4WMID

Crystal structure of mouse xyloside xylosyltransferase 1 complexed with manganese, product ligand and udp (product complex i)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
35
structure length
35
Chain Sequence
QCESNPCLNGGSCKDDINSYECWCPFGFEGKNCEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/protein binding
molecule keywords Xyloside xylosyltransferase 1
publication title Notch-modifying xylosyltransferase structures support an SNi-like retaining mechanism.
pubmed doi rcsb
source organism Mus musculus
total genus 5
structure length 35
sequence length 35
ec nomenclature ec 3.4.21.22: Coagulation factor IXa.
pdb deposition date 2014-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00008 EGF EGF-like domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...