4WP0A

Crystal structure of human kynurenine aminotransferase-i with a c-terminal v5-hexahistidine tag
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
422
structure length
415
Chain Sequence
b'QLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGLGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVELENL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kynurenine--oxoglutarate transaminase 1
publication title Crystal structure of human kynurenine aminotransferase-I in a novel space group
rcsb
source organism Homo sapiens
molecule tags Lyase, transferase
total genus 135
structure length 415
sequence length 422
chains with identical sequence B, C, D
ec nomenclature ec 2.6.1.64: Glutamine--phenylpyruvate transaminase.
pdb deposition date 2014-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4wp0A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4wp0A01
2VMSA 2FYFA 3FVUA 5EFSA 2CH1A 4JEWA 4AO4A 4AO9A 4CVQA 3ELEA 3HLMA 4P3MA 3ZRPA 2X3LA 1X28A 2DKBA 3K28A 2VMRA 5EIGA 1BT4A 4KXKA 4WXGA 4WYFA 4Y0IA 4EFFA 9AATA 2X5DA 3GZCA 1SPAA 1UU0A 3H14A 5K8BA 1ASEA 4BMKA 2AY7A 1MDXA 3CAIA 1B8GA 4CBSA 1Z3ZA 3AOVA 1AMRA 3B46A 1YJYA 2AY5A 1JS3A 3F6TA 4F5GA 1AX4A 1AJRA 3FVXA 1AICA 1LS3A 5TF5A 3RBLA 1GC0A 4JEYA 2W8VA 4EU1A 1O61A 3FDDA 5D5SA 1X2AA 1MAQA 2GSAA 3W1IA 1CL1A 3BCBA 4EB7A 3K7YA 2GB3A 3ZZKA 3QN6A 4JE5A 1AHEA 4W1XA 2HZPA 3LVMA 4TMRA 1C7NA 3VOMA 2VYCA 3BV0A 4L0OA 4MKKA 1WYTA 5DB5A 4HVKA 1LC8A 3NYTA 1GBNA 2VMZA 1BW0A 1WSTA 2FNUA 1ARTA 1UU1A 3FDBA 3GR9A 4PVFA 2Z1YA 4WLJA 4A00A 2CTZA 4JF1A 2JG2A 2OATA 1KKPA 4A6UA 1S0AA 1W7MA 5HHYA 4HF8A 4E77A 4BA5A 1PMOA 2AY1A 3EI5A 3WGBA 2FQ6A 5IWQA 4H51A 5M46A 4WB0B 3BWNA 1IUGA 5DX5A 8AATA 1QJ5A 1TOIA 4OTLA 1CJ0A 3JWAA 5G2QA 3WCOA 1AY4A 2BIAA 3NX3A 1ASNA 3WKSA 4WP0A 3AENB 1EQBA 1ASFA 4ZWVA 4ZSYA 3EZ1A 2HUIA 4ZDOA 2Z9XA 2ZYJA 3NYSA 1VEFA 2ZSMA 2ZY4A 1CQ7A 1AIBA 3LY1A 1C7GA 4BQ0A 1WYUB 2C7TA 2O1BA 1PFFA 1BKGA 2VGZA 3II0A 2WK7A 2ZP7A 3PPLA 2CJDA 2AY4A 2VGVA 3EI9A 1W3UA 1TOKA 1TARA 4IW7A 1M0PA 4R5ZA 1BJOB 4CXRA 2CANA 3I16A 4TV7A 1ASBA 1LC7A 1TATA 4J8LA 4TN4A 3R9AA 1DFOA 3EI6A 4AZJA 4GE4A 1AIAA 4F5HA 3A9YA 1RVUA 2ZY3A 2BWPA 2D63A 3BCAA 1AKBA 2TPLA 2VMOA 3MADA 4AH3A 2W7DA 3KKIA 4RJ0A 1GC2A 4F4EA 1SZKA 5E4ZA 1JF9A 3BC8A 1ASGA 2EH6A 2CJHA 3MEBA 3EIAA 2HORA 2DKJA 2Z61A 1C0NA 3B8XA 1QISA 3FD0A 3GWPA 3GZDC 2E7IA 3N75A 3JW9A 2OQXA 1AKCA 4N0BA 2JGTA 3NDNA 4DGTA 3DR7A 4WBTA 3LG0A 3ZRQA 4WYEA 2YKVA 5D95A 2CJGA 1X29A 3QM2A 2VI9A 1H1CA 2EZ2A 1IX7A 4MY5A 3HQTA 4MQPA 3MAFA 1OHYA 3GBXA 4M2KA 1DGDA 3OKSA 1G4VA 4EMYA 1OHWA 2W7IA 1X0MA 3LV2A 3DXVA 1SVVA 4XK1A 2VMNA 5G09A 2W7MA 1O62A 1AAWA 3AEJC 4FL0A 2QB2A 4CBRA 2FM1A 2W8TA 2ZUKA 2V0YA 3HVYA 1AMQA 5F9SA 3B1DA 1XEYA 2BIEA 2QMAA 4OT8A 4WD2A 3RI6A 3RCHB 2Z20A 1V2FA 2R0TA 1T3IA 2YCPA 3ISLA 3W1HA 1AHFA 3WLXA 3HL2A 1BJOA 2BHXA 1D7VA 3BWOA 3TFUA 1ASDA 2FN6A 4OBVA 5EUNA 3IHJA 3BCXA 1ECXA 1MDZA 1MAPA 2OGAA 2YRRA 5EAAA 2ZY2A 2DGLA 3HDOA 3DXWA 1S08A 4XEWA 5DJ9A 4A6RA 2YKUA 4LNMA 3E9KA 4PIWA 2BKWA 3AEMC 1RVYA 1B9HA 2VMVA 2DGMA 3PD6A 3RBFA 2V1PA 3MC6C 4A6TA 1IX8A 2VGSA 3ASBA 1GCKA 1W7NA 2R2NA 1QZ9A 1YJSA 2VIBA 5E3KA 2E7UA 2Z67A 1OXPA 3DODA 3FQAA 3FSLA 1M0NA 2WK9A 1B9IA 1QITA 4XJPA 4M2JA 5LH9A 2CB1A 3A2BA 4IYOA 1FC4A 1DJEA 1S07A 4ITXA 4KAMA 4LW2A 1W7LA 1KL1A 2ZSLA 4Y0DA 2CSTA 1TOEA 4LW4A 1DGEA 3EI7A 4ZLVA 3DYDA 3A8UX 7AATA 1Z7DA 3QPGA 3RUYA 4XQ2A 1B5OA 3TQXA 3FFHA 3RQ1A 4Q76A 3BN1A 2Q7WA 3PGYA 3WX9A 3E2ZB 3MKJA 4ZM3A 2CFBA 3ECDA 2VMXA 3EI8A 4JE5D 4LC3A 4QGRA 2W7KA 2AY6A 4R5FA 4J5UA 5G4JA 2D64A 3I5TA 4K2IA 1AHGA 3B1CA 4ITGA 4W5KA 1QGNA 4KYOA 3G0TA 3TATA 1H0CA 1AJSB 2R5CB 1TOGA 3MBBA 2E54A 4GDYA 4ISYA 1DTYA 4BHDA 2VMPA 3NU8A 1GEYA 1SFFA 2BI3A 1XI9A 4K2BA 1OXOA 3JZLA 1KL2A 1LW4A 1OHVA 3NNKA 2NMPA 1CZCA 3NRAA 3L8AA 4ZM4A 5AX8A 5EQCA 2Z1ZA 1J04A 1M6SA 1MLZA 4UQVA 4ZASA 4ADBA 1AY5A 3VK2A 3EZSA 2JJFA 1MDOA 1AHXA 1N2TA 2HUUA 4XJLA 2XBNA 2C81A 5EUDA 1ARGA 5DJ1A 3UE8A 3USFA 4AZKA 3DR4A 1IBJA 1PMMA 4OC9A 4XAUA 2W7EA 2YHKA 3N0LA 3GJUA 3FZ6A 2HP2A 2O7CA 2YCNA 2AY8A 1BQDA 5EUEA 5LHAA 1D7SA 4ZDLA 1BS0A 2WKAA 3FQ7A 4JEVA 2AY3A 2Z9VA 2ZC0A 4ZWMA 2RFVA 4GE9A 5FT5A 2W7LA 1GC4A 1CL2A 4DQ6A 2D5YA 3UAKA 4OBUA 1CZEA 1ARHA 3NU7A 4Q75A 3AOWA 1FG3A 5M4DA 3DZZA 2VMQA 3GZDA 4RKCA 3QGUA 1M32A 4OCAA 2JJGA 4MQQA 3HBXA 3QI6A 1ASAA 4AOAA 3E2FA 4ZSWA 1EJIA 3FFRA 2W7HA 2C0RA 4UHNA 3ELPA 3E2ZA 3B1EA 2BWOA 3P6KA 4XJMA 3R4TA 5FT4A 1KKJA 4M2MA 5HDMA 1LKCA 3CQ4A 4MQRA 1LW5A 5BJ3A 2GMSA 1LC5A 4WB0A 1G7XA 4RIZA 3N5MA 3WY7A 1V72A 3HT4A 4LNLA 1DJUA 3WZFA 2R5CA 1DKAA 4GE7A 4IXOA 4ZAHA 1ARIA 3AEJA 3LVKA 3AENA 1UU2A 3TCMA 1ZODA 1ORDA 3DU4A 2VGUA 5FT6A 4F5IA 4BA4A 2VGWA 4DBCA 1WKGA 1S06A 2VMUA 4Q31A 1C9CA 5G2PA 4A72A 1GDEA 3AEOA 2Z9UA 1TOJA 1BJNA 1G7WA 3LWSA 2W8WA 2HOYA 4JF0A 2JISA 1GC3A 3VAXA 5C6UA 3EUCA 1BJWA 1WYUA 4R8DA 4UHOA 3JTXA 4IX8A 3CQ6A 4F5JA 1VJOA 1CQ6A 2ZJGA 2BI1A 1D2FA 4B98A 1WYTB 2YKXA 4OMAA 2EZ1A 1I41A 3MAUA 1AHYA 1IVRA 1V2EA 4F5KA 4ATQA 3CQ5A 1OATA 1GEXA 4RAEA 2JJEA 2QLRA 2D7YA 5E5IA 3G8MA 3FVSA 1V2DA 2VLFA 2CY8A 2D7ZA 1C4KA 4RM1A 1VP4A 1DJ9A 2D61A 1KMKA 1E5FA 2EPJA 3E2YA 4R2NA 1JS6A 3DRDA 2E7JA 1EG5A 1ZC9A 2XH1A 3MC6A 1MGVA 5J8QA 2PO3A 2BYLA 4JEXA 3W1JA 2OKKA 2DGKA 5I92A 2BI5A 2PB0A 2QB3A 2FNIA 2VMYA 4PFFA 1N8PA 3ZRRA 3AELA 2VMWA 3ACZA 1GEWA 2EGYA 2ORDA 3BB8A 4FFCA 4OYTA 1D7RA 3LVJA 5G0AA 2EO5A 3LVLB 4MSOA 3CBFA 3DC1A 1YOOA 1O4SA 4GRXA 1G4XA 3H7FA 3Q8NA 1M0OA 3WKRA 4WXFA 4Q6RA 1I48A 4RKDA 4U2HA 2HUFA 4E3RA 1N31A 2BI2A 3L44A 1AKAA 2W8JA 2BYJA 4MGRA 5FT8A 1ASLA 1IX6A 1CQ8A 2X8UA 3IF2A 4ZDPA 4W91A 2AEUA 2D65A 3RCHA 2VGTA 4P7YA 3I4JA 1YNUA 1QIRA 3OP7A 3TFTA 2R5EA 1B5PA 4O6ZA 4W8IA 3E77A 1SZUA 3WCNA 4F5LA 5F8VA 1M4NA 2BWNA 2OKJA 3UWCA 3ASAA 4WYDA 1CS1A 3PDXA 3JU7A 2WK8A 1YAAA 4ADEA 4GSAA 2DOUA 1M7YA 3ZZJA 2PB2A 1GD9A 2G6WA 2VMTA 3FCRA 3PIUA 2Z9WA 3KE3A 1ZOBA 4U1TA 1BJ4A 1WYVB 3FZ8A 3FKDA 3MAFB 3EIBA 1B4XA 4GEBA 2AY2A 2HOXA 5HXXA 4A0HA 2CH2A 1JG8A 1RV4A 1TPLA 3F0HA 3VK4A 3BWNC 1AY8A 1TASA 2VIAA 2AATA 4B9BA 1O69A 5JAYA 3FZ7A 1PG8A 1AAMA 1FG7A 1IAYA 2GMUA 3GETA 2GQNA 3PAAA 2YKYA 1S09A 2W7FA 2QA3A 3P1TA 3PDBB 4MKJA 1SF2A 3K40A 1P3WA 5EAVA 1J32A 4F5MA 1LK9A 4CXQA 4WLHA 1RV3A 2C44A 1IAXA 4RJYA 2DR1A 2YRIA 4ADDA 1ASMA 1QJ3A 4UOYA 5EIGB 4PFNA 1KMJA 4F5FA 3KGWA 1ELUA 3HMUA 3VP6A 5G4IA 1I29A 3M5UA 1IJIA 4NOGA 1U08A 2OGEA 2ZY5A 4E1OA 1Y4IA 2BIGA 2VLHA 4IY7A 4K2MA 3D6KA 3E6GA 4WYGA 3G7QA 1ELQA 4A0RA 2AEVA 2VI8A 1C7OA 2BI9A 4UHMA 3BS8A 3NYUA 1AJSA 2QBTA 3T32A 5M4BA 3COGA 3PJ0A 5BJ4A 3FQ8A 3KGXA 4A0FA 3NTJA 3AATA 1WKHA 2O0RA 1UKJA 4IXZA 3PD6B 1YIZA 2X5FA 2HP1A 3VK3A 2YCTA 3F9TA 1I43A 2JJHA 3NUIA 3GSBA 1MLYA 1AMSA 2AY9A 3A9ZA 4LNJA 4N0WA 1YJZA 2HOZA 3QHXA 3PA9A 2W7JA 2YOBA 1SZSA 2W8UA 5M49A 4WXBA 3FRKA 4EB5A 4WYCA 4IXSA 3QBOA 1M0QA 3FTBA 1AMAA 1ASCA 4XJOA 1WYVA 2CINA 4IYOB 1ARSA 4RLGA 4ADCA 4ATPA 4RITA 2D66A 4JEZA 4Y0HA 4E3QA 3A9XA 3JWBA 1E5EA 3AEPA 4WYAA 1W23A 3NUBA 4W1VA 2F8JA 3AEMA 1BQAA 2W7GA 3ATHA 1D7UA 1YIYA 3WGCA 4W1WA 3AV7A 4I8AA 4A0GA 3PDBA
chains in the Genus database with same CATH superfamily
2VMSA 2FYFA 3FVUA 5EFSA 2CH1A 4JEWA 4AO4A 4AO9A 4CVQA 3ELEA 3HLMA 4P3MA 3ZRPA 2X3LA 1X28A 2DKBA 3K28A 2VMRA 5EIGA 1BT4A 4KXKA 4WXGA 4WYFA 4Y0IA 4EFFA 9AATA 2X5DA 3GZCA 5KTBA 1SPAA 1UU0A 3H14A 3N4SA 5K8BA 1ASEA 4BMKA 2FKIA 2AY7A 1MDXA 3CAIA 1B8GA 4CBSA 1Z3ZA 3AOVA 1AMRA 3B46A 1YJYA 2AY5A 1JS3A 3F6TA 4F5GA 1AX4A 1AJRA 3FVXA 1AICA 1LS3A 5TF5A 3RBLA 1GC0A 4JEYA 2W8VA 4EU1A 1O61A 3FDDA 5D5SA 1X2AA 1MAQA 2GSAA 3W1IA 1CL1A 3BCBA 4EB7A 3K7YA 2GB3A 3ZZKA 3QN6A 4JE5A 1AHEA 4W1XA 2HZPA 3LVMA 4TMRA 1C7NA 3VOMA 2VYCA 3BV0A 4L0OA 4MKKA 1WYTA 5DB5A 4HVKA 1LC8A 3NYTA 1GBNA 2VMZA 1BW0A 1WSTA 2FNUA 1ARTA 1UU1A 3FDBA 3GR9A 4PVFA 2Z1YA 4WLJA 4A00A 2CTZA 4JF1A 2JG2A 2OATA 2WB6A 1KKPA 4A6UA 1S0AA 1W7MA 5HHYA 4HF8A 4E77A 4BA5A 1PMOA 2AY1A 3EI5A 3WGBA 2FQ6A 5IWQA 4H51A 5M46A 4WB0B 3BWNA 1IUGA 5DX5A 8AATA 1QJ5A 1TOIA 4OTLA 1CJ0A 3JWAA 5G2QA 3WCOA 1AY4A 2BIAA 3NX3A 1ASNA 3WKSA 4WP0A 3AENB 1EQBA 1ASFA 4ZWVA 4ZSYA 3EZ1A 2HUIA 4ZDOA 2Z9XA 2ZYJA 3NYSA 1VEFA 2ZSMA 2ZY4A 1CQ7A 1AIBA 3LY1A 1C7GA 4BQ0A 1WYUB 2C7TA 2O1BA 1PFFA 1BKGA 2VGZA 2A1VA 3II0A 2WK7A 2ZP7A 3PPLA 2CJDA 2AY4A 2VGVA 3EI9A 1W3UA 1TOKA 1TARA 4IW7A 1M0PA 4R5ZA 1BJOB 4CXRA 2CANA 3I16A 4TV7A 1ASBA 1LC7A 1TATA 4J8LA 4TN4A 3R9AA 1DFOA 3EI6A 4AZJA 4GE4A 1AIAA 4F5HA 3A9YA 1RVUA 2ZY3A 2BWPA 2D63A 3BCAA 1AKBA 2TPLA 2VMOA 3MADA 4AH3A 2W7DA 3KKIA 4RJ0A 1GC2A 4F4EA 1SZKA 5E4ZA 1JF9A 3BC8A 1ASGA 2EH6A 2CJHA 3MEBA 3EIAA 2HORA 2DKJA 2Z61A 1C0NA 3B8XA 1QISA 3FD0A 3GWPA 3GZDC 2E7IA 3N75A 3JW9A 2OQXA 1AKCA 4N0BA 2JGTA 3NDNA 4DGTA 3DR7A 4WBTA 3LG0A 3ZRQA 4WYEA 2YKVA 5D95A 2CJGA 1X29A 3QM2A 2VI9A 1H1CA 2EZ2A 1IX7A 4MY5A 3HQTA 4MQPA 3MAFA 1OHYA 3GBXA 4M2KA 1DGDA 3OKSA 1G4VA 4EMYA 1OHWA 2W7IA 1X0MA 3LV2A 3DXVA 3N7NA 1SVVA 4XK1A 2VMNA 5G09A 2W7MA 1O62A 1AAWA 3AEJC 4FL0A 2QB2A 4CBRA 2FM1A 2W8TA 2ZUKA 2V0YA 3HVYA 1AMQA 5F9SA 3B1DA 1XEYA 2BIEA 2QMAA 4OT8A 4WD2A 3RI6A 3RCHB 2Z20A 1V2FA 2R0TA 1T3IA 2YCPA 3ISLA 3W1HA 1AHFA 3WLXA 3HL2A 1BJOA 2BHXA 1D7VA 3BWOA 3TFUA 1ASDA 2FN6A 4OBVA 5EUNA 3IHJA 3BCXA 1ECXA 1MDZA 1MAPA 2OGAA 2YRRA 5EAAA 2ZY2A 2DGLA 3HDOA 3DXWA 1S08A 4XEWA 5DJ9A 4A6RA 1KAFA 2YKUA 4LNMA 3E9KA 4PIWA 2BKWA 3AEMC 1RVYA 1B9HA 2VMVA 2DGMA 3PD6A 3RBFA 2V1PA 3MC6C 4A6TA 1IX8A 2VGSA 3ASBA 1GCKA 1W7NA 2R2NA 1QZ9A 1YJSA 2VIBA 5E3KA 2E7UA 2Z67A 1OXPA 3DODA 3FQAA 3FSLA 1M0NA 2WK9A 1B9IA 1QITA 4XJPA 4M2JA 5LH9A 2CB1A 3A2BA 4IYOA 1FC4A 1DJEA 1S07A 4ITXA 4KAMA 4LW2A 1W7LA 1KL1A 2ZSLA 4Y0DA 2CSTA 1TOEA 4LW4A 1DGEA 3EI7A 4ZLVA 3DYDA 3A8UX 7AATA 1Z7DA 3QPGA 3RUYA 4XQ2A 1B5OA 3TQXA 3FFHA 3RQ1A 4Q76A 3BN1A 2Q7WA 3PGYA 3WX9A 3E2ZB 3MKJA 4ZM3A 2CFBA 3ECDA 2VMXA 3EI8A 4JE5D 2KFPA 4LC3A 4QGRA 2W7KA 2AY6A 4R5FA 4J5UA 5G4JA 2D64A 3I5TA 4K2IA 1AHGA 3B1CA 4ITGA 4W5KA 1QGNA 4KYOA 3G0TA 3TATA 1H0CA 1AJSB 2R5CB 1TOGA 3MBBA 2E54A 4GDYA 4ISYA 1DTYA 4BHDA 2VMPA 3NU8A 1GEYA 1SFFA 2BI3A 1XI9A 4K2BA 1OXOA 3JZLA 1KL2A 1LW4A 1OHVA 3NNKA 2NMPA 1CZCA 3NRAA 3L8AA 4ZM4A 5AX8A 5EQCA 2Z1ZA 1J04A 1M6SA 1MLZA 4UQVA 4ZASA 4ADBA 1AY5A 3VK2A 3EZSA 2JJFA 1MDOA 1AHXA 1N2TA 2HUUA 4XJLA 2XBNA 2C81A 5EUDA 1ARGA 5DJ1A 3UE8A 3USFA 4AZKA 3DR4A 1IBJA 1PMMA 4OC9A 4XAUA 2W7EA 2YHKA 3N0LA 3GJUA 3FZ6A 2HP2A 2O7CA 2YCNA 2AY8A 1BQDA 5EUEA 5LHAA 1D7SA 4ZDLA 1BS0A 2WKAA 3FQ7A 4JEVA 2AY3A 2Z9VA 2ZC0A 4ZWMA 4H63Q 2RFVA 4GE9A 5FT5A 2W7LA 3N4XA 1GC4A 1CL2A 4DQ6A 2D5YA 3UAKA 4OBUA 1CZEA 1ARHA 3NU7A 4Q75A 3AOWA 1FG3A 5M4DA 3DZZA 2VMQA 3GZDA 4RKCA 3QGUA 1M32A 4OCAA 2JJGA 4MQQA 3HBXA 3QI6A 1ASAA 4AOAA 3E2FA 4ZSWA 3H9XA 1EJIA 3FFRA 2W7HA 2C0RA 4UHNA 3ELPA 3E2ZA 3B1EA 2BWOA 3P6KA 4XJMA 3R4TA 5FT4A 1KKJA 4M2MA 5HDMA 1LKCA 2G7JA 3CQ4A 4MQRA 1LW5A 5BJ3A 2GMSA 1LC5A 4WB0A 1G7XA 4RIZA 3N5MA 3WY7A 1V72A 3HT4A 4LNLA 1DJUA 3WZFA 2R5CA 1DKAA 4GE7A 4IXOA 4ZAHA 1ARIA 3AEJA 3LVKA 3AENA 1UU2A 3TCMA 1ZODA 1ORDA 3DU4A 2VGUA 5FT6A 4F5IA 4BA4A 2VGWA 4DBCA 1WKGA 1S06A 2VMUA 4Q31A 1C9CA 5G2PA 4A72A 1GDEA 3AEOA 2Z9UA 1TOJA 1BJNA 1G7WA 3LWSA 2W8WA 2HOYA 4JF0A 2JISA 1GC3A 3VAXA 5C6UA 3EUCA 1BJWA 1WYUA 4R8DA 4UHOA 3JTXA 4IX8A 3CQ6A 4F5JA 1VJOA 1CQ6A 2ZJGA 2BI1A 1D2FA 4B98A 1WYTB 2YKXA 4OMAA 2EZ1A 1I41A 3MAUA 1AHYA 1IVRA 1V2EA 4F5KA 4ATQA 3CQ5A 1OATA 1GEXA 4RAEA 2JJEA 2QLRA 2D7YA 5E5IA 3G8MA 3FVSA 1V2DA 2VLFA 2CY8A 2D7ZA 1C4KA 4RM1A 1VP4A 1DJ9A 2D61A 1KMKA 1E5FA 2EPJA 3E2YA 4R2NA 1JS6A 3DRDA 2E7JA 1EG5A 1ZC9A 2XH1A 3MC6A 1MGVA 5J8QA 2PO3A 2BYLA 4JEXA 3W1JA 2OKKA 2DGKA 5I92A 2BI5A 2PB0A 2QB3A 2FNIA 2VMYA 4PFFA 1N8PA 3ZRRA 3AELA 2VMWA 3ACZA 1GEWA 2EGYA 2ORDA 3BB8A 4FFCA 4OYTA 1D7RA 3LVJA 5G0AA 2EO5A 3LVLB 4MSOA 3CBFA 3DC1A 1YOOA 4K05A 1O4SA 4GRXA 1G4XA 2QSRA 3H7FA 3Q8NA 1M0OA 3WKRA 4WXFA 4Q6RA 1I48A 4RKDA 4U2HA 2HUFA 4E3RA 1N31A 2BI2A 3L44A 1AKAA 2W8JA 2BYJA 4MGRA 5FT8A 1ASLA 1IX6A 1CQ8A 2X8UA 3IF2A 4ZDPA 4W91A 2AEUA 2D65A 3RCHA 2VGTA 4P7YA 3I4JA 1YNUA 1QIRA 3OP7A 3TFTA 2R5EA 1B5PA 4O6ZA 4W8IA 3E77A 1SZUA 3WCNA 4F5LA 5F8VA 1M4NA 2BWNA 2OKJA 3UWCA 3ASAA 4WYDA 1CS1A 3PDXA 3JU7A 2WK8A 1YAAA 4ADEA 4GSAA 2DOUA 1M7YA 3ZZJA 2PB2A 1GD9A 2G6WA 2VMTA 3FCRA 3PIUA 2Z9WA 3KE3A 1ZOBA 4U1TA 1BJ4A 1WYVB 3FZ8A 3FKDA 3MAFB 3EIBA 1B4XA 4GEBA 2AY2A 2HOXA 5HXXA 4A0HA 2CH2A 1JG8A 1RV4A 1TPLA 3F0HA 3VK4A 3BWNC 1AY8A 1TASA 2VIAA 2AATA 4B9BA 1O69A 5JAYA 3FZ7A 1PG8A 1AAMA 1FG7A 1IAYA 2GMUA 3GETA 2GQNA 3PAAA 2YKYA 1S09A 2W7FA 2QA3A 3P1TA 3PDBB 4MKJA 1SF2A 3K40A 1P3WA 5EAVA 1J32A 4F5MA 1LK9A 4CXQA 4WLHA 1RV3A 2C44A 1IAXA 4RJYA 2DR1A 2YRIA 4ADDA 1ASMA 1QJ3A 4UOYA 5EIGB 4PFNA 1KMJA 4F5FA 3KGWA 1ELUA 3HMUA 3VP6A 5G4IA 1I29A 3M5UA 1IJIA 4NOGA 1U08A 2OGEA 2ZY5A 4E1OA 1Y4IA 2BIGA 2VLHA 4IY7A 4K2MA 3D6KA 3E6GA 4WYGA 3G7QA 1ELQA 4A0RA 2AEVA 2VI8A 1C7OA 2BI9A 4UHMA 3BS8A 3NYUA 1AJSA 2QBTA 3T32A 5M4BA 3COGA 3PJ0A 5BJ4A 3FQ8A 3KGXA 4A0FA 3NTJA 3AATA 1WKHA 2O0RA 1UKJA 4IXZA 3PD6B 1YIZA 2X5FA 2HP1A 3VK3A 2YCTA 3F9TA 1I43A 2JJHA 3NUIA 3GSBA 1MLYA 1AMSA 2AY9A 3A9ZA 4LNJA 4N0WA 1YJZA 2HOZA 3QHXA 3PA9A 2W7JA 2YOBA 1SZSA 2W8UA 5M49A 4WXBA 3FRKA 4EB5A 4WYCA 4IXSA 3QBOA 1M0QA 3FTBA 1AMAA 1ASCA 4XJOA 1WYVA 2CINA 4IYOB 1ARSA 4RLGA 4ADCA 4ATPA 4RITA 2D66A 4JEZA 4Y0HA 4E3QA 3A9XA 3JWBA 1E5EA 3AEPA 4WYAA 1W23A 2EYQA 3NUBA 4W1VA 2F8JA 3AEMA 3N4RA 1BQAA 2W7GA 3ATHA 1D7UA 1YIYA 3WGCA 4W1WA 3AV7A 4I8AA 4A0GA 3PDBA
chains in the Genus database with same CATH topology
2VMSA 2FYFA 3FVUA 5EFSA 2CH1A 4JEWA 4AO4A 4AO9A 4CVQA 3ELEA 3HLMA 4P3MA 3ZRPA 2X3LA 1X28A 2DKBA 3K28A 2VMRA 5EIGA 1BT4A 4KXKA 4WXGA 4WYFA 4Y0IA 4EFFA 9AATA 2X5DA 3GZCA 5KTBA 1SPAA 1UU0A 3H14A 3N4SA 5K8BA 1ASEA 4BMKA 2FKIA 2AY7A 1MDXA 3CAIA 1B8GA 4CBSA 1Z3ZA 3AOVA 1AMRA 3B46A 1YJYA 2AY5A 1JS3A 3F6TA 4F5GA 1AX4A 1AJRA 3FVXA 1AICA 1LS3A 5TF5A 3RBLA 1GC0A 4JEYA 2W8VA 4EU1A 1O61A 3FDDA 5D5SA 1X2AA 1MAQA 2GSAA 3W1IA 1CL1A 3BCBA 4EB7A 3K7YA 2GB3A 3ZZKA 3QN6A 4JE5A 1AHEA 4W1XA 2HZPA 3LVMA 4TMRA 1C7NA 3VOMA 2VYCA 3BV0A 4L0OA 4MKKA 1WYTA 5DB5A 4HVKA 1LC8A 3NYTA 1GBNA 2VMZA 1BW0A 1WSTA 2FNUA 1ARTA 1UU1A 3FDBA 3GR9A 4PVFA 2Z1YA 4WLJA 4A00A 2CTZA 4JF1A 2JG2A 2OATA 2WB6A 1KKPA 4A6UA 1S0AA 1W7MA 5HHYA 4HF8A 4E77A 4BA5A 1PMOA 2AY1A 3EI5A 3WGBA 2FQ6A 5IWQA 4H51A 5M46A 4WB0B 3BWNA 1IUGA 5DX5A 8AATA 1QJ5A 1TOIA 4OTLA 1CJ0A 3JWAA 5G2QA 3WCOA 1AY4A 2BIAA 3NX3A 1ASNA 3WKSA 4WP0A 3AENB 1EQBA 1ASFA 4ZWVA 4ZSYA 3EZ1A 2HUIA 4ZDOA 2Z9XA 2ZYJA 3NYSA 1VEFA 2ZSMA 2ZY4A 1CQ7A 1AIBA 3LY1A 1C7GA 4BQ0A 1WYUB 2C7TA 2O1BA 1PFFA 1BKGA 2VGZA 2A1VA 3II0A 2WK7A 2ZP7A 3PPLA 2CJDA 2AY4A 2VGVA 3EI9A 1W3UA 1TOKA 1TARA 4IW7A 1M0PA 4R5ZA 1BJOB 4CXRA 2CANA 3I16A 4TV7A 1ASBA 1LC7A 1TATA 4J8LA 4TN4A 3R9AA 1DFOA 3EI6A 4AZJA 4GE4A 1AIAA 4F5HA 3A9YA 1RVUA 2ZY3A 2BWPA 2D63A 3BCAA 1AKBA 2TPLA 2VMOA 3MADA 4AH3A 2W7DA 3KKIA 4RJ0A 1GC2A 4F4EA 1SZKA 5E4ZA 1JF9A 3BC8A 1ASGA 2EH6A 2CJHA 3MEBA 3EIAA 2HORA 2DKJA 2Z61A 1C0NA 3B8XA 1QISA 3FD0A 3GWPA 3GZDC 2E7IA 3N75A 3JW9A 2OQXA 1AKCA 4N0BA 2JGTA 3NDNA 4DGTA 3DR7A 4WBTA 3LG0A 3ZRQA 4WYEA 2YKVA 5D95A 2CJGA 1X29A 3QM2A 2VI9A 1H1CA 2EZ2A 1IX7A 4MY5A 3HQTA 4MQPA 3MAFA 1OHYA 3GBXA 4M2KA 1DGDA 3OKSA 1G4VA 4EMYA 1OHWA 2W7IA 1X0MA 3LV2A 3DXVA 3N7NA 1SVVA 4XK1A 2VMNA 5G09A 2W7MA 1O62A 1AAWA 3AEJC 4FL0A 2QB2A 4CBRA 2FM1A 2W8TA 2ZUKA 2V0YA 3HVYA 1AMQA 5F9SA 3B1DA 1XEYA 2BIEA 2QMAA 4OT8A 4WD2A 3RI6A 3RCHB 2Z20A 1V2FA 2R0TA 1T3IA 2YCPA 3ISLA 3W1HA 1AHFA 3WLXA 3HL2A 1BJOA 2BHXA 1D7VA 3BWOA 3TFUA 1ASDA 2FN6A 4OBVA 5EUNA 3IHJA 3BCXA 1ECXA 1MDZA 1MAPA 2OGAA 2YRRA 5EAAA 2ZY2A 2DGLA 3HDOA 3DXWA 1S08A 4XEWA 5DJ9A 4A6RA 2YKUA 4LNMA 3E9KA 4PIWA 2BKWA 3AEMC 1RVYA 1B9HA 2VMVA 2DGMA 3PD6A 3RBFA 2V1PA 3MC6C 4A6TA 1IX8A 2VGSA 3ASBA 1GCKA 1W7NA 2R2NA 1QZ9A 1YJSA 2VIBA 5E3KA 2E7UA 2Z67A 1OXPA 3DODA 3FQAA 3FSLA 1M0NA 2WK9A 1B9IA 1QITA 4XJPA 4M2JA 5LH9A 2CB1A 3A2BA 4IYOA 1FC4A 1DJEA 1S07A 4ITXA 4KAMA 4LW2A 1W7LA 1KL1A 2ZSLA 4Y0DA 2CSTA 1TOEA 4LW4A 1DGEA 3EI7A 4ZLVA 3DYDA 3A8UX 7AATA 1Z7DA 3QPGA 3RUYA 4XQ2A 1B5OA 3TQXA 3FFHA 3RQ1A 4Q76A 3BN1A 2Q7WA 3PGYA 3WX9A 3E2ZB 3MKJA 4ZM3A 2CFBA 3ECDA 2VMXA 3EI8A 4JE5D 2KFPA 4LC3A 4QGRA 2W7KA 2AY6A 4R5FA 4J5UA 5G4JA 2D64A 3I5TA 4K2IA 1AHGA 3B1CA 4ITGA 4W5KA 1QGNA 4KYOA 3G0TA 3TATA 1H0CA 1AJSB 2R5CB 1TOGA 3MBBA 2E54A 4GDYA 4ISYA 1DTYA 4BHDA 2VMPA 3NU8A 1GEYA 1SFFA 2BI3A 1XI9A 4K2BA 1OXOA 3JZLA 1KL2A 1LW4A 1OHVA 3NNKA 2NMPA 1CZCA 3NRAA 3L8AA 4ZM4A 5AX8A 5EQCA 2Z1ZA 1J04A 1M6SA 1MLZA 4UQVA 4ZASA 4ADBA 1AY5A 3VK2A 3EZSA 2JJFA 1MDOA 1AHXA 1N2TA 2HUUA 4XJLA 2XBNA 2C81A 5EUDA 1ARGA 5DJ1A 3UE8A 3USFA 4AZKA 3DR4A 1IBJA 1PMMA 4OC9A 4XAUA 2W7EA 2YHKA 3N0LA 3GJUA 3FZ6A 2HP2A 2O7CA 2YCNA 2AY8A 1BQDA 5EUEA 5LHAA 1D7SA 4ZDLA 1BS0A 2WKAA 3FQ7A 4JEVA 2AY3A 2Z9VA 2ZC0A 4ZWMA 4H63Q 2RFVA 4GE9A 5FT5A 2W7LA 3N4XA 1GC4A 1CL2A 4DQ6A 2D5YA 3UAKA 4OBUA 1CZEA 1ARHA 3NU7A 4Q75A 3AOWA 1FG3A 5M4DA 3DZZA 2VMQA 3GZDA 4RKCA 3QGUA 1M32A 4OCAA 2JJGA 4MQQA 3HBXA 3QI6A 1ASAA 4AOAA 3E2FA 4ZSWA 3H9XA 1EJIA 3FFRA 2W7HA 2C0RA 4UHNA 3ELPA 3E2ZA 3B1EA 2BWOA 3P6KA 4XJMA 3R4TA 5FT4A 1KKJA 4M2MA 5HDMA 1LKCA 2G7JA 3CQ4A 4MQRA 1LW5A 5BJ3A 2GMSA 1LC5A 4WB0A 1G7XA 4RIZA 3N5MA 3WY7A 1V72A 3HT4A 4LNLA 1DJUA 3WZFA 2R5CA 1DKAA 4GE7A 4IXOA 4ZAHA 1ARIA 3AEJA 3LVKA 3AENA 1UU2A 3TCMA 1ZODA 1ORDA 3DU4A 2VGUA 5FT6A 4F5IA 4BA4A 2VGWA 4DBCA 1WKGA 1S06A 2VMUA 4Q31A 1C9CA 5G2PA 4A72A 1GDEA 3AEOA 2Z9UA 1TOJA 1BJNA 1G7WA 3LWSA 2W8WA 2HOYA 4JF0A 2JISA 1GC3A 3VAXA 5C6UA 3EUCA 1BJWA 1WYUA 4R8DA 4UHOA 3JTXA 4IX8A 3CQ6A 4F5JA 1VJOA 1CQ6A 2ZJGA 2BI1A 1D2FA 4B98A 1WYTB 2YKXA 4OMAA 2EZ1A 1I41A 3MAUA 1AHYA 1IVRA 1V2EA 4F5KA 4ATQA 3CQ5A 1OATA 1GEXA 4RAEA 2JJEA 2QLRA 2D7YA 5E5IA 3G8MA 3FVSA 1V2DA 2VLFA 2CY8A 2D7ZA 1C4KA 4RM1A 1VP4A 1DJ9A 2D61A 1KMKA 1E5FA 2EPJA 3E2YA 4R2NA 1JS6A 3DRDA 2E7JA 1EG5A 1ZC9A 2XH1A 3MC6A 1MGVA 5J8QA 2PO3A 2BYLA 4JEXA 3W1JA 2OKKA 2DGKA 5I92A 2BI5A 2PB0A 2QB3A 2FNIA 2VMYA 4PFFA 1N8PA 3ZRRA 3AELA 2VMWA 3ACZA 1GEWA 2EGYA 2ORDA 3BB8A 4FFCA 4OYTA 1D7RA 3LVJA 5G0AA 2EO5A 3LVLB 4MSOA 3CBFA 3DC1A 1YOOA 4K05A 1O4SA 4GRXA 1G4XA 2QSRA 3H7FA 3Q8NA 1M0OA 3WKRA 4WXFA 4Q6RA 1I48A 4RKDA 4U2HA 2HUFA 4E3RA 1N31A 2BI2A 3L44A 1AKAA 2W8JA 2BYJA 4MGRA 5FT8A 1ASLA 1IX6A 1CQ8A 2X8UA 3IF2A 4ZDPA 4W91A 2AEUA 2D65A 3RCHA 2VGTA 4P7YA 3I4JA 1YNUA 1QIRA 3OP7A 3TFTA 2R5EA 1B5PA 4O6ZA 4W8IA 3E77A 1SZUA 3WCNA 4F5LA 5F8VA 1M4NA 2BWNA 2OKJA 3UWCA 3ASAA 4WYDA 1CS1A 3PDXA 3JU7A 2WK8A 1YAAA 4ADEA 4GSAA 2DOUA 1M7YA 3ZZJA 2PB2A 1GD9A 2G6WA 2VMTA 3FCRA 3PIUA 2Z9WA 3KE3A 1ZOBA 4U1TA 1BJ4A 1WYVB 3FZ8A 3FKDA 3MAFB 3EIBA 1B4XA 4GEBA 2AY2A 2HOXA 5HXXA 4A0HA 2CH2A 1JG8A 1RV4A 1TPLA 3F0HA 3VK4A 3BWNC 1AY8A 1TASA 2VIAA 2AATA 4B9BA 1O69A 5JAYA 3FZ7A 1PG8A 1AAMA 1FG7A 1IAYA 2GMUA 3GETA 2GQNA 3PAAA 2YKYA 1S09A 2W7FA 2QA3A 3P1TA 3PDBB 4MKJA 1SF2A 3K40A 1P3WA 5EAVA 1J32A 4F5MA 1LK9A 4CXQA 4WLHA 1RV3A 2C44A 1IAXA 4RJYA 2DR1A 2YRIA 4ADDA 1ASMA 1QJ3A 4UOYA 5EIGB 4PFNA 1KMJA 4F5FA 3KGWA 1ELUA 3HMUA 3VP6A 5G4IA 1I29A 3M5UA 1IJIA 4NOGA 1U08A 2OGEA 2ZY5A 4E1OA 1Y4IA 2BIGA 2VLHA 4IY7A 4K2MA 3D6KA 3E6GA 4WYGA 3G7QA 1ELQA 4A0RA 2AEVA 2VI8A 1C7OA 2BI9A 4UHMA 3BS8A 3NYUA 1AJSA 2QBTA 3T32A 5M4BA 3COGA 3PJ0A 5BJ4A 3FQ8A 3KGXA 4A0FA 3NTJA 3AATA 1WKHA 2O0RA 1UKJA 4IXZA 3PD6B 1YIZA 2X5FA 2HP1A 3VK3A 2YCTA 3F9TA 1I43A 2JJHA 3NUIA 3GSBA 1MLYA 1AMSA 2AY9A 3A9ZA 4LNJA 4N0WA 1YJZA 2HOZA 3QHXA 3PA9A 2W7JA 2YOBA 1SZSA 2W8UA 5M49A 4WXBA 3FRKA 4EB5A 4WYCA 4IXSA 3QBOA 1M0QA 3FTBA 1AMAA 1ASCA 4XJOA 1WYVA 2CINA 4IYOB 1ARSA 4RLGA 4ADCA 4ATPA 4RITA 2D66A 4JEZA 4Y0HA 4E3QA 3A9XA 3JWBA 1E5EA 3AEPA 4WYAA 1W23A 2EYQA 3NUBA 4W1VA 2F8JA 3AEMA 3N4RA 1BQAA 2W7GA 3ATHA 1D7UA 1YIYA 3WGCA 4W1WA 3AV7A 4I8AA 4A0GA 3PDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VMS A;  2FYF A;  3FVU A;  5EFS A;  2CH1 A;  4JEW A;  4AO4 A;  4AO9 A;  4CVQ A;  3ELE A;  3HLM A;  4P3M A;  3ZRP A;  2X3L A;  1X28 A;  2DKB A;  3K28 A;  2VMR A;  5EIG A;  1BT4 A;  4KXK A;  4WXG A;  4WYF A;  4Y0I A;  4EFF A;  9AAT A;  2X5D A;  3GZC A;  1SPA A;  1UU0 A;  3H14 A;  5K8B A;  1ASE A;  4BMK A;  2AY7 A;  1MDX A;  3CAI A;  1B8G A;  4CBS A;  1Z3Z A;  3AOV A;  1AMR A;  3B46 A;  1YJY A;  2AY5 A;  1JS3 A;  3F6T A;  4F5G A;  1AX4 A;  1AJR A;  3FVX A;  1AIC A;  1LS3 A;  5TF5 A;  3RBL A;  1GC0 A;  4JEY A;  2W8V A;  4EU1 A;  1O61 A;  3FDD A;  5D5S A;  1X2A A;  1MAQ A;  2GSA A;  3W1I A;  1CL1 A;  3BCB A;  4EB7 A;  3K7Y A;  2GB3 A;  3ZZK A;  3QN6 A;  4JE5 A;  1AHE A;  4W1X A;  2HZP A;  3LVM A;  4TMR A;  1C7N A;  3VOM A;  2VYC A;  3BV0 A;  4L0O A;  4MKK A;  1WYT A;  5DB5 A;  4HVK A;  1LC8 A;  3NYT A;  1GBN A;  2VMZ A;  1BW0 A;  1WST A;  2FNU A;  1ART A;  1UU1 A;  3FDB A;  3GR9 A;  4PVF A;  2Z1Y A;  4WLJ A;  4A00 A;  2CTZ A;  4JF1 A;  2JG2 A;  2OAT A;  1KKP A;  4A6U A;  1S0A A;  1W7M A;  5HHY A;  4HF8 A;  4E77 A;  4BA5 A;  1PMO A;  2AY1 A;  3EI5 A;  3WGB A;  2FQ6 A;  5IWQ A;  4H51 A;  5M46 A;  4WB0 B;  3BWN A;  1IUG A;  5DX5 A;  8AAT A;  1QJ5 A;  1TOI A;  4OTL A;  1CJ0 A;  3JWA A;  5G2Q A;  3WCO A;  1AY4 A;  2BIA A;  3NX3 A;  1ASN A;  3WKS A;  4WP0 A;  3AEN B;  1EQB A;  1ASF A;  4ZWV A;  4ZSY A;  3EZ1 A;  2HUI A;  4ZDO A;  2Z9X A;  2ZYJ A;  3NYS A;  1VEF A;  2ZSM A;  2ZY4 A;  1CQ7 A;  1AIB A;  3LY1 A;  1C7G A;  4BQ0 A;  1WYU B;  2C7T A;  2O1B A;  1PFF A;  1BKG A;  2VGZ A;  3II0 A;  2WK7 A;  2ZP7 A;  3PPL A;  2CJD A;  2AY4 A;  2VGV A;  3EI9 A;  1W3U A;  1TOK A;  1TAR A;  4IW7 A;  1M0P A;  4R5Z A;  1BJO B;  4CXR A;  2CAN A;  3I16 A;  4TV7 A;  1ASB A;  1LC7 A;  1TAT A;  4J8L A;  4TN4 A;  3R9A A;  1DFO A;  3EI6 A;  4AZJ A;  4GE4 A;  1AIA A;  4F5H A;  3A9Y A;  1RVU A;  2ZY3 A;  2BWP A;  2D63 A;  3BCA A;  1AKB A;  2TPL A;  2VMO A;  3MAD A;  4AH3 A;  2W7D A;  3KKI A;  4RJ0 A;  1GC2 A;  4F4E A;  1SZK A;  5E4Z A;  1JF9 A;  3BC8 A;  1ASG A;  2EH6 A;  2CJH A;  3MEB A;  3EIA A;  2HOR A;  2DKJ A;  2Z61 A;  1C0N A;  3B8X A;  1QIS A;  3FD0 A;  3GWP A;  3GZD C;  2E7I A;  3N75 A;  3JW9 A;  2OQX A;  1AKC A;  4N0B A;  2JGT A;  3NDN A;  4DGT A;  3DR7 A;  4WBT A;  3LG0 A;  3ZRQ A;  4WYE A;  2YKV A;  5D95 A;  2CJG A;  1X29 A;  3QM2 A;  2VI9 A;  1H1C A;  2EZ2 A;  1IX7 A;  4MY5 A;  3HQT A;  4MQP A;  3MAF A;  1OHY A;  3GBX A;  4M2K A;  1DGD A;  3OKS A;  1G4V A;  4EMY A;  1OHW A;  2W7I A;  1X0M A;  3LV2 A;  3DXV A;  1SVV A;  4XK1 A;  2VMN A;  5G09 A;  2W7M A;  1O62 A;  1AAW A;  3AEJ C;  4FL0 A;  2QB2 A;  4CBR A;  2FM1 A;  2W8T A;  2ZUK A;  2V0Y A;  3HVY A;  1AMQ A;  5F9S A;  3B1D A;  1XEY A;  2BIE A;  2QMA A;  4OT8 A;  4WD2 A;  3RI6 A;  3RCH B;  2Z20 A;  1V2F A;  2R0T A;  1T3I A;  2YCP A;  3ISL A;  3W1H A;  1AHF A;  3WLX A;  3HL2 A;  1BJO A;  2BHX A;  1D7V A;  3BWO A;  3TFU A;  1ASD A;  2FN6 A;  4OBV A;  5EUN A;  3IHJ A;  3BCX A;  1ECX A;  1MDZ A;  1MAP A;  2OGA A;  2YRR A;  5EAA A;  2ZY2 A;  2DGL A;  3HDO A;  3DXW A;  1S08 A;  4XEW A;  5DJ9 A;  4A6R A;  2YKU A;  4LNM A;  3E9K A;  4PIW A;  2BKW A;  3AEM C;  1RVY A;  1B9H A;  2VMV A;  2DGM A;  3PD6 A;  3RBF A;  2V1P A;  3MC6 C;  4A6T A;  1IX8 A;  2VGS A;  3ASB A;  1GCK A;  1W7N A;  2R2N A;  1QZ9 A;  1YJS A;  2VIB A;  5E3K A;  2E7U A;  2Z67 A;  1OXP A;  3DOD A;  3FQA A;  3FSL A;  1M0N A;  2WK9 A;  1B9I A;  1QIT A;  4XJP A;  4M2J A;  5LH9 A;  2CB1 A;  3A2B A;  4IYO A;  1FC4 A;  1DJE A;  1S07 A;  4ITX A;  4KAM A;  4LW2 A;  1W7L A;  1KL1 A;  2ZSL A;  4Y0D A;  2CST A;  1TOE A;  4LW4 A;  1DGE A;  3EI7 A;  4ZLV A;  3DYD A;  3A8U X;  7AAT A;  1Z7D A;  3QPG A;  3RUY A;  4XQ2 A;  1B5O A;  3TQX A;  3FFH A;  3RQ1 A;  4Q76 A;  3BN1 A;  2Q7W A;  3PGY A;  3WX9 A;  3E2Z B;  3MKJ A;  4ZM3 A;  2CFB A;  3ECD A;  2VMX A;  3EI8 A;  4JE5 D;  4LC3 A;  4QGR A;  2W7K A;  2AY6 A;  4R5F A;  4J5U A;  5G4J A;  2D64 A;  3I5T A;  4K2I A;  1AHG A;  3B1C A;  4ITG A;  4W5K A;  1QGN A;  4KYO A;  3G0T A;  3TAT A;  1H0C A;  1AJS B;  2R5C B;  1TOG A;  3MBB A;  2E54 A;  4GDY A;  4ISY A;  1DTY A;  4BHD A;  2VMP A;  3NU8 A;  1GEY A;  1SFF A;  2BI3 A;  1XI9 A;  4K2B A;  1OXO A;  3JZL A;  1KL2 A;  1LW4 A;  1OHV A;  3NNK A;  2NMP A;  1CZC A;  3NRA A;  3L8A A;  4ZM4 A;  5AX8 A;  5EQC A;  2Z1Z A;  1J04 A;  1M6S A;  1MLZ A;  4UQV A;  4ZAS A;  4ADB A;  1AY5 A;  3VK2 A;  3EZS A;  2JJF A;  1MDO A;  1AHX A;  1N2T A;  2HUU A;  4XJL A;  2XBN A;  2C81 A;  5EUD A;  1ARG A;  5DJ1 A;  3UE8 A;  3USF A;  4AZK A;  3DR4 A;  1IBJ A;  1PMM A;  4OC9 A;  4XAU A;  2W7E A;  2YHK A;  3N0L A;  3GJU A;  3FZ6 A;  2HP2 A;  2O7C A;  2YCN A;  2AY8 A;  1BQD A;  5EUE A;  5LHA A;  1D7S A;  4ZDL A;  1BS0 A;  2WKA A;  3FQ7 A;  4JEV A;  2AY3 A;  2Z9V A;  2ZC0 A;  4ZWM A;  2RFV A;  4GE9 A;  5FT5 A;  2W7L A;  1GC4 A;  1CL2 A;  4DQ6 A;  2D5Y A;  3UAK A;  4OBU A;  1CZE A;  1ARH A;  3NU7 A;  4Q75 A;  3AOW A;  1FG3 A;  5M4D A;  3DZZ A;  2VMQ A;  3GZD A;  4RKC A;  3QGU A;  1M32 A;  4OCA A;  2JJG A;  4MQQ A;  3HBX A;  3QI6 A;  1ASA A;  4AOA A;  3E2F A;  4ZSW A;  1EJI A;  3FFR A;  2W7H A;  2C0R A;  4UHN A;  3ELP A;  3E2Z A;  3B1E A;  2BWO A;  3P6K A;  4XJM A;  3R4T A;  5FT4 A;  1KKJ A;  4M2M A;  5HDM A;  1LKC A;  3CQ4 A;  4MQR A;  1LW5 A;  5BJ3 A;  2GMS A;  1LC5 A;  4WB0 A;  1G7X A;  4RIZ A;  3N5M A;  3WY7 A;  1V72 A;  3HT4 A;  4LNL A;  1DJU A;  3WZF A;  2R5C A;  1DKA A;  4GE7 A;  4IXO A;  4ZAH A;  1ARI A;  3AEJ A;  3LVK A;  3AEN A;  1UU2 A;  3TCM A;  1ZOD A;  1ORD A;  3DU4 A;  2VGU A;  5FT6 A;  4F5I A;  4BA4 A;  2VGW A;  4DBC A;  1WKG A;  1S06 A;  2VMU A;  4Q31 A;  1C9C A;  5G2P A;  4A72 A;  1GDE A;  3AEO A;  2Z9U A;  1TOJ A;  1BJN A;  1G7W A;  3LWS A;  2W8W A;  2HOY A;  4JF0 A;  2JIS A;  1GC3 A;  3VAX A;  5C6U A;  3EUC A;  1BJW A;  1WYU A;  4R8D A;  4UHO A;  3JTX A;  4IX8 A;  3CQ6 A;  4F5J A;  1VJO A;  1CQ6 A;  2ZJG A;  2BI1 A;  1D2F A;  4B98 A;  1WYT B;  2YKX A;  4OMA A;  2EZ1 A;  1I41 A;  3MAU A;  1AHY A;  1IVR A;  1V2E A;  4F5K A;  4ATQ A;  3CQ5 A;  1OAT A;  1GEX A;  4RAE A;  2JJE A;  2QLR A;  2D7Y A;  5E5I A;  3G8M A;  3FVS A;  1V2D A;  2VLF A;  2CY8 A;  2D7Z A;  1C4K A;  4RM1 A;  1VP4 A;  1DJ9 A;  2D61 A;  1KMK A;  1E5F A;  2EPJ A;  3E2Y A;  4R2N A;  1JS6 A;  3DRD A;  2E7J A;  1EG5 A;  1ZC9 A;  2XH1 A;  3MC6 A;  1MGV A;  5J8Q A;  2PO3 A;  2BYL A;  4JEX A;  3W1J A;  2OKK A;  2DGK A;  5I92 A;  2BI5 A;  2PB0 A;  2QB3 A;  2FNI A;  2VMY A;  4PFF A;  1N8P A;  3ZRR A;  3AEL A;  2VMW A;  3ACZ A;  1GEW A;  2EGY A;  2ORD A;  3BB8 A;  4FFC A;  4OYT A;  1D7R A;  3LVJ A;  5G0A A;  2EO5 A;  3LVL B;  4MSO A;  3CBF A;  3DC1 A;  1YOO A;  1O4S A;  4GRX A;  1G4X A;  3H7F A;  3Q8N A;  1M0O A;  3WKR A;  4WXF A;  4Q6R A;  1I48 A;  4RKD A;  4U2H A;  2HUF A;  4E3R A;  1N31 A;  2BI2 A;  3L44 A;  1AKA A;  2W8J A;  2BYJ A;  4MGR A;  5FT8 A;  1ASL A;  1IX6 A;  1CQ8 A;  2X8U A;  3IF2 A;  4ZDP A;  4W91 A;  2AEU A;  2D65 A;  3RCH A;  2VGT A;  4P7Y A;  3I4J A;  1YNU A;  1QIR A;  3OP7 A;  3TFT A;  2R5E A;  1B5P A;  4O6Z A;  4W8I A;  3E77 A;  1SZU A;  3WCN A;  4F5L A;  5F8V A;  1M4N A;  2BWN A;  2OKJ A;  3UWC A;  3ASA A;  4WYD A;  1CS1 A;  3PDX A;  3JU7 A;  2WK8 A;  1YAA A;  4ADE A;  4GSA A;  2DOU A;  1M7Y A;  3ZZJ A;  2PB2 A;  1GD9 A;  2G6W A;  2VMT A;  3FCR A;  3PIU A;  2Z9W A;  3KE3 A;  1ZOB A;  4U1T A;  1BJ4 A;  1WYV B;  3FZ8 A;  3FKD A;  3MAF B;  3EIB A;  1B4X A;  4GEB A;  2AY2 A;  2HOX A;  5HXX A;  4A0H A;  2CH2 A;  1JG8 A;  1RV4 A;  1TPL A;  3F0H A;  3VK4 A;  3BWN C;  1AY8 A;  1TAS A;  2VIA A;  2AAT A;  4B9B A;  1O69 A;  5JAY A;  3FZ7 A;  1PG8 A;  1AAM A;  1FG7 A;  1IAY A;  2GMU A;  3GET A;  2GQN A;  3PAA A;  2YKY A;  1S09 A;  2W7F A;  2QA3 A;  3P1T A;  3PDB B;  4MKJ A;  1SF2 A;  3K40 A;  1P3W A;  5EAV A;  1J32 A;  4F5M A;  1LK9 A;  4CXQ A;  4WLH A;  1RV3 A;  2C44 A;  1IAX A;  4RJY A;  2DR1 A;  2YRI A;  4ADD A;  1ASM A;  1QJ3 A;  4UOY A;  5EIG B;  4PFN A;  1KMJ A;  4F5F A;  3KGW A;  1ELU A;  3HMU A;  3VP6 A;  5G4I A;  1I29 A;  3M5U A;  1IJI A;  4NOG A;  1U08 A;  2OGE A;  2ZY5 A;  4E1O A;  1Y4I A;  2BIG A;  2VLH A;  4IY7 A;  4K2M A;  3D6K A;  3E6G A;  4WYG A;  3G7Q A;  1ELQ A;  4A0R A;  2AEV A;  2VI8 A;  1C7O A;  2BI9 A;  4UHM A;  3BS8 A;  3NYU A;  1AJS A;  2QBT A;  3T32 A;  5M4B A;  3COG A;  3PJ0 A;  5BJ4 A;  3FQ8 A;  3KGX A;  4A0F A;  3NTJ A;  3AAT A;  1WKH A;  2O0R A;  1UKJ A;  4IXZ A;  3PD6 B;  1YIZ A;  2X5F A;  2HP1 A;  3VK3 A;  2YCT A;  3F9T A;  1I43 A;  2JJH A;  3NUI A;  3GSB A;  1MLY A;  1AMS A;  2AY9 A;  3A9Z A;  4LNJ A;  4N0W A;  1YJZ A;  2HOZ A;  3QHX A;  3PA9 A;  2W7J A;  2YOB A;  1SZS A;  2W8U A;  5M49 A;  4WXB A;  3FRK A;  4EB5 A;  4WYC A;  4IXS A;  3QBO A;  1M0Q A;  3FTB A;  1AMA A;  1ASC A;  4XJO A;  1WYV A;  2CIN A;  4IYO B;  1ARS A;  4RLG A;  4ADC A;  4ATP A;  4RIT A;  2D66 A;  4JEZ A;  4Y0H A;  4E3Q A;  3A9X A;  3JWB A;  1E5E A;  3AEP A;  4WYA A;  1W23 A;  3NUB A;  4W1V A;  2F8J A;  3AEM A;  1BQA A;  2W7G A;  3ATH A;  1D7U A;  1YIY A;  3WGC A;  4W1W A;  3AV7 A;  4I8A A;  4A0G A;  3PDB A; 
#chains in the Genus database with same CATH topology
 2VMS A;  2FYF A;  3FVU A;  5EFS A;  2CH1 A;  4JEW A;  4AO4 A;  4AO9 A;  4CVQ A;  3ELE A;  3HLM A;  4P3M A;  3ZRP A;  2X3L A;  1X28 A;  2DKB A;  3K28 A;  2VMR A;  5EIG A;  1BT4 A;  4KXK A;  4WXG A;  4WYF A;  4Y0I A;  4EFF A;  9AAT A;  2X5D A;  3GZC A;  5KTB A;  1SPA A;  1UU0 A;  3H14 A;  3N4S A;  5K8B A;  1ASE A;  4BMK A;  2FKI A;  2AY7 A;  1MDX A;  3CAI A;  1B8G A;  4CBS A;  1Z3Z A;  3AOV A;  1AMR A;  3B46 A;  1YJY A;  2AY5 A;  1JS3 A;  3F6T A;  4F5G A;  1AX4 A;  1AJR A;  3FVX A;  1AIC A;  1LS3 A;  5TF5 A;  3RBL A;  1GC0 A;  4JEY A;  2W8V A;  4EU1 A;  1O61 A;  3FDD A;  5D5S A;  1X2A A;  1MAQ A;  2GSA A;  3W1I A;  1CL1 A;  3BCB A;  4EB7 A;  3K7Y A;  2GB3 A;  3ZZK A;  3QN6 A;  4JE5 A;  1AHE A;  4W1X A;  2HZP A;  3LVM A;  4TMR A;  1C7N A;  3VOM A;  2VYC A;  3BV0 A;  4L0O A;  4MKK A;  1WYT A;  5DB5 A;  4HVK A;  1LC8 A;  3NYT A;  1GBN A;  2VMZ A;  1BW0 A;  1WST A;  2FNU A;  1ART A;  1UU1 A;  3FDB A;  3GR9 A;  4PVF A;  2Z1Y A;  4WLJ A;  4A00 A;  2CTZ A;  4JF1 A;  2JG2 A;  2OAT A;  2WB6 A;  1KKP A;  4A6U A;  1S0A A;  1W7M A;  5HHY A;  4HF8 A;  4E77 A;  4BA5 A;  1PMO A;  2AY1 A;  3EI5 A;  3WGB A;  2FQ6 A;  5IWQ A;  4H51 A;  5M46 A;  4WB0 B;  3BWN A;  1IUG A;  5DX5 A;  8AAT A;  1QJ5 A;  1TOI A;  4OTL A;  1CJ0 A;  3JWA A;  5G2Q A;  3WCO A;  1AY4 A;  2BIA A;  3NX3 A;  1ASN A;  3WKS A;  4WP0 A;  3AEN B;  1EQB A;  1ASF A;  4ZWV A;  4ZSY A;  3EZ1 A;  2HUI A;  4ZDO A;  2Z9X A;  2ZYJ A;  3NYS A;  1VEF A;  2ZSM A;  2ZY4 A;  1CQ7 A;  1AIB A;  3LY1 A;  1C7G A;  4BQ0 A;  1WYU B;  2C7T A;  2O1B A;  1PFF A;  1BKG A;  2VGZ A;  2A1V A;  3II0 A;  2WK7 A;  2ZP7 A;  3PPL A;  2CJD A;  2AY4 A;  2VGV A;  3EI9 A;  1W3U A;  1TOK A;  1TAR A;  4IW7 A;  1M0P A;  4R5Z A;  1BJO B;  4CXR A;  2CAN A;  3I16 A;  4TV7 A;  1ASB A;  1LC7 A;  1TAT A;  4J8L A;  4TN4 A;  3R9A A;  1DFO A;  3EI6 A;  4AZJ A;  4GE4 A;  1AIA A;  4F5H A;  3A9Y A;  1RVU A;  2ZY3 A;  2BWP A;  2D63 A;  3BCA A;  1AKB A;  2TPL A;  2VMO A;  3MAD A;  4AH3 A;  2W7D A;  3KKI A;  4RJ0 A;  1GC2 A;  4F4E A;  1SZK A;  5E4Z A;  1JF9 A;  3BC8 A;  1ASG A;  2EH6 A;  2CJH A;  3MEB A;  3EIA A;  2HOR A;  2DKJ A;  2Z61 A;  1C0N A;  3B8X A;  1QIS A;  3FD0 A;  3GWP A;  3GZD C;  2E7I A;  3N75 A;  3JW9 A;  2OQX A;  1AKC A;  4N0B A;  2JGT A;  3NDN A;  4DGT A;  3DR7 A;  4WBT A;  3LG0 A;  3ZRQ A;  4WYE A;  2YKV A;  5D95 A;  2CJG A;  1X29 A;  3QM2 A;  2VI9 A;  1H1C A;  2EZ2 A;  1IX7 A;  4MY5 A;  3HQT A;  4MQP A;  3MAF A;  1OHY A;  3GBX A;  4M2K A;  1DGD A;  3OKS A;  1G4V A;  4EMY A;  1OHW A;  2W7I A;  1X0M A;  3LV2 A;  3DXV A;  3N7N A;  1SVV A;  4XK1 A;  2VMN A;  5G09 A;  2W7M A;  1O62 A;  1AAW A;  3AEJ C;  4FL0 A;  2QB2 A;  4CBR A;  2FM1 A;  2W8T A;  2ZUK A;  2V0Y A;  3HVY A;  1AMQ A;  5F9S A;  3B1D A;  1XEY A;  2BIE A;  2QMA A;  4OT8 A;  4WD2 A;  3RI6 A;  3RCH B;  2Z20 A;  1V2F A;  2R0T A;  1T3I A;  2YCP A;  3ISL A;  3W1H A;  1AHF A;  3WLX A;  3HL2 A;  1BJO A;  2BHX A;  1D7V A;  3BWO A;  3TFU A;  1ASD A;  2FN6 A;  4OBV A;  5EUN A;  3IHJ A;  3BCX A;  1ECX A;  1MDZ A;  1MAP A;  2OGA A;  2YRR A;  5EAA A;  2ZY2 A;  2DGL A;  3HDO A;  3DXW A;  1S08 A;  4XEW A;  5DJ9 A;  4A6R A;  1KAF A;  2YKU A;  4LNM A;  3E9K A;  4PIW A;  2BKW A;  3AEM C;  1RVY A;  1B9H A;  2VMV A;  2DGM A;  3PD6 A;  3RBF A;  2V1P A;  3MC6 C;  4A6T A;  1IX8 A;  2VGS A;  3ASB A;  1GCK A;  1W7N A;  2R2N A;  1QZ9 A;  1YJS A;  2VIB A;  5E3K A;  2E7U A;  2Z67 A;  1OXP A;  3DOD A;  3FQA A;  3FSL A;  1M0N A;  2WK9 A;  1B9I A;  1QIT A;  4XJP A;  4M2J A;  5LH9 A;  2CB1 A;  3A2B A;  4IYO A;  1FC4 A;  1DJE A;  1S07 A;  4ITX A;  4KAM A;  4LW2 A;  1W7L A;  1KL1 A;  2ZSL A;  4Y0D A;  2CST A;  1TOE A;  4LW4 A;  1DGE A;  3EI7 A;  4ZLV A;  3DYD A;  3A8U X;  7AAT A;  1Z7D A;  3QPG A;  3RUY A;  4XQ2 A;  1B5O A;  3TQX A;  3FFH A;  3RQ1 A;  4Q76 A;  3BN1 A;  2Q7W A;  3PGY A;  3WX9 A;  3E2Z B;  3MKJ A;  4ZM3 A;  2CFB A;  3ECD A;  2VMX A;  3EI8 A;  4JE5 D;  2KFP A;  4LC3 A;  4QGR A;  2W7K A;  2AY6 A;  4R5F A;  4J5U A;  5G4J A;  2D64 A;  3I5T A;  4K2I A;  1AHG A;  3B1C A;  4ITG A;  4W5K A;  1QGN A;  4KYO A;  3G0T A;  3TAT A;  1H0C A;  1AJS B;  2R5C B;  1TOG A;  3MBB A;  2E54 A;  4GDY A;  4ISY A;  1DTY A;  4BHD A;  2VMP A;  3NU8 A;  1GEY A;  1SFF A;  2BI3 A;  1XI9 A;  4K2B A;  1OXO A;  3JZL A;  1KL2 A;  1LW4 A;  1OHV A;  3NNK A;  2NMP A;  1CZC A;  3NRA A;  3L8A A;  4ZM4 A;  5AX8 A;  5EQC A;  2Z1Z A;  1J04 A;  1M6S A;  1MLZ A;  4UQV A;  4ZAS A;  4ADB A;  1AY5 A;  3VK2 A;  3EZS A;  2JJF A;  1MDO A;  1AHX A;  1N2T A;  2HUU A;  4XJL A;  2XBN A;  2C81 A;  5EUD A;  1ARG A;  5DJ1 A;  3UE8 A;  3USF A;  4AZK A;  3DR4 A;  1IBJ A;  1PMM A;  4OC9 A;  4XAU A;  2W7E A;  2YHK A;  3N0L A;  3GJU A;  3FZ6 A;  2HP2 A;  2O7C A;  2YCN A;  2AY8 A;  1BQD A;  5EUE A;  5LHA A;  1D7S A;  4ZDL A;  1BS0 A;  2WKA A;  3FQ7 A;  4JEV A;  2AY3 A;  2Z9V A;  2ZC0 A;  4ZWM A;  4H63 Q;  2RFV A;  4GE9 A;  5FT5 A;  2W7L A;  3N4X A;  1GC4 A;  1CL2 A;  4DQ6 A;  2D5Y A;  3UAK A;  4OBU A;  1CZE A;  1ARH A;  3NU7 A;  4Q75 A;  3AOW A;  1FG3 A;  5M4D A;  3DZZ A;  2VMQ A;  3GZD A;  4RKC A;  3QGU A;  1M32 A;  4OCA A;  2JJG A;  4MQQ A;  3HBX A;  3QI6 A;  1ASA A;  4AOA A;  3E2F A;  4ZSW A;  3H9X A;  1EJI A;  3FFR A;  2W7H A;  2C0R A;  4UHN A;  3ELP A;  3E2Z A;  3B1E A;  2BWO A;  3P6K A;  4XJM A;  3R4T A;  5FT4 A;  1KKJ A;  4M2M A;  5HDM A;  1LKC A;  2G7J A;  3CQ4 A;  4MQR A;  1LW5 A;  5BJ3 A;  2GMS A;  1LC5 A;  4WB0 A;  1G7X A;  4RIZ A;  3N5M A;  3WY7 A;  1V72 A;  3HT4 A;  4LNL A;  1DJU A;  3WZF A;  2R5C A;  1DKA A;  4GE7 A;  4IXO A;  4ZAH A;  1ARI A;  3AEJ A;  3LVK A;  3AEN A;  1UU2 A;  3TCM A;  1ZOD A;  1ORD A;  3DU4 A;  2VGU A;  5FT6 A;  4F5I A;  4BA4 A;  2VGW A;  4DBC A;  1WKG A;  1S06 A;  2VMU A;  4Q31 A;  1C9C A;  5G2P A;  4A72 A;  1GDE A;  3AEO A;  2Z9U A;  1TOJ A;  1BJN A;  1G7W A;  3LWS A;  2W8W A;  2HOY A;  4JF0 A;  2JIS A;  1GC3 A;  3VAX A;  5C6U A;  3EUC A;  1BJW A;  1WYU A;  4R8D A;  4UHO A;  3JTX A;  4IX8 A;  3CQ6 A;  4F5J A;  1VJO A;  1CQ6 A;  2ZJG A;  2BI1 A;  1D2F A;  4B98 A;  1WYT B;  2YKX A;  4OMA A;  2EZ1 A;  1I41 A;  3MAU A;  1AHY A;  1IVR A;  1V2E A;  4F5K A;  4ATQ A;  3CQ5 A;  1OAT A;  1GEX A;  4RAE A;  2JJE A;  2QLR A;  2D7Y A;  5E5I A;  3G8M A;  3FVS A;  1V2D A;  2VLF A;  2CY8 A;  2D7Z A;  1C4K A;  4RM1 A;  1VP4 A;  1DJ9 A;  2D61 A;  1KMK A;  1E5F A;  2EPJ A;  3E2Y A;  4R2N A;  1JS6 A;  3DRD A;  2E7J A;  1EG5 A;  1ZC9 A;  2XH1 A;  3MC6 A;  1MGV A;  5J8Q A;  2PO3 A;  2BYL A;  4JEX A;  3W1J A;  2OKK A;  2DGK A;  5I92 A;  2BI5 A;  2PB0 A;  2QB3 A;  2FNI A;  2VMY A;  4PFF A;  1N8P A;  3ZRR A;  3AEL A;  2VMW A;  3ACZ A;  1GEW A;  2EGY A;  2ORD A;  3BB8 A;  4FFC A;  4OYT A;  1D7R A;  3LVJ A;  5G0A A;  2EO5 A;  3LVL B;  4MSO A;  3CBF A;  3DC1 A;  1YOO A;  4K05 A;  1O4S A;  4GRX A;  1G4X A;  2QSR A;  3H7F A;  3Q8N A;  1M0O A;  3WKR A;  4WXF A;  4Q6R A;  1I48 A;  4RKD A;  4U2H A;  2HUF A;  4E3R A;  1N31 A;  2BI2 A;  3L44 A;  1AKA A;  2W8J A;  2BYJ A;  4MGR A;  5FT8 A;  1ASL A;  1IX6 A;  1CQ8 A;  2X8U A;  3IF2 A;  4ZDP A;  4W91 A;  2AEU A;  2D65 A;  3RCH A;  2VGT A;  4P7Y A;  3I4J A;  1YNU A;  1QIR A;  3OP7 A;  3TFT A;  2R5E A;  1B5P A;  4O6Z A;  4W8I A;  3E77 A;  1SZU A;  3WCN A;  4F5L A;  5F8V A;  1M4N A;  2BWN A;  2OKJ A;  3UWC A;  3ASA A;  4WYD A;  1CS1 A;  3PDX A;  3JU7 A;  2WK8 A;  1YAA A;  4ADE A;  4GSA A;  2DOU A;  1M7Y A;  3ZZJ A;  2PB2 A;  1GD9 A;  2G6W A;  2VMT A;  3FCR A;  3PIU A;  2Z9W A;  3KE3 A;  1ZOB A;  4U1T A;  1BJ4 A;  1WYV B;  3FZ8 A;  3FKD A;  3MAF B;  3EIB A;  1B4X A;  4GEB A;  2AY2 A;  2HOX A;  5HXX A;  4A0H A;  2CH2 A;  1JG8 A;  1RV4 A;  1TPL A;  3F0H A;  3VK4 A;  3BWN C;  1AY8 A;  1TAS A;  2VIA A;  2AAT A;  4B9B A;  1O69 A;  5JAY A;  3FZ7 A;  1PG8 A;  1AAM A;  1FG7 A;  1IAY A;  2GMU A;  3GET A;  2GQN A;  3PAA A;  2YKY A;  1S09 A;  2W7F A;  2QA3 A;  3P1T A;  3PDB B;  4MKJ A;  1SF2 A;  3K40 A;  1P3W A;  5EAV A;  1J32 A;  4F5M A;  1LK9 A;  4CXQ A;  4WLH A;  1RV3 A;  2C44 A;  1IAX A;  4RJY A;  2DR1 A;  2YRI A;  4ADD A;  1ASM A;  1QJ3 A;  4UOY A;  5EIG B;  4PFN A;  1KMJ A;  4F5F A;  3KGW A;  1ELU A;  3HMU A;  3VP6 A;  5G4I A;  1I29 A;  3M5U A;  1IJI A;  4NOG A;  1U08 A;  2OGE A;  2ZY5 A;  4E1O A;  1Y4I A;  2BIG A;  2VLH A;  4IY7 A;  4K2M A;  3D6K A;  3E6G A;  4WYG A;  3G7Q A;  1ELQ A;  4A0R A;  2AEV A;  2VI8 A;  1C7O A;  2BI9 A;  4UHM A;  3BS8 A;  3NYU A;  1AJS A;  2QBT A;  3T32 A;  5M4B A;  3COG A;  3PJ0 A;  5BJ4 A;  3FQ8 A;  3KGX A;  4A0F A;  3NTJ A;  3AAT A;  1WKH A;  2O0R A;  1UKJ A;  4IXZ A;  3PD6 B;  1YIZ A;  2X5F A;  2HP1 A;  3VK3 A;  2YCT A;  3F9T A;  1I43 A;  2JJH A;  3NUI A;  3GSB A;  1MLY A;  1AMS A;  2AY9 A;  3A9Z A;  4LNJ A;  4N0W A;  1YJZ A;  2HOZ A;  3QHX A;  3PA9 A;  2W7J A;  2YOB A;  1SZS A;  2W8U A;  5M49 A;  4WXB A;  3FRK A;  4EB5 A;  4WYC A;  4IXS A;  3QBO A;  1M0Q A;  3FTB A;  1AMA A;  1ASC A;  4XJO A;  1WYV A;  2CIN A;  4IYO B;  1ARS A;  4RLG A;  4ADC A;  4ATP A;  4RIT A;  2D66 A;  4JEZ A;  4Y0H A;  4E3Q A;  3A9X A;  3JWB A;  1E5E A;  3AEP A;  4WYA A;  1W23 A;  2EYQ A;  3NUB A;  4W1V A;  2F8J A;  3AEM A;  3N4R A;  1BQA A;  2W7G A;  3ATH A;  1D7U A;  1YIY A;  3WGC A;  4W1W A;  3AV7 A;  4I8A A;  4A0G A;  3PDB A; 
#chains in the Genus database with same CATH homology
 2VMS A;  2FYF A;  3FVU A;  5EFS A;  2CH1 A;  4JEW A;  4AO4 A;  4AO9 A;  4CVQ A;  3ELE A;  3HLM A;  4P3M A;  3ZRP A;  2X3L A;  1X28 A;  2DKB A;  3K28 A;  2VMR A;  5EIG A;  1BT4 A;  4KXK A;  4WXG A;  4WYF A;  4Y0I A;  4EFF A;  9AAT A;  2X5D A;  3GZC A;  5KTB A;  1SPA A;  1UU0 A;  3H14 A;  3N4S A;  5K8B A;  1ASE A;  4BMK A;  2FKI A;  2AY7 A;  1MDX A;  3CAI A;  1B8G A;  4CBS A;  1Z3Z A;  3AOV A;  1AMR A;  3B46 A;  1YJY A;  2AY5 A;  1JS3 A;  3F6T A;  4F5G A;  1AX4 A;  1AJR A;  3FVX A;  1AIC A;  1LS3 A;  5TF5 A;  3RBL A;  1GC0 A;  4JEY A;  2W8V A;  4EU1 A;  1O61 A;  3FDD A;  5D5S A;  1X2A A;  1MAQ A;  2GSA A;  3W1I A;  1CL1 A;  3BCB A;  4EB7 A;  3K7Y A;  2GB3 A;  3ZZK A;  3QN6 A;  4JE5 A;  1AHE A;  4W1X A;  2HZP A;  3LVM A;  4TMR A;  1C7N A;  3VOM A;  2VYC A;  3BV0 A;  4L0O A;  4MKK A;  1WYT A;  5DB5 A;  4HVK A;  1LC8 A;  3NYT A;  1GBN A;  2VMZ A;  1BW0 A;  1WST A;  2FNU A;  1ART A;  1UU1 A;  3FDB A;  3GR9 A;  4PVF A;  2Z1Y A;  4WLJ A;  4A00 A;  2CTZ A;  4JF1 A;  2JG2 A;  2OAT A;  2WB6 A;  1KKP A;  4A6U A;  1S0A A;  1W7M A;  5HHY A;  4HF8 A;  4E77 A;  4BA5 A;  1PMO A;  2AY1 A;  3EI5 A;  3WGB A;  2FQ6 A;  5IWQ A;  4H51 A;  5M46 A;  4WB0 B;  3BWN A;  1IUG A;  5DX5 A;  8AAT A;  1QJ5 A;  1TOI A;  4OTL A;  1CJ0 A;  3JWA A;  5G2Q A;  3WCO A;  1AY4 A;  2BIA A;  3NX3 A;  1ASN A;  3WKS A;  4WP0 A;  3AEN B;  1EQB A;  1ASF A;  4ZWV A;  4ZSY A;  3EZ1 A;  2HUI A;  4ZDO A;  2Z9X A;  2ZYJ A;  3NYS A;  1VEF A;  2ZSM A;  2ZY4 A;  1CQ7 A;  1AIB A;  3LY1 A;  1C7G A;  4BQ0 A;  1WYU B;  2C7T A;  2O1B A;  1PFF A;  1BKG A;  2VGZ A;  2A1V A;  3II0 A;  2WK7 A;  2ZP7 A;  3PPL A;  2CJD A;  2AY4 A;  2VGV A;  3EI9 A;  1W3U A;  1TOK A;  1TAR A;  4IW7 A;  1M0P A;  4R5Z A;  1BJO B;  4CXR A;  2CAN A;  3I16 A;  4TV7 A;  1ASB A;  1LC7 A;  1TAT A;  4J8L A;  4TN4 A;  3R9A A;  1DFO A;  3EI6 A;  4AZJ A;  4GE4 A;  1AIA A;  4F5H A;  3A9Y A;  1RVU A;  2ZY3 A;  2BWP A;  2D63 A;  3BCA A;  1AKB A;  2TPL A;  2VMO A;  3MAD A;  4AH3 A;  2W7D A;  3KKI A;  4RJ0 A;  1GC2 A;  4F4E A;  1SZK A;  5E4Z A;  1JF9 A;  3BC8 A;  1ASG A;  2EH6 A;  2CJH A;  3MEB A;  3EIA A;  2HOR A;  2DKJ A;  2Z61 A;  1C0N A;  3B8X A;  1QIS A;  3FD0 A;  3GWP A;  3GZD C;  2E7I A;  3N75 A;  3JW9 A;  2OQX A;  1AKC A;  4N0B A;  2JGT A;  3NDN A;  4DGT A;  3DR7 A;  4WBT A;  3LG0 A;  3ZRQ A;  4WYE A;  2YKV A;  5D95 A;  2CJG A;  1X29 A;  3QM2 A;  2VI9 A;  1H1C A;  2EZ2 A;  1IX7 A;  4MY5 A;  3HQT A;  4MQP A;  3MAF A;  1OHY A;  3GBX A;  4M2K A;  1DGD A;  3OKS A;  1G4V A;  4EMY A;  1OHW A;  2W7I A;  1X0M A;  3LV2 A;  3DXV A;  3N7N A;  1SVV A;  4XK1 A;  2VMN A;  5G09 A;  2W7M A;  1O62 A;  1AAW A;  3AEJ C;  4FL0 A;  2QB2 A;  4CBR A;  2FM1 A;  2W8T A;  2ZUK A;  2V0Y A;  3HVY A;  1AMQ A;  5F9S A;  3B1D A;  1XEY A;  2BIE A;  2QMA A;  4OT8 A;  4WD2 A;  3RI6 A;  3RCH B;  2Z20 A;  1V2F A;  2R0T A;  1T3I A;  2YCP A;  3ISL A;  3W1H A;  1AHF A;  3WLX A;  3HL2 A;  1BJO A;  2BHX A;  1D7V A;  3BWO A;  3TFU A;  1ASD A;  2FN6 A;  4OBV A;  5EUN A;  3IHJ A;  3BCX A;  1ECX A;  1MDZ A;  1MAP A;  2OGA A;  2YRR A;  5EAA A;  2ZY2 A;  2DGL A;  3HDO A;  3DXW A;  1S08 A;  4XEW A;  5DJ9 A;  4A6R A;  2YKU A;  4LNM A;  3E9K A;  4PIW A;  2BKW A;  3AEM C;  1RVY A;  1B9H A;  2VMV A;  2DGM A;  3PD6 A;  3RBF A;  2V1P A;  3MC6 C;  4A6T A;  1IX8 A;  2VGS A;  3ASB A;  1GCK A;  1W7N A;  2R2N A;  1QZ9 A;  1YJS A;  2VIB A;  5E3K A;  2E7U A;  2Z67 A;  1OXP A;  3DOD A;  3FQA A;  3FSL A;  1M0N A;  2WK9 A;  1B9I A;  1QIT A;  4XJP A;  4M2J A;  5LH9 A;  2CB1 A;  3A2B A;  4IYO A;  1FC4 A;  1DJE A;  1S07 A;  4ITX A;  4KAM A;  4LW2 A;  1W7L A;  1KL1 A;  2ZSL A;  4Y0D A;  2CST A;  1TOE A;  4LW4 A;  1DGE A;  3EI7 A;  4ZLV A;  3DYD A;  3A8U X;  7AAT A;  1Z7D A;  3QPG A;  3RUY A;  4XQ2 A;  1B5O A;  3TQX A;  3FFH A;  3RQ1 A;  4Q76 A;  3BN1 A;  2Q7W A;  3PGY A;  3WX9 A;  3E2Z B;  3MKJ A;  4ZM3 A;  2CFB A;  3ECD A;  2VMX A;  3EI8 A;  4JE5 D;  2KFP A;  4LC3 A;  4QGR A;  2W7K A;  2AY6 A;  4R5F A;  4J5U A;  5G4J A;  2D64 A;  3I5T A;  4K2I A;  1AHG A;  3B1C A;  4ITG A;  4W5K A;  1QGN A;  4KYO A;  3G0T A;  3TAT A;  1H0C A;  1AJS B;  2R5C B;  1TOG A;  3MBB A;  2E54 A;  4GDY A;  4ISY A;  1DTY A;  4BHD A;  2VMP A;  3NU8 A;  1GEY A;  1SFF A;  2BI3 A;  1XI9 A;  4K2B A;  1OXO A;  3JZL A;  1KL2 A;  1LW4 A;  1OHV A;  3NNK A;  2NMP A;  1CZC A;  3NRA A;  3L8A A;  4ZM4 A;  5AX8 A;  5EQC A;  2Z1Z A;  1J04 A;  1M6S A;  1MLZ A;  4UQV A;  4ZAS A;  4ADB A;  1AY5 A;  3VK2 A;  3EZS A;  2JJF A;  1MDO A;  1AHX A;  1N2T A;  2HUU A;  4XJL A;  2XBN A;  2C81 A;  5EUD A;  1ARG A;  5DJ1 A;  3UE8 A;  3USF A;  4AZK A;  3DR4 A;  1IBJ A;  1PMM A;  4OC9 A;  4XAU A;  2W7E A;  2YHK A;  3N0L A;  3GJU A;  3FZ6 A;  2HP2 A;  2O7C A;  2YCN A;  2AY8 A;  1BQD A;  5EUE A;  5LHA A;  1D7S A;  4ZDL A;  1BS0 A;  2WKA A;  3FQ7 A;  4JEV A;  2AY3 A;  2Z9V A;  2ZC0 A;  4ZWM A;  4H63 Q;  2RFV A;  4GE9 A;  5FT5 A;  2W7L A;  3N4X A;  1GC4 A;  1CL2 A;  4DQ6 A;  2D5Y A;  3UAK A;  4OBU A;  1CZE A;  1ARH A;  3NU7 A;  4Q75 A;  3AOW A;  1FG3 A;  5M4D A;  3DZZ A;  2VMQ A;  3GZD A;  4RKC A;  3QGU A;  1M32 A;  4OCA A;  2JJG A;  4MQQ A;  3HBX A;  3QI6 A;  1ASA A;  4AOA A;  3E2F A;  4ZSW A;  3H9X A;  1EJI A;  3FFR A;  2W7H A;  2C0R A;  4UHN A;  3ELP A;  3E2Z A;  3B1E A;  2BWO A;  3P6K A;  4XJM A;  3R4T A;  5FT4 A;  1KKJ A;  4M2M A;  5HDM A;  1LKC A;  2G7J A;  3CQ4 A;  4MQR A;  1LW5 A;  5BJ3 A;  2GMS A;  1LC5 A;  4WB0 A;  1G7X A;  4RIZ A;  3N5M A;  3WY7 A;  1V72 A;  3HT4 A;  4LNL A;  1DJU A;  3WZF A;  2R5C A;  1DKA A;  4GE7 A;  4IXO A;  4ZAH A;  1ARI A;  3AEJ A;  3LVK A;  3AEN A;  1UU2 A;  3TCM A;  1ZOD A;  1ORD A;  3DU4 A;  2VGU A;  5FT6 A;  4F5I A;  4BA4 A;  2VGW A;  4DBC A;  1WKG A;  1S06 A;  2VMU A;  4Q31 A;  1C9C A;  5G2P A;  4A72 A;  1GDE A;  3AEO A;  2Z9U A;  1TOJ A;  1BJN A;  1G7W A;  3LWS A;  2W8W A;  2HOY A;  4JF0 A;  2JIS A;  1GC3 A;  3VAX A;  5C6U A;  3EUC A;  1BJW A;  1WYU A;  4R8D A;  4UHO A;  3JTX A;  4IX8 A;  3CQ6 A;  4F5J A;  1VJO A;  1CQ6 A;  2ZJG A;  2BI1 A;  1D2F A;  4B98 A;  1WYT B;  2YKX A;  4OMA A;  2EZ1 A;  1I41 A;  3MAU A;  1AHY A;  1IVR A;  1V2E A;  4F5K A;  4ATQ A;  3CQ5 A;  1OAT A;  1GEX A;  4RAE A;  2JJE A;  2QLR A;  2D7Y A;  5E5I A;  3G8M A;  3FVS A;  1V2D A;  2VLF A;  2CY8 A;  2D7Z A;  1C4K A;  4RM1 A;  1VP4 A;  1DJ9 A;  2D61 A;  1KMK A;  1E5F A;  2EPJ A;  3E2Y A;  4R2N A;  1JS6 A;  3DRD A;  2E7J A;  1EG5 A;  1ZC9 A;  2XH1 A;  3MC6 A;  1MGV A;  5J8Q A;  2PO3 A;  2BYL A;  4JEX A;  3W1J A;  2OKK A;  2DGK A;  5I92 A;  2BI5 A;  2PB0 A;  2QB3 A;  2FNI A;  2VMY A;  4PFF A;  1N8P A;  3ZRR A;  3AEL A;  2VMW A;  3ACZ A;  1GEW A;  2EGY A;  2ORD A;  3BB8 A;  4FFC A;  4OYT A;  1D7R A;  3LVJ A;  5G0A A;  2EO5 A;  3LVL B;  4MSO A;  3CBF A;  3DC1 A;  1YOO A;  4K05 A;  1O4S A;  4GRX A;  1G4X A;  2QSR A;  3H7F A;  3Q8N A;  1M0O A;  3WKR A;  4WXF A;  4Q6R A;  1I48 A;  4RKD A;  4U2H A;  2HUF A;  4E3R A;  1N31 A;  2BI2 A;  3L44 A;  1AKA A;  2W8J A;  2BYJ A;  4MGR A;  5FT8 A;  1ASL A;  1IX6 A;  1CQ8 A;  2X8U A;  3IF2 A;  4ZDP A;  4W91 A;  2AEU A;  2D65 A;  3RCH A;  2VGT A;  4P7Y A;  3I4J A;  1YNU A;  1QIR A;  3OP7 A;  3TFT A;  2R5E A;  1B5P A;  4O6Z A;  4W8I A;  3E77 A;  1SZU A;  3WCN A;  4F5L A;  5F8V A;  1M4N A;  2BWN A;  2OKJ A;  3UWC A;  3ASA A;  4WYD A;  1CS1 A;  3PDX A;  3JU7 A;  2WK8 A;  1YAA A;  4ADE A;  4GSA A;  2DOU A;  1M7Y A;  3ZZJ A;  2PB2 A;  1GD9 A;  2G6W A;  2VMT A;  3FCR A;  3PIU A;  2Z9W A;  3KE3 A;  1ZOB A;  4U1T A;  1BJ4 A;  1WYV B;  3FZ8 A;  3FKD A;  3MAF B;  3EIB A;  1B4X A;  4GEB A;  2AY2 A;  2HOX A;  5HXX A;  4A0H A;  2CH2 A;  1JG8 A;  1RV4 A;  1TPL A;  3F0H A;  3VK4 A;  3BWN C;  1AY8 A;  1TAS A;  2VIA A;  2AAT A;  4B9B A;  1O69 A;  5JAY A;  3FZ7 A;  1PG8 A;  1AAM A;  1FG7 A;  1IAY A;  2GMU A;  3GET A;  2GQN A;  3PAA A;  2YKY A;  1S09 A;  2W7F A;  2QA3 A;  3P1T A;  3PDB B;  4MKJ A;  1SF2 A;  3K40 A;  1P3W A;  5EAV A;  1J32 A;  4F5M A;  1LK9 A;  4CXQ A;  4WLH A;  1RV3 A;  2C44 A;  1IAX A;  4RJY A;  2DR1 A;  2YRI A;  4ADD A;  1ASM A;  1QJ3 A;  4UOY A;  5EIG B;  4PFN A;  1KMJ A;  4F5F A;  3KGW A;  1ELU A;  3HMU A;  3VP6 A;  5G4I A;  1I29 A;  3M5U A;  1IJI A;  4NOG A;  1U08 A;  2OGE A;  2ZY5 A;  4E1O A;  1Y4I A;  2BIG A;  2VLH A;  4IY7 A;  4K2M A;  3D6K A;  3E6G A;  4WYG A;  3G7Q A;  1ELQ A;  4A0R A;  2AEV A;  2VI8 A;  1C7O A;  2BI9 A;  4UHM A;  3BS8 A;  3NYU A;  1AJS A;  2QBT A;  3T32 A;  5M4B A;  3COG A;  3PJ0 A;  5BJ4 A;  3FQ8 A;  3KGX A;  4A0F A;  3NTJ A;  3AAT A;  1WKH A;  2O0R A;  1UKJ A;  4IXZ A;  3PD6 B;  1YIZ A;  2X5F A;  2HP1 A;  3VK3 A;  2YCT A;  3F9T A;  1I43 A;  2JJH A;  3NUI A;  3GSB A;  1MLY A;  1AMS A;  2AY9 A;  3A9Z A;  4LNJ A;  4N0W A;  1YJZ A;  2HOZ A;  3QHX A;  3PA9 A;  2W7J A;  2YOB A;  1SZS A;  2W8U A;  5M49 A;  4WXB A;  3FRK A;  4EB5 A;  4WYC A;  4IXS A;  3QBO A;  1M0Q A;  3FTB A;  1AMA A;  1ASC A;  4XJO A;  1WYV A;  2CIN A;  4IYO B;  1ARS A;  4RLG A;  4ADC A;  4ATP A;  4RIT A;  2D66 A;  4JEZ A;  4Y0H A;  4E3Q A;  3A9X A;  3JWB A;  1E5E A;  3AEP A;  4WYA A;  1W23 A;  2EYQ A;  3NUB A;  4W1V A;  2F8J A;  3AEM A;  3N4R A;  1BQA A;  2W7G A;  3ATH A;  1D7U A;  1YIY A;  3WGC A;  4W1W A;  3AV7 A;  4I8A A;  4A0G A;  3PDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...