VQEJ 3VQTA 1IJEB 2VFVA 1EP4A 2AJ1A 4J9LA 1I3OB 2JLGA 4ED7A 3GV7B 1WG4A 4KSEB 4NCGB 2VD3A 2G0JA 4IH6A 3DLBA 4I6WA 2RDJA 1HMVA 3W9JA 1RTIA 5D4OA 4A8YA 3PM9A 5K8MA 2PC6A 5KFLA 3UR0A 3E51A 4CI0B 2W8LA 3V4MA 1CS4A 1KQFB 4RBTA 1F2GA 4R8UA 4QPTA 4ZP9A 4DZ6A 3LTOA 3ZZOA 4QR2A 3QGGA 5F9NA 2XC9A 1QLNA 4K50A 2ZC4A 3IR5B 4OYXA 5JJBA 1PG5B 3U1LA 3UNGC 5JMNA 2VFSA 5HANA 2KI2A 2X3GA 1L3VA 1CJUA 2MGZB 4OX6A 2OD6A 3GSIA 4KO0A 2WOMA 3PRVA 2XY7A 1FD2A 3SCKE 1WHXA 4J9MA 4KB7A 5J1NA 4DV0F 2B4VA 3KXDA 3HD1A 1JKHA 1YJVA 4K4WA 1K0TA 3VAJA 3PO5A 2VG7A 3W9IA 1IR1A 1YJUA 1AT1B 1ZYQA 1GTEA 1ZETA 3M8YA 3BH6B 5U47A 5GADU 1IWGA 4RBVA 4N47A 4PPZA 1F2HA 1CJTB 3KLIA 3ZNUA 3SQGA 3K2YA 2ZOGA 1U1KA 4DSEA 1JQGA 3MEEB 3M6XA 3QT5A 2DNLA 2ZKUA 4QR0A 2QLXA 2ZNZA 4TVAB 1QAIA 2V5HG 2EBEA 1OQ3A 2N4CA 3KYLA 4G3IA 2HAIA 3V81B 1NJWA 1E6VB 4DF8A 4ZVQB 1S6OA 1IKWB 1EETB 2DH8A 3SQOP 2V69A 1DHMA 1LKZA 4XPEA 2AEMA 1RWOB 2K7JA 2DGUA 1T03A 1N5SA 4JYAF 4DG1B 4U95A 2PDAA 4HT5A 1QSYA 2XQCA 1WF0A 2UUBJ 4I68A 1KLMB 2AJQA 4QW8A 2OKQA 2YKMA 3SDEA 4QPXA 5KTQA 3UD4P 1WF2A 2E44A 2MHEA 1NH7A 3G82B 3CTRA 4AYBD 2VBZA 4LBHA 5MAOA 2ZJPQ 2IDLA 1KFSA 3IR7B 5BR8F 2EG1A 5L9NA 3ILLA 4URGA 2IIHA 4Y34A 1Q81T 4KH1B 4IR1A 4I0WA 4WFZA 3TZZA 4EUVA 4RUBA 1SKRA 1XWLA 4RO0A 1IQZA 2HGNA 2IM0A 2DBBA 1LEOA 4ELVA 5LJ3Y 2LECA 4K8RA 3DLEA 2BJ3A 2HBZB 1NKCA 3BSNA 1LK7A 1ZM4A 2CPHA 5A2QY 2CPDA 4LFAF 2XI3A 3TUZC 2G1HA 3UCGA 3VAFA 1LW2A 2EI5A 2JC0A 3CWJA 3I32A 4OL8A 3QRRA 4B3MF 2PMHA 3MTJA 2IRXA 1Z1ZA 1U8WA 2J9EA 4KFBB 4F7VA 4RW9A 5KT3A 4HLBA 1IKVB 3T3FA 1X0PA 1N32F 5KOWA 2CJ9A 1KBRA 4X4VA 2IM3A 4ILRA 2NS1B 4LJMA 3VVTA 2RDDA 3I96A 4IR9A 2CPYA 2GW8A 2D3UA 3QFHA 4H4KC 4BWJA 2SXLA 2ZDPA 1GNKA 4FNHA 3FCVA 4BCAA 4F4ZA 3RAQA 1JB0C 3KWMA 3FSIA 2LLZA 4M5GA 1VQYA 2CPJA 1VIOA 4PXDA 4DPWA 3KMQA 1PC4A 3BBBA 2F4VJ 3MD1A 4NCAA 4OJ3A 2Y0SD 4DFMA 1VQ4S 3HZEA 3CW2C 1SPBP 4IOAQ 2W01A 2JEGA 1WWHA 3LAKA 1B7YB 4DBQA 3M2RA 3K5NA 2RT3A 1X9MA 3THVA 1NDCA 1RI7A 3CUNA 4MFBA 3MFIA 3LOUA 3A4TA 3GQCA 1FEEA 4UQTA 1WOOA 5D0HA 1TL1A 2B43A 2HNDB 3BZQA 5A8KB 3HLUA 5D0RA 2UVUA 1D1UA 4EO6A 2OPQA 3LWMA 2HGMA 2HPUA 3I87A 2YNHA 2C2ZB 1N52B 4HEA9 1FD8A 2JRSA 5B08A 5J1EB 1EJ7L 5F8GA 1WC5A 3FEYB 5EUHA 4A4JA 3T5JA 2AYEA 2R7SA 1TV6A 4AQYF 1VQPS 2DITA 4K4TA 4Y0FA 1ZM2A 2V50A 3LW5C 3HSZA 2Q66A 1F9HA 3DC2A 4HHHA 1PYOB 2RUGA 4CLLA 3R97A 2Q6CA 4ZCIA 3CMES 2K1RB 3OTCA 4ED1A 3WBZA 2DNKA 2VUGA 3QQCD 2O3DA 4AXIA 3RR8A 2J5AA 4E0DA 1QSLA 2JVOA 4IG0B 2IBOA 5ETPA 3BSOA 2OPSB 3W62A 5HBMB 1FKPA 1EAYC 3T5LA 5I42B 3R5CA 4DV6F 4DX7A 1HKAA 2EW9A 2YWHA 4WFYA 4M94A 3QJJA 4I6AA 1OJ4A 5I3UA 1YWXA 1NB2A 5IOLA 1HNZJ 4CLFA 2F63A 4U96A 1S76D 4FYYB 3S01A 5EGYA 1SKUB 1UWBA 4NA3A 1J5OA 4QYZK 4FF1A 1NK0A 5KT6A 4C98A 1SJQA 1S9EA 3W9HA 2JL9A 4TNOA 4GVBB 5KFOA 1WKKA 3UE2A 1B0TA 3THPA 4FP9A 3FRYA 5DDQC 5GVQA 3WIUA 1S77D 1UTAA 3ILOA 2G9OA 3PEJA 3DOLB 2UV8A 2DGSA 2JLFA 2FGCA 2DGWA 2J0XA 5KG1A 1S1XB 3F44A 1R8CA 3OR2B 3W5ZA 3HD2A 3IAM9 4DV2F 4DQQA 2EFGA 2RHSB 3CCZA 2ZH2A 1VLOA 4GRSA 3HF5A 5K8NA 1X4DA 4DV3F 3MMCA 3VGSA 3C14A 1J27A 3NL0A 3QSIA 4Y2AA 5AJ3J 5CHCB 4DV1J 3BSAA 3C2PA 3M1VB 2KFZA 2MSTA 4NLQA 2MPUA 3MCNA 1M1HA 4RWXA 5GAEI 3FQLA 5FLXU 3J81U 4P74A 4X66J 2HFZA 4LR9A 2V2KA 1WSRA 2WAQD 4WIIA 5DM6Q 1WUUA 2H5IB 2VASA 3DLJA 4X84A 5FLXY 4DQRA 3J81Y 3V4IA 3CCES 4WIQA 3CIZA 3GIMA 3PW2A 4ZDNA 1HI1A 2HSEB 1RUSA 2NXJA 2G2YA 4DR7F 5KFBA 2WONB 3CDEA 3KK2A 2DJWA 4WU3A 2KDOA 3NCQA 4MYUA 2CQDA 2RRAA 1JLBB 2B9YA 5F8NA 2JWNA 1U48A 4LF4J 2KHCA 5SUHA 3TUIC 4P2XA 2DB1A 5DS7A 2B6AA 3DM2B 1HBNA 2DNQA 5EX0A 1GX5A 4LFCF 3LALA 2IY5B 2R7RA 1R0AA 2BQRA 2HNZB 4EU0A 4EYHB 2K8GA 1SKSA 3F56A 3FBFA 5KG2A 3EVMA 1YJWS 1SH3A 1VC6A 3MHYA 4DR4J 1WD6A 4OI3A 1T05B 1MWQA 1ZAVA 3W65A 1RWPB 1Y3KA 1PBAA 2UU9J 1RAAB 2KT5A 5KFGA 3O2IA 4U8VA 3GTYX 1RAEB 2BM1A 2VC0A 1JJHA 4DR1F 4E8UA 2HK2A 3RR7A 1W2BR 1TVRA 5LM7E 2KT2A 1TMMA 4PZVA 4NYOA 1B0PA 1S59A 3QYYA 5E3QA 3KMSA 1D9AA 2W7AA 3ZXWA 3DI6B 2QGFB 4Y00A 2R9LA 5AE2A 5CCMA 4DUTA 1X8DA 1ICEB 2L41A 4NA1A 3Q8YA 3MMJA 4OLOA 2HWTA 4J9OA 3NKYA 4A8WA 4LRBA 1FXLA 4J9QA 4C3MA 4FXVA 4LSZB 2NPFA 5DQGA 2MY7A 3MM9B 2KZZA 3G6ES 1JNZB 5HL7Q 3D54A 2WW4A 2K3IA 1R89A 4ZJQA 4F3QA 4KTQA 4ZITA 2VC1A 2I5JA 3CDAA 4IOCQ 4EFAC 4PG8A 3D7SB 4G1QA 3G6YA 3ZTRA 4UY8T 4P7TA 2XGPA 3MOJB 6AT1B 4O4GB 2QTWA 2J9CA 4TY9A 4FDFA 4QYRA 1RTHB 1U1LA 4ZVEA 3FFIB 1VRUB 5B0EA 3R6LB 3U7JA 2XTJP 5CYMA 4B02A 4EI2A 2MZQA 2XY5A 3NRBA 2DNMA 1K9MT 1UFKA 3HX9A 3HM9A 4YHHF 3Q8RB 3FK4A 4HT7A 3BO4A 1HLWA 2ZOMA 1O6XA 2HLTA 1ZTWA 5F0UA 2FC9A 4A8MP 2HNYB 2IVMA 3P6YC 4WP3A 1C1CB 5HO4A 3BS9A 3C3LA 2XO6A 4L6V3 3DOMA 4FBUA 1IVZA 5DGAA 3IXQA 1BQNA 2AEFA 2UXDF 2JFKA 3KLFA 1PGZA 3R27A 2VB6A 1RT6A 1WHYA 3JSMA 1R8HA 2PGCA 3R1LA 4PKDB 4NZ6A 5GAHU 5SZTA 2RD5C 3RJMB 3R9LA 2H5EA 4O3OA 2E9ZA 3J7YU 4OI2A 2D3ZA 1TL7B 2UUAJ 4V19X 4F25A 1A6LA 3M8WA 2CJQA 5B0AA 1LNQA 3Q23A 4MMOA 2XLIA 1CPZA 4DR6F 2V8VA 4YDXA 9ATCB 3TJ9A 2BKOA 3HVTB 2NXEA 3VAIA 1FK9A 1S10A 2Z58B 2W2NP 2W2PP 2KG1A 2HK3A 3HJFA 4I6YA 3L3CA 3B82A 3AQOA 1FKOB 3G8SA 4ID5A 1H7WA 2E5LJ 2PT0A 3M8PB 4PXCA 3HKWA 2KKHA 1FJEB 4PABA 2I6WA 5E7OB 2EC0A 3HHNB 2NREA 5L1KA 4DPXA 2UP1A 2MKJA 3DLKB 5A8RB 2GNKA 4X4NA 3VQSA 3H2LA 4LSLB 2ZM6J 2UUTA 1FE4A 2DGOA 2CNKB 4WP9A 4H4OB 1S6PA 3PHTA 2FJAB 1T95A 4KGZB 3K8WA 1APSA 3BO2A 1S6QB 2ROPA 1KWMA 1I94J 1YJ9S 1U47A 5M2UA 3W61A 1M5KC 5HVGA 2B7BB 4O3RA 1VC0A 3DHXA 3D1OA 4JP8A 2BEFA 1XERA 4FXWA 4K0KF 3I6PA 5DLGA 2XS5A 4WK1A 2YKOA 4LREA 4U9RA 4CCHA 1NB7A 2QLBB 1AFIA 4ZLLA 2CVIA 1Q8KA 2R2TA 3MR3A 4L74A 1LWCA 2BE9B 4C8OA 1X4EA 2L9NA 4DLGA 3NWRA 1XQIA 3D66A 3D0HE 1NNDA 2NPIA 1DQ9A 5JVGQ 4M5JA 4DSJA 2W2MP 4DL4A 2C2MB 4PUOB 4WZMA 3CJKA 4FXDA 1YKWA 4DJBA 3EVWA 3DMJB 1HR0J 3Q0AA 3QZ7A 4FPRA 1KONA 2HKEA 4ECUA 2OPRB 3UDEA 4NCGA 4PPDA 4K4SA 5KG7A 4JV1A 1H6KX 1Y9OA 3VR1A 1GXLA 2C22A 4HR2A 3IBFB 2P6TA 4DPTA 3M7VA 4UUXA 2CVEA 4EWTA 3MWBA 4WKYA 4Q2LA 4ZPVR 1RT2B 1SVDA 3LUYA 4NLRA 1VBXA 3D67A 3C16B 5K8PA 1IXKA 1K8AT 4CT8A 4MH8A 4UOHA 1C0UB 3TVYA 3IAS9 2MGZA 4LFBJ 3QWUA 4NZ7A 5THWA 1S57A 1VK3A 3HSDA 4H4KA 3EPGA 2DXDA 5KFVA 2BM0A 3E01B 1XNQJ 1EHWA 5J2MB 3PTWA 1NSKL 2AX0A 4PR6A 1RAJA 2GGPA 2Y1JA 1VQ5S 4F0KA 1WKLA 2MKCA 3UW1A 4EO8A 1LXJA 4WJBA 3UCUP 5LSOA 2ZVSA 4WZQA 4F2RA 4QU7A 1JJCB 2O66A 4P2FA 3NG8A 4FYWB 3OTDA 3ZTQA 1EIYB 4C8ZA 1CJTA 3BEGB 3MEEA 3CCTA 3IWLA 1Q8IA 2IJNA 2RS8A 4DXLA 2MQQA 5CD4A 5IT4A 5CYQB 3W3SA 3A1YG 2PI4A 4YEAA 5G0RB 3C6TB 1TUWA 1U1QA 5JVHQ 3V81A 1VQMS 1P8GA 2JJ4D 1E6VA 1D9FA 4DPUA 1F0XA 4JI8F 3GFZA 1IKWA 1EETA 2V2QA 3KOAA 3IRWP 4MK9A 4Y2CA 4NLPA 4MK8A 2YXLA 3MM8B 4M5HA 5KFCA 4DG1A 1FTCA 3AB2B 1RE1B 3R1HA 4KHMA 4QIEA 1KLMA 3LP2B 5KFAA 1JLCB 2GMHA 1CVJA 3DGPB 3UN3A 3OLAA 4F4AA 3CIMA 3Q22A 5B0GA 1F6TA 5KG6A 1XJWB 3FCHA 3G82A 2HHXA 1W26A 2ROGA 4USHA 2IM1A 2FLPA 2NCKL 5AXNA 3CCUS 2Z2MA 3N9UC 2HS0A 3IA0A 1K1SA 4M5DB 3CO0P 3IRXB 3DU6A 1PKUA 3GV8B 2RDIA 3THTA 3CGIA 1ZH5A 2B3TB 3OL9A 3DYAB 5C25B 1S4FA 3KNGA 2J8SA 1RT4B 4XDCA 1CJVB 3GSDA 3D3BJ 1GXUA 4LQ3A 1AA1B 4CT9A 2PI5A 5F3ZA 2MY8A 3VGVA 4H4MB 1V5IB 4N8OA 3MM7B 2WSEC 5J1PA 1FHTA 4Y2MA 1V3RA 4CLZA 5LSLA 2WVCA 1VI7A 4KFBA 2HZCA 3BPDA 3AJ2A 1IKVA 3UN5A 4WYWA 3MZIA 4X4QA 4ZPDA 4X64J 3AHPA 4Y2KA 4B9SA 5F3TA 5FDLB 1FRHA 3K58A 3DRRB 4CO2A 4KE5A 3TA2A 2EK1A 4FYDA 1O51A 4IG3B 2Y1LB 1QAYA 3W8GA 5CCLA 3D9BA 1QUVA 4DHVA 3MDFA 9RUBA 3BQ2A 1S12A 2DHHA 2FVRA 1SKWA 1AFJA 3OFHA 2MZSA 3DXBA 4M5IA 3K5MA 3RW6A 1UJ4A 7FD1A 5HMZA 1FWKA 4NLXA 3OBIA 3R7NB 1RWVB 2DKOB 4YB6A 3GMGA 3T1HF 4B3TJ 3A3PB 2HNDA 1FWLA 2PEBA 3FMWA 5A8KA 2BUNA 3QO9B 4M5NA 4ED6A 3L9ZA 3BGFA 3VAHA 5E3AA 3C6UB 5KFXA 1XIQA 3UPFA 2X1GA 1F1BB 3FC9A 1W7WA 4GC6A 3SMZA 4DPOA 2VU5A 1CC8A 2G1DA 3CT9A 1FWPA 1YDLA 2VJUA 4ZHRB 1XMBA 1NPPA 2ZBRA 2BOAA 2LKZA 1VJQA 2DR9A 1VHFA 4OIXA 2R7WA 1U49A 1TFYA 6FDRA 2B4UA 2OP5A 5IXUA 5KFPA 2G2ZA 1FKAF 2D7SA 1QTMA 1CS4B 1FTRA 2K1RA 1CC7A 1XNRJ 1Y5IB 2DNHA 2PFDA 2H4WB 1N5TA 1F5CA 5J2PB 5B7WA 5KG3A 3CD6S 4HDGA 2HWHA 5AE3A 3ZFVA 4MKBA 5H1SV 4IG0A 5EWFA 4OYIA 2OPSA 1O0PA 3H42A 5HBMA 3Q2TC 4JI6F 1R3NA 5I42A 4LF9J 4D3HA 2XMAA 2QA1A 3GB0A 1Y5LB 3Q89A 4MAKA 1U02A 4ETZA 1SJ1A 1IKYB 5D77A 2I8EA 1NK4A 3LP1B 3R5JB 1D8ZA 2UUCJ 3CD0A 4Q7AA 2V0NA 3E8OA 3SSSA 2AJFE 2NZCA 1NJZA 1TK0A 2R7XA 1TKTB 3QPIA 2ZD1B 2ABYA 4IO9Q 3K17A 2HVIA 1MMNA 3HHDA 1VQOS 2CDQA 2JZ5A 4GVBA 1IBMF 2C1EB 1J2VA 4IUFA 2W24A 2GQQA 1UPPA 1UFWA 4WF9Q 2E7XA 4NRTA 1DARA 4LF1A 2MQ8A 4ZLNA 3PJXA 3DOLA 1VMBA 1S0NA 4GO5X 4C7QA 3BYPA 1VQ8S 3LQVA 3TEGA 2VQEF 1S1XA 1BQXA 2VPXB 3OR2A 5C24B 3D0GE 4DR5F 2P5VA 1YVFA 3BGLA 3TAQA 3CF5Q 2A6MA 3JTPA 2GAGC 2WW8A 1VJWA 2HS4A 5DDRC 2KXHA 1OYDA 3PYDA 4Q45A 4NASA 3KLHB 3M1VA 1LOUA 2GHPA 2HBRB 2VV5A 3C66A 4IRCA 3CEDA 2M5YA 4N77A 1M5VC 5IS2A 1Z4UA 1YJ7A 2QLWA 3AJDA 1I6JA 4DDFA 3NP5A 1R8PA 4JI0J 2DRDA 2GA7A 2WONA 1X31C 2AYBA 1OSCA 2B51A 5IFMA 2UXBJ 5GMDA 1JLBA 2MB0B 5KT7A 4OHZA 1DY3A 3R5BA 4DU7A 3RU0A 2JH3A 3SV3A 5F8JA 1P6TA 3DM2A 4Y6IA 4NLUA 3PACA 1R7IA 1FF2A 4ZA1A 3DLLQ 1QUPA 2HNZA 3FCWA 2MZJA 4LBPA 5HATA 4UT4A 4EZ6A 3RAMA 1TMJA 4B3RJ 1WNEA 2R8HA 2FJXA 3G87A 3HK2A 2DD8S 3PR4A 2FY1A 2I38A 1Q7LB 4F2SA 3BPSP 2X1FA 3KHRA 1HQ2A 4J5OA 4F8RA 3PR5B 2M8HA 2IFXA 4HHUA 1T05A 2RKIB 4JB8B 5F9LA 3C19A 5DZ6A 4DR2J 5KFKA 4Q8EA 2BXJA 2H1YA 2IVYA 4RW4B 2F8EX 3MUMP 2XM3A 2M9KA 2LQ8A 2C2OB 3LH2S 3UFCX 3ZTOA 1GK8A 2UUBF 1B64A 3DI6A 4NPOA 5T7LB 3MECB 2DNGA 1VOMA 1NHVA 1NH8A 3KLGB 2Y1IA 3LP0B 2BMBA 2XMUA 4I2QB 5J2QB 1BE4A 5D15A 1M0SA 2KVIA 4F04B 2PMWA 4L73A 2UVRA 2B8QA 2LXUA 3PNIA 3I56S 3NLCA 3ISZA 5ETSA 4NE9C 3POTB 2NUHA 3MM9A 3BDEA 1NXIA 1RHUB 3UDCA 1Q53A 2Y1RI 3SEOA 1OIAA 1OO0B 3PFEA 2LXFA 1M90T 1S97A 1WORA 2NXNA 2DPJA 3IWXA 1N4LA 2GQ2A 5DGBA 1NSPA 2HRUA 2JEFA 4LVOP 4O4GA 4USWA 3TX8A 3RBZA 2J0SD 3JSYA 2DIVA 1RTHA 1LWXA 4LQ9A 2WCXA 3FFIA 1VRUA 2FJVA 3IM8A 3MR6A 3TZXA 1JLAB 4TN2A 4NLDA 2E5HA 1T94A 3PX6A 1N54B 4BC7A 3HVRA 1RBLA 2QEXS 2VONA 4Q2MA 1WACA 3LO3A 4L75A 3TAPA 4IH5A 2CAJA 5C2GA 1PCAA 1SQGA 4FF2A 4HI1A 3SYZA 3CD5A 2LMIA 2HNYA 3D6FB 4DX6A 2ZZTA 3HHEA 4X4PA 3OUYB 1C1CA 2MZTA 5DJBA 4ICLB 4CTAB 2F4VF 1T9VA 1VQLS 3SZ2A 2AX1A 1YHQS 3PJWA 2VKRA 2RU9A 3QFWA 4DCOB 4DCPB 1DTTB 4USVA 2RH3A 4J9NA 4TU8A 2AJ4A 1FJGF 4I1TA 5HSPA 2W4DA 4TLRA 4I69A 1TL7A 4Q44A 1MSWD 2D9PA 3ZZTA 1RTJB 3GONA 3TANA 1UZHA 3BR9A 4ZJLA 5DG8A 5KFZA 4ES2A 3R6GB 4USKA 3HVTA 2BBEA 2QE5A 2M8DB 1N0VC 1RWNB 2NSCA 1FKOA 5L46A 4PWWA 4DV0J 1V6HA 3M8PA 4O0IA 1S7HA 4C11B 4IFVB 2BVZA 4C9DA 2K7KA 1REVA 1S6UA 2KYXA 3T1AA 3DLKA 5A8RA 5BYSA 3EGNA 4ED8A 4X4UA 4F4WA 4F4KA 3C14B 3C46A 4LSLA 1CG2A 4C2MA 2ZBPA 3Q2SC 3MEDA 3DFEA 1E6YB 1BWVA 4K5SA 4USTA 4P7VA 1RU2A 2IAJB 4H4OA 1HWLA 2L3MA 1C0TB 4ZPTR 3NOGA 3P5TL 4NXMJ 1S6QA 2F40A 2DO4A 3UVJB 5KFFA 4WFNQ 4KY3A 2HMIB 4WYLA 3VAKA 3TQEA 2BACA 2H54B 3I0SB 2DPIA 5DQHA 3HCXA 3AODA 2J9DA 1IKXB 1WHVA 2OAUA 2VQFJ 3EUNA 3IWNC 1GTHA 4ENOA 1HNZF 2V2VA 5FD1A 3G4SS 3PV8A 4OMFG 3TQ1A 1HYSB 3GPAA 3IBWA 1HHSA 1GX6A 2WB4A 3TZWA 3PEHA 1RXOB 2P8IA 3FMBA 3WHIA 4NYZA 5RUBA 4C8MA 1O5JA 2HZAA 1VK8A 1IQTA 1ZA1B 2C3UA 4QWAA 4X62J 4PUOA 3GR0A 4Q0BB 5BR8J 3Q86A 2HVHA 3OHAA 5G4DA 4Y2IA 4G6VB 3NS6A 3DMJA 3GZ7A 1F9FA 3OSNA 1U0SA 2OPRA 4RL1A 4TU9A 3OVAA 4XIUA 2I2YA 2DY1A 4C97A 2M0GB 4HTIA 3V5RA 3B8HA 2HFSA 5KG0A 1ULRA 4FVMA 1H98A 4OV6A 3Q24A 2XMJA 2MKIA 1RT3A 4U7UD 1HI0P 1R8AA 1ZAXA 3W1YC 3KJFB 2W9CB 1JNRB 3DOKB 2AV5A 3KG0A 2M70A 2B4OA 5GAGU 2WHOA 2EFNA 1RT2A 3C16A 1X7VA 1B4SA 5AJ3F 4O4RA 4TU7A 4DV1F 4B3MJ 4RW8B 2B0GA 1N34J 1TUGB 2HRYA 2IVFB 1C0UA 1JLFB 5K5MA 1N32J 4X66F 2R2UA 3GCWP 3QIPA 2FJWA 3A3OB 5EHHA 2CG4A 3K5LA 3W7BA 2EG2A 3MEGB 3QLHB 4ED3A 2E1AA 2P9EA 4JBCA 2VODA 2F4FA 3E01A 2VBYA 2Z2LA 2Z0GA 2KG0A 1GAOA 2UVWA 5J2MA 2BW2A 2F1FA 3O8WA 4BC9A 1S1TB 4CH0S 2J6UA 1UEKA 3N6LA 4B17A 4LF5J 4X4TA 4DV4F 2R2SA 2DNNA 3TX0A 4LF4F 1SL0A 3MPDA 1IWAA 2ATCB 4LF7F 2DGXA 1P27B 2RQCA 2DISA 4BLGA 2GC8A 3ZTSA 3I55S 2BYCA 4TXSA 1UJ6A 4RNHA 2MQLA 2B4PA 3CDUA 2HQCA 5GMKa 1N88A 3EGVA 5CYQA 1VLYA 5G0RA 3C6TA 2DT9A 2Z2YB 1H2VZ 2MZRA 4Z2XA 3AT1B 1OY8A 2FDNA 2ZUAA 3K89A 2AP6A 4KGMA 2B56A 2BE2B 5LL6d 4DR4F 1C4CA 2NXUA 2IA6A 2RUSA 5EN1A 2XI2A 1FJ7A 3MM8A 2E5GA 2UU9F 2HS3A 4LRAA 2HFVA 2ZE2B 3TVKA 2D9OA 3GE9A 3WIVA 3OD2A 1MLAA 3LP2A 4OJ1A 1JLCA 3M2VB 3DGPA 4QYZJ 1QDUB 4M5MA 2HW3A 3HFKA 4UUWA 2DO0A 3H5SA 3T6JA 3JSMB 2OMLA 4MT1A 2GO8A 1NCLA 1SCJB 1SH0A 2QMUB 2YBVA 1RHRB 2ZOFA 1FVSA 4M5DA 3VALA 3EX7B 3HDSA 3IRXA 4ILMA 3F73A 2E7VA 2WSFC 1VS3A 2ZC3A 3CMAS 1PYTA 4WXWA 3JB9k 2HVZA 3S7RA 3DYAA 5A76A 3MFHA 5C25A 3WX4A 4DV6J 1RT4A 2X51A 1MNEA 1CJVA 5K9FA 3CCSS 1YJTA 2DNPA 1U1MA 2DHAA 1JLEB 5EX3A 4YY3J 5ETNA 1ZTTA 2KJWA 1URRA 4AUKA 4H4MA 3H59A 3MM7A 2Z8QA 4ZIVA 5HVHA 1KC8T 3B78A 1ZA2B 1TQLA 5LOQA 4EEYA 1RT5B 3BKTA 1GXTA 2CQBA 1EB0A 2G13A 2E9TA 2CZ4A 4K59A 1FO1A 2DXFA 2AWZA 3CC7S 2R8JA 5FDLA 3AFGA 3DRRA 2OMOA 1MN9A 4XK8C 2GJIA 1HBMB 2NSBA 1X9SA 2ALYB 5F8MA 2E1PA 1SIWB 3KG1A 4IG3A 4CLTA 3H2VE 1C4AA 2XMMA 5E0OA 4C0HA 5LJ5Y 3A12A 3CCWA 4N41A 2GMJA 3BBCA 1KNZA 2XGQA 4USIA 1BY9A 2ZH9A 2ATLA 4RU2A 1Q5YA 4V1Ak 3RB0A 4K2JA 3DDNA 4CZCA 3JYTB 3DRXA 2QA2A 3HMJG 1HWKA 2VICA 3W5YA 2VKZG 5HJXA 3MCMA 2KXNB 4QWDA 1RWWB 2YQ0A 3H0PA 2NQPA 2H51B 4UW2A 1ZZNA 3CCMS 1UKUA 4ECTA 4G1IA 1WI8A 4J9KA 3C6UA 1RADB 4CM0A 4N76A 4ERDA 3A8KA 2G2OA 1UPMB 2QC3A 3CJKB 2I1RA 5ITHA 1B0VA 2FVCA 2BKNA 4J9VA 2P6SA 5HN0A 5EWGA 4L3NA 1LW0B 3SXLA 1XN9A 2V68A 4ZHRA 5C42B 2N4DA 1YX2A 2J7UA 4KC5A 1T3NA 1HA1A 1R27B 2E5LF 2FGOA 3MMBB 3I5BA 3HULA 2RE1A 1S49A 2N3OA 4LF8J 3K59A 4YB7A 4QWBA 1G3OA 5CA5A 4E2FB 1NK5A 4RPFA 4KHRA 5BXIA 4W92B 2FHJA 3BH7B 2ILYA 4RX6A 3CJQA 3HT0A 2ZM6F 5DRKA 3GIIA 3CDWA 3N01A 5J2PA 3NGSA 3I0RB 1PAUB 3NGDA 5MLCV 2UZAA 4P52A 4ZK7M 1N36J 2YVSA 1U8SA 3VHQA 1I94F 1XEZA 4PG4A 3FNNA 3D2WA 3H20A 1UZDA 1SQEA 3PYGA 4PYDA 4ED4A 3JS9A 1IKYA 4OQJA 5B0CA 3LP1A 4KBIA 2JDJA 3TYTA 4RLEA 1JK9B 4JI7F 2CQGA 3DGVA 2GGPB 2XG8A 4RU9A 2AW0A 2AD9A 5HAOA 4RNFA 1TKTA 1IUJA 3CCRS 2LA4A 2ZD1A 3CC4S 1HQEB 4ZPAA 1IN0A 2EK6A 1N5YA 3KNAA 5KFMA 3H25A 2WTFA 4URQU 3OJSA 3IP0A 4UOFA 4DFPA 3M9NB 4FPIA 1MWZA 2YWGA 4EK2A 4RKUC 4X4SA 1RJJA 3OR1B 3Q8PB 2IJRA 4N5SA 1WF1A 3E3XA 5IWAF 5KFEA 4DS4A 1EZZB 4B9NA 1S99A 3CJ8A 4B9TA 4ZVSB 4IQXA 3MGJA 1H3DA 4LIRA 4CYUB 3A8EA 1HR0F 2QLFB 1ZM9A 3D4JA 5C24A 2QA4S 2OFHX 2OH2A 4I64A 2VG6B 4LRCA 4OYPA 3T9NA 1Q5VA 4X2BA 1NU4A 4ZN3A 5CQGA 1NDLA 2ACMA 1TAQA 2IHR1 2QX0A 1Q8LA 2LDYA 1X4GA 1IR0A 2EFOA 1WEXA 3KLHA 5CAAA 3J7Z5 3H98A 1W2IA 1VISA 3IGVA 2JFDA 2YNFB 3BKFA 3R8YA 3A3NB 4J91A 2IA0A 3CMQA 1M1KT 2HGLA 2Q3PA 4LFBF 3GCXP 4LR7A 2O1PA 1FFGB 1VBKA 4KH0B 2ZH8A 1SC4B 5L1JA 3RBDA 3QT7A 1L3TA 4RJVA 2VA3A 1LWEB 3KJNB 3X1LB 1XNQF 1P1TA 2XY6A 4F4YA 4DR3F 4PG5A 1SJ4P 2AZ3A 5JUMA 1G6BA 1NBEB 1S1WB 1JIHA 5LXYA 2YQ3A 3ISNC 1DRZA 1JLGB 1NLKL 1VR6A 2UXDJ 5HQ8A 3BN4A 3EMTA 4QIVA 4QWCA 2CNNB 1MG7A 3H5YA 2KL8A 2AT1B 3P5BP 1BMQB 1N6QB 4QIWD 3M30B 2APOA 1HBUA 3KHGA 3KLEB 2KHDA 2KFNA 2LP4A 1MU2B 4OHVA 3ILIA 3G71S 2AGQA 3JQJA 2RKIA 1C2PA 5KT5A 2CJBA 1U7LA 1LXNA 4KAIA 2ILZA 1G7CB 4OX9J 2GO9A 3MUTP 3ZZUA 1IBLF 5AE1A 1HFEL 2BKPA 3G8TA 4RW4A 2RNEA 4MIBA 3U02A 3DRSB 1UJ5A 4CRJA 4FZVA 4PQAA 3VV2B 5T7LA 3MECA 1JXVA 2ZNYA 4WPAA 2XMWA 4OX7A 4HACB 1Y7PA 4PG7A 3KLGA 1R6VA 2W7PA 2A3JA 1D3WA 2C2NA 3SFGA 3LP0A 1BQMB 3AJ1A 4R0EA 2MQPA 1X5SA 4I2QA 1UVLA 5J2QA 3RB3A 3SCLE 2XEXA 1FXRA 1KHVA 3CVKA 2M3DA 4FVCA 4DL7A 2DGVA 3PRDA 3L7OA 3DHWC 5DQIA 1CJKB 3A8JA 3POTA 3BBFA 1OPZA 5AXMA 4I56A 4W90B 5HROB 1RWMB 3HZGA 4TYBA 1QTNB 2HFUA 4KGKA 5ETRA 5D4NA 2I0XA 4R5PB 2YNIB 1Q78A 3HPOA 3EZOA 1Y11A 2FUG9 2OPPB 1XTZA 3TO8A 4DL5A 3TVZA 1AYEA 4YS2A 2R7TA 2OHDA 4ZVUB 4W98A 3NAHA 4ECXA 3IC1A 3AB4B 2YQ1A 3W63A 5BYQA 3CO9A 4LVNP 1JLAA 1CEZA 2M4MA 2N3LA 4O3QA 3NMAA 2FC8A 3ZO7A 5CZVA 1FXDA 4I7FB 3WC2A 2PSZA 4OZ0A 1UVNA 4S0MA 2FYXA 5HI7A 2QRRA 3RTVA 2MYFA 5LMUJ 1TR0A 2FPHX 3MTKA 2H9ZA 3DCAA 3OUYA 2YPYA 4ICLA 4CTAA 3M6VA 3GYXB 1WSVA 3RGIA 4F36A 1S0MA 1H0HB 3R5GA 3MUVP 1XR5A 2AGOA 1DTTA 1HW9A 4IRKA 4USUA 2MQMA 2F9DA 3H2UB 3CCJS 2VL1A 2LU1A 3NGRA 4CO3A 3GV5B 2AF6A 1Z2ZA 2DR8A 1JJ4A 3RRGA 4B3SJ 3V6DB 1RTJA 3KK1B 2WRMA 3OTEA 3OFEA 4JI3J 5CD4H 2DEJA 2HQGA 5C5JA 4BS2A 5KFRA 5F8IA 3SI8A 3C8YA 2IM2A 2FHKA 3FBCA 4N7TA 2HZVA 1YG0A 1XMOJ 2GVZB 3QMQA 3J7AN 1HI8A 1WC4A 2KFYA 5LMNF 3PZPA 1HWJA 3PKYA 2L48A 3BR8A 1ZOTA 4C11A 3FDSA 4IFVA 3FSYA 4NRUA 1C1BB 2KH9A 4KR0B 1H2UX 3T41A 4ED0A 3VWSA 1K1QA 2HFNA 3OLBA 1BHNA 1JLQB 3RBEA 2R8IA 4JV5J 1WG1A 4ED2A 3MM6B 1HBOB 1E6YA 2BZ2A 4NXNF 1FESA 2MKSA 2EEYA 3TI0A 2FVSA 4JUZA 2DCUB 2IAJA 1XNRF 2C2RA 4Q43A 1TUVA 4O3SA 1C0TA 3KUGA 5ETMA 3I9V9 2N7YA 1HARA 2W2OP 4P72A 3OL6A 4JI4F 1S9GA 1HNVB 1PSDA 4O44B 3UVJA 1PBUA 2HMIA 1R43A 1TKDA 5H9FJ 3I0SA 2LU2A 3G2XA 1AROP 1NK9A 4CWBA 2CQ4A 1IKXA 3VCDA 1F5BA 4QR1A 4OYOA 2Y8YA 2LEAA 4JI1F 5ADZA 3DDKA 3TNVA 1HYSA 1L5UA 3VAMA 2YKNB 2FJDB 3WC0A 2V9KA 4H54A 4P9SA 2CQ2A 2DIUA 1YRTA 4A47A 5L38A 2J6TA 4NEZA 5F8HA 5KT2A 3S6EA 4ECRA 4QBUA 3D68A 4Q0BA 1FDAA 2HG4A 1BGXT 1T02A 1S9FA 4NA2A 2GX8A 2CXEA 3CJRA 3GR1A 3FEZA 2JEIA 2QV6A 1OPIA 1RHJB 4ID8A 5HVFA 4LT6A 4KKOB 5EWEA 4U67Q 1H7XA 3CJ5A 1OMSA 2W9CA 2DCLA 3J81j 2FJEB 2ZEJA 3DOKA 3T6BA 3QSYB 2RS2A 5D6GA 1SL2A 2QFIA 5I4MA 5LSRA 4XAKA 1AZSB 1UVMA 1X5PA 2CIMA 2B8PA 2M2BA 4N8NA 2CJYB 3EM1A 2MLYA 2ZITA 4ZVPB 4RW8A 1T9YA 1U2FA 1TL3B 4JOUA 5F8LA 3GG1A 1JLFA 4FNIA 2KM8B 2KT3A 3G9CA 1WDDA 1KR4A 5GAEU 1SI9A 2BJDA 3MEGA 3MCOA 3QLHA 1KLNA 1TTHB 3ENWA 3IG1B 1WJ9A 2HQDA 2HHUA 2Y0BB 1TP7A 2EFQA 3L95X 4YR0A 4JI0F 1S1TA 2DXEA 2ASJA 1DTQB 1PIEA 4N56A 3PO4A 2LEPA 2UXBF 2LQ5A 1X4CA 3CD7A 5E5NA 1K0VA 1YBTA 1T7PA 1QJHA 3ZZYA 2XZTB 3M8ZA 2RB7A 2DRAA 2CQIA 2H4YB 1ZBTA 1JMTA 1RLDA 3H90A 2WVEA 3ZZ0A 3UR3C 2V94A 1U45A 4ECYA 2XB2D 3T1HJ 4FKXA 3JSBA 2EC2A 2LQBA 3Q83A 3JTNA 3OXGA 2FY8A 2ZHBA 4DSKA 2DYAA 3US5A 1BXNA 5A0YB 2DH9A 1V9OA 2XMKA 1LFWA 2BE2A 1ZAWA 1RLCL 1PC5A 2FVQA 1NZ8A 4TQSA 4CNYA 1S4EA 4CP5A 2DGQA 4C48A 2GAHC 1N5QA 4OHWA 3QIDA 1J5EJ 4DR2F 4HYKA 5C7PA 2ZE2A 2H48B 7FDRA 2VA2A 5AT1B 1U6FA 4A48A 1T8EA 1Y4ZB 4ZJOA 3M2VA
chains in the Genus database with same CATH topology
3LWMA 5KFUA 1RTHA 2HGMA 2ZJRQ 3L09A 4LQ9A 3HHLB 1JX4A 2HPUA 2WCXA 3I87A 3FFIA 1VRUA 2FJVA 1SJRA 1T3OA 2YNHA 3MR6A 3QJLA 4HVZA 1U09A 1JLAB 4TN2A 1N52B 4HEA9 1SUQA 3BGUA 4NLDA 1FD8A 2JRSA 2E5HA 5K14A 1T94A 5B08A 5J1EB 1DLOB 5F8GA 5J2NA 3OW2R 2B5JB 2GQCA 4AE5A 1N8RT 3FEYB 5EUHA 2W9BB 3PX6A 1N54B 4A4JA 3RYLA 3T5JA 1NRKA 4BC7A 2AYEA 2R7SA 1KVJA 3HVRA 1Z2LA 2QEXS 1TV6A 2A10A 4AQYF 4Q2MA 1VQPS 3UDLA 1WACA 3LO3A 2FLNA 2VONA 1FT8A 3DLGA 3KK3B 1FVQA 1SV5B 3TAPA 4IH5A 1ZZFA 2DITA 5HMWA 4Y0FA 4K4TA 4IH7A 1ZM2A 5A6WA 3LW5C 4FF2A 2PFFB 3CPWR 3EXYA 4HI1A 3SYZA 3CD5A 2Q66A 4IO1A 2LMIA 2HNYA 2J6SA 3HHEA 3HVWA 4X4PA 3DC2A 3KTQA 3L7PA 1D9DA 3OUYB 1C1CA 4PQUB 2RUGA 2MZTA 2MJUA 2YWFA 4ICLB 5DJBA 4CTAB 2F4VF 2Q6CA 1NEEA 1UVJA 1TK5A 1VQLS 3CJ2A 4ZCIA 3SZ2A 2AX1A 1V3SA 1YHQS 2DR7A 1NK7A 3PJWA 5KG5A 4QCLA 3CMES 1MW7A 1UETA 2K1RB 2RU9A 2VKRA 2W25A 4CIOA 1JLEA 4BBYA 4R0JA 3OTCA 4HDHA 4ED1A 4QIFA 3WBZA 2DNKA 1U1RA 4RNNA 1DTTB 2RH3A 4J9NA 2VUGA 1XBWA 3U27A 5J1EA 4TU8A 3NGKA 2O3DA 2ZH7A 1M5PC 2AJ4A 1U4BA 4AXIA 1FJGF 1EP4B 3RR8A 5L8RC 4I1TA 4U7CA 2W4CA 1J5EF 2J5AA 1RT5A 4E0DA 2O01C 2W4DA 5GADI 1HPZB 1REVB 1QSLA 4TLRA 3ZZRA 3HXMA 1GT8A 5IZHA 2JVOA 4IG0B 4RW6A 2V4QA 4I69A 3FJ2A 2IBOA 3BSOA 2OPSB 4Q44A 2YX4A 4B3OB 4OZLA 1MSWD 3PRBA 2D9PA 5HBMB 2Q79A 2VPYB 1FKPA 1ZPVA 1HMVB 2YNGB 3SFUA 3T5LA 2IC3B 4ZP8A 1RTIB 1RTJB 1SH2A 2DHSA 3TP2A 4A46A 3ZZTA 4DEZA 5A8WA 1YJNS 5I42B 4EBEA 3R5CA 4DV6F 1TAUA 3TANA 3BR9A 1HD1A 5DG8A 1Q1KA 5KFZA 2EW9A 2YWHA 5F41A 3MEDB 2ZBCA 4ES2A 2N7CA 1GH8A 4WFYA 3N6NA 4M94A 3QJJA 2KB2A 2RJZA 3M32B 4I6AA 2KN4A 3KG4A 3GIJA 5I3UA 4I67A 3HVTA 4ZVGA 4OX8A 1YWXA 2BBEA 3FSXA 1HBMA 3M6UA 2QE5A 2FHJD 2M8DB 1N0VC 4R8UB 3G6XA 3RB4A 2NSCA 4ZPWR 1S76D 1FRMA 3S01A 1FKOA 2A2CA 1ZM3A 5EGYA 3PX4A 5E3PA 4C8KA 1FERA 1V6HA 3D1HA 3M8PA 4YQWA 5KFSA 1UWBA 4NA3A 4O0IA 3ITHB 3U1NA 1S7HA 4C11B 4IFVB 2BVZA 2PIIA 1J5OA 4CO1A 1BLUA 2UUAF 2MQOA 3M8RA 4C9DA 2VFTA 2KXFA 4OZ1A 4FF1A 2K7KA 1N0UA 3U1MA 1NK0A 4FF4A 1REVA 1S6UA 4C98A 5KT6A 1SJQA 2KYXA 2I9SA 3T1AA 3DLKA 1YIJS 5A8RA 5T14A 1S9EA 2JL9A 5BYSA 3OXFA 1Y3JA 4TNOA 5KFOA 3OHBA 4B3OA 3UE2A 3EGNA 1B0TA 4ED8A 2YNGA 3UD3P 3IN5A 3THPA 1BD6A 4CO0A 4X4UA 4FP9A 4F4WA 1F5AA 4F4KA 3FRYA 1FE0A 5DDQC 1HL6A 3C46A 4LSLA 1PO6A 5GVQA 1CG2A 4C2MA 4YP3A 2HLUA 3Q2SC 3JYTA 3MEDA 3DFEA 1E6YB 3BO3A 4KO0B 2WOMB 4YB1P 2HHVA 3LPYA 4K5SA 1S77D 4P7VA 2G9OA 2IAJB 3PEJA 3DOLB 4H4OA 2UV8A 2B9XA 3VAGA 2DGSA 1HWLA 2L3MA 5KG4A 4P2SA 1UMJA 2JLFA 5AXLA 1C0TB 2C28A 2FGCA 3MAQA 4ZPTR 2EFVA 2DGWA 2J0XA 1DAXA 3P5TL 5KG1A 4A8XA 1JKHB 2VFUA 5HMYA 1S1XB 3F44A 2QSWA 2W7OA 1R8CA 3OR2B 1S6QA 2F40A 1FCAA 2DO4A 2VG7B 3ITHA 3M8QB 2GIRA 2VOOA 3IAM9 4C3KA 3NAIA 2BR0A 4C0OC 5KFFA 4DV2F 4DQQA 2HFOA 5L1IA 4WFNQ 4F67A 1YQHA 2HMIB 2F7VA 1TZ0A 1UP1A 3JTOA 2EFGA 4WYLA 3VAKA 3CCZA 2ZH2A 2BACA 3I0SB 1RT7A 3HF5A 5K8NA 5IM0B 1X4DA 2DPIA 1X4AA 1TL4A 1RGVA 5DQHA 2YY3A 3KLIB 3SQGB 2J9DA 4DV3F 3MOZA 1IKXB 1LW0A 1RT1B 1WHVA 2OAUA 3EZUA 3HI9A 3MMCA 1KOOA 3EUNA 3NL0A 4C3LA 1H2TZ 3IWNC 1GTHA 4Y2AA 4AXJA 1HNZF 2RQKA 5FD1A 3G4SS 5E2QA 3PV8A 5CHCB 1XR6A 3MD3A 4G1PA 3BSAA 4OMFG 5C42A 1Q7YT 3TQ1A 3M1VB 3C2PA 4Q8FA 4QZVB 3T1YF 1HYSB 2KFZA 1UEVA 2MSTA 4NLQA 4QQBA 1KRPA 5E33A 2MPUA 2ZHOA 3QJPA 2D41A 2VPWB 4ECZA 5F0WA 3FQKA 4RWXA 3IBWA 5GAEI 2BANB 1HHSA 1JXEA 2YWKA 3FQLA 4K4XA 3MMBA 2C3MA 3S1TA 4YR2A 4V19J 1GX6A 2P9CA 2WB4A 2J0WA 2J76E 2HFZA 3M2UA 3PEHA 1M5SA 1RT3B 1VGYA 2V2KA 3FMBA 3K7RA 3HHLC 4NYZA 2WAQD 4WIIA 3CXCR 3OL8A 4C8MA 1RTDA 2O67A 1O5JA 5DM6Q 5D78A 1VK8A 1IQTA 2VASA 2RVJA 3DLJA 4X84A 5FLXY 1UAWA 4DQRA 2C3UA 4QWAA 4NYPA 4ZCLA 3J81Y 3V4IA 3GR0A 3CCES 4PUOA 2R7UA 1S0VA 3CIZA 1WG5A 3GIMA 4Q0BB 3PW2A 1WHWA 2BQ3A 4NLVA 2HVHA 3OHAA 4ZDNA 5G4DA 4Y2IA 3TOQA 1HI1A 1X4BA 1SC6A 4G6VB 2ZUGA 5KFIA 3NS6A 3CJ3A 4DR7F 5KFBA 2WONB 3CDEA 2JHEA 3DMJA 3IS9A 3BN7A 3GZ7A 3DXSX 1F9FA 2DJWA 1KQKA 3KK2A 1T03B 1VQNS 3OSNA 4WU3A 4TQRA 2KDOA 2NYIA 1A9NB 3NCQA 3I0RA 5JXSA 4MYUA 2CQDA 2OPRA 1D0EA 2BDPA 2RRAA 4IKAA 1U6BA 4TU9A 1JLBB 2A18A 3G86A 2B9YA 3OVAA 2JWNA 4XIUA 1U48A 5F8NA 2I2YA 3NMRA 4C97A 1DJ0A 2M0GB 4CO4A 4HTIA 3V5RA 1VQKS 2KHCA 3B8HA 1VRTB 4MYTA 4NXMF 4RUAA 1U25A 5SUHA 2Z4PA 4YOEA 4DL6A 3QIPB 3TUIC 5KG0A 1ULRA 2YKMB 4FVMA 4DN0A 2AU0A 1X4HA 3EXCX 3SDEB 1H98A 4RUCA 3CB4A 2OD4A 2DB1A 3AY0A 3Q24A 4GO7X 2XMJA 2MKIA 1WTFA 3FRZA 1RT3A 5DS7A 2B6AA 1HI0P 3DM2B 1R8AA 1HBNA 2DNQA 1ZAXA 2L08A 2FHMA 1I1GA 1VQ7S 4ZKAA 5EX0A 1RDRA 1GX5A 4LFCF 1GQEA 3LALA 2W9CB 1FDBA 3O44A 1JNRB 2R7RA 2BQRA 1R0AA 3DOKB 2AV5A 3KG0A 2DNOA 5IQQA 2M70A 4IFYB 2B4OA 3DLHA 5GAGU 2VQFF 2HNZB 2WHOA 4EU0A 1CSJA 1RT2A 2EFNA 4HI2A 4M95A 4EYHB 1X7VA 2CQ0A 2JOQA 2K8GA