4XJJA

Extracellular domain of type ii transforming growth factor beta receptor in complex with 2-(2-hydroxyethyl)ndsb-201
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
ALCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPTCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extracellular domain of type II Transforming Growth Factor Beta receptor in complex with 2-(2-Hydroxyethyl)NDSB-201
rcsb
source organism Homo sapiens
molecule tags Cytokine receptor
molecule keywords TGF-beta receptor type-2
total genus 24
structure length 105
sequence length 105
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2015-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4xjjA00
2H7ZB 2MUOA 5DO6A 1QKEA 2L5SA 2MUPA 1IDLA 1KBTA 2JQPA 2K3GA 4HQPF 4IYEA 2MHYA 1NTXA 5IMYC 1COEA 1ES7B 2H62C 1KS6A 4BDTB 1LX5B 2ERAA 1VB0A 2QJAC 2CCXA 2H64C 1LXGA 2JVEA 3VTSA 2H62D 3KFDE 4DO8A 2CDXA 5DZ5A 4QTIU 1F8UB 1W6BA 2LA1A 1TXAA 2UWRA 2MFAA 2OFSA 1KXIA 1CDQA 1QKDA 1B41B 2QC1A 1JBDA 1IDHA 3ERAA 1PLOA 2CRTA 3NDSA 1MAHF 2HLQA 5IMTD 3LAQU 4AEAA 1KL8A 1TGXA 1TXBA 1FASA 1HC9B 2X8BB 3KFDI 1FSCA 2N99A 2BHIA 1CVOA 1NYUA 5EBXA 4EY8B 2H8UA 3EVSC 1BTEA 2MJ4A 1KTZB 3NEQA 1HC9A 1CHVS 2LCRA 1CXOA 3U74U 2GOOC 2PJYB 1KBSA 1YWHA 1FF4A 4LFTA 1FRAA 1ERGA 2I9BE 1NTNA 2BTXA 1H0JA 2CRSA 2H5FA 1F94A 1KBAA 1TFSA 1RL5A 1JGKA 1REWC 3FEVA 1CXNA 1DRSA 3NH7A 2GOOB 2PJYC 1HOYA 3BT1U 1JE9A 3PLCA 1CDTA 3EBXA 1RGJA 1IKCA 1LXHA 3HH7A 1IQ9A 1CODA 2QJBC 4ZQYA 2MJ0A 1HAAA 2FD6U 3BT2U 1IDGA 5DU1A 4BIKB 1V6PA 1HAJA 1KC4A 1ABTA 1CDRA 1XT3A 1G6MA 1BXPA 4RUDA 1CCQA 2H64B 4XJJA 1CDSA 1NEAA 4OM5A 4P7UA 1IJCA 1KU6B 1I02A 4FAOC 3U73U 2NBTA 1ONJA 4UY2C 2CTXA 1LJZA 1CRFA 1IDIA 2HLRA 1M9ZA 1UG4A 3QB4B 1CB9A 4OM4A 1CREA 1L4WA 2L03A 1FFJA 1CTXA 2MJYA 6EBXA 2QJ9C 1LSIA 1FSSB 1MR6A 1IK8A 1NXBA 2UX2A 2ABXA 2VLWA 1NORA 1QM7A 1S4YA 2J8BA 4FAOE 2H7ZA 1ERAA 1ZADA 1KFHA 1NYSA
chains in the Genus database with same CATH superfamily
2H7ZB 2MUOA 5DO6A 1QKEA 2L5SA 2MUPA 1IDLA 1KBTA 2JQPA 2K3GA 4HQPF 4IYEA 2MHYA 1NTXA 5IMYC 1COEA 1ES7B 2H62C 1KS6A 4BDTB 1LX5B 2ERAA 1VB0A 2QJAC 2CCXA 2H64C 1LXGA 2JVEA 3VTSA 2H62D 3KFDE 4DO8A 2CDXA 5DZ5A 4QTIU 1F8UB 1W6BA 2LA1A 1TXAA 2UWRA 2MFAA 2OFSA 1KXIA 1CDQA 1QKDA 1B41B 2QC1A 1JBDA 1IDHA 3ERAA 1PLOA 2CRTA 3NDSA 1MAHF 2HLQA 5IMTD 3LAQU 4AEAA 1KL8A 1TGXA 1TXBA 1FASA 1HC9B 2X8BB 3KFDI 1FSCA 2N99A 2BHIA 1CVOA 1NYUA 5EBXA 4EY8B 2H8UA 3EVSC 1BTEA 2MJ4A 1KTZB 3NEQA 1HC9A 1CHVS 2LCRA 1CXOA 3U74U 2GOOC 2PJYB 1KBSA 1YWHA 1FF4A 4LFTA 1FRAA 1ERGA 2I9BE 1NTNA 2BTXA 1H0JA 2CRSA 2H5FA 1F94A 1KBAA 1TFSA 1RL5A 1JGKA 1REWC 3FEVA 1CXNA 1DRSA 3NH7A 2GOOB 2PJYC 1HOYA 3BT1U 1JE9A 3PLCA 1CDTA 3EBXA 1RGJA 1IKCA 1LXHA 3HH7A 1IQ9A 1CODA 2QJBC 4ZQYA 2MJ0A 1HAAA 2FD6U 3BT2U 1IDGA 5DU1A 4BIKB 1V6PA 1HAJA 1KC4A 4KSNA 1ABTA 1CDRA 1XT3A 1G6MA 1BXPA 4RUDA 1CCQA 2H64B 4XJJA 1CDSA 1NEAA 4OM5A 4P7UA 1IJCA 1KU6B 1I02A 4FAOC 3U73U 2NBTA 1ONJA 4UY2C 2CTXA 1LJZA 1CRFA 1IDIA 2HLRA 1M9ZA 1UG4A 3QB4B 1CB9A 4OM4A 1CREA 1L4WA 2L03A 1FFJA 1CTXA 2MJYA 6EBXA 2QJ9C 1LSIA 1FSSB 1MR6A 1IK8A 1NXBA 2UX2A 2ABXA 2VLWA 1NORA 1QM7A 1S4YA 2J8BA 4FAOE 2H7ZA 1ERAA 1ZADA 1KFHA 1NYSA
chains in the Genus database with same CATH topology
2H7ZB 2MUOA 5DO6A 1QKEA 2L5SA 2MUPA 1IDLA 1KBTA 2JQPA 2K3GA 4HQPF 4IYEA 2MHYA 1NTXA 5IMYC 1COEA 1ES7B 2H62C 1KS6A 4BDTB 1LX5B 2ERAA 1VB0A 2QJAC 2CCXA 2H64C 1LXGA 2JVEA 3VTSA 2H62D 3KFDE 4DO8A 2CDXA 5DZ5A 4QTIU 1F8UB 1W6BA 2LA1A 1TXAA 2UWRA 2MFAA 2OFSA 1KXIA 1CDQA 1QKDA 1B41B 2QC1A 1JBDA 1IDHA 3ERAA 1PLOA 2CRTA 3NDSA 1MAHF 2HLQA 5IMTD 3LAQU 4AEAA 1KL8A 1TGXA 1TXBA 1FASA 1HC9B 2X8BB 3KFDI 1FSCA 2N99A 2BHIA 1CVOA 1NYUA 5EBXA 4EY8B 2H8UA 3EVSC 1BTEA 2MJ4A 1KTZB 3NEQA 1HC9A 1CHVS 2LCRA 1CXOA 3U74U 2GOOC 2PJYB 1KBSA 1YWHA 1FF4A 4LFTA 1FRAA 1ERGA 2I9BE 1NTNA 2BTXA 1H0JA 2CRSA 2H5FA 1F94A 1KBAA 1TFSA 1RL5A 1JGKA 1REWC 3FEVA 1CXNA 1DRSA 3NH7A 2GOOB 2PJYC 1HOYA 3BT1U 1JE9A 3PLCA 1CDTA 3EBXA 1RGJA 1IKCA 1LXHA 3HH7A 1IQ9A 1CODA 2QJBC 4ZQYA 2MJ0A 1HAAA 2FD6U 3BT2U 1IDGA 5DU1A 4BIKB 1V6PA 1HAJA 1KC4A 4KSNA 1ABTA 1CDRA 1XT3A 1G6MA 1BXPA 4RUDA 1CCQA 2H64B 4XJJA 1CDSA 1NEAA 4OM5A 4P7UA 1IJCA 1KU6B 1I02A 4FAOC 3U73U 2NBTA 1ONJA 4UY2C 2CTXA 1LJZA 1CRFA 1IDIA 2HLRA 1M9ZA 1UG4A 3QB4B 1CB9A 4OM4A 1CREA 1L4WA 2L03A 1FFJA 1CTXA 2MJYA 6EBXA 2QJ9C 1LSIA 1FSSB 1MR6A 1IK8A 1NXBA 2UX2A 2ABXA 2VLWA 1NORA 1QM7A 1S4YA 2J8BA 4FAOE 2H7ZA 1ERAA 1ZADA 1KFHA 1NYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H7Z B;  2MUO A;  5DO6 A;  1QKE A;  2L5S A;  2MUP A;  1IDL A;  1KBT A;  2JQP A;  2K3G A;  4HQP F;  4IYE A;  2MHY A;  1NTX A;  5IMY C;  1COE A;  1ES7 B;  2H62 C;  1KS6 A;  4BDT B;  1LX5 B;  2ERA A;  1VB0 A;  2QJA C;  2CCX A;  2H64 C;  1LXG A;  2JVE A;  3VTS A;  2H62 D;  3KFD E;  4DO8 A;  2CDX A;  5DZ5 A;  4QTI U;  1F8U B;  1W6B A;  2LA1 A;  1TXA A;  2UWR A;  2MFA A;  2OFS A;  1KXI A;  1CDQ A;  1QKD A;  1B41 B;  2QC1 A;  1JBD A;  1IDH A;  3ERA A;  1PLO A;  2CRT A;  3NDS A;  1MAH F;  2HLQ A;  5IMT D;  3LAQ U;  4AEA A;  1KL8 A;  1TGX A;  1TXB A;  1FAS A;  1HC9 B;  2X8B B;  3KFD I;  1FSC A;  2N99 A;  2BHI A;  1CVO A;  1NYU A;  5EBX A;  4EY8 B;  2H8U A;  3EVS C;  1BTE A;  2MJ4 A;  1KTZ B;  3NEQ A;  1HC9 A;  1CHV S;  2LCR A;  1CXO A;  3U74 U;  2GOO C;  2PJY B;  1KBS A;  1YWH A;  1FF4 A;  4LFT A;  1FRA A;  1ERG A;  2I9B E;  1NTN A;  2BTX A;  1H0J A;  2CRS A;  2H5F A;  1F94 A;  1KBA A;  1TFS A;  1RL5 A;  1JGK A;  1REW C;  3FEV A;  1CXN A;  1DRS A;  3NH7 A;  2GOO B;  2PJY C;  1HOY A;  3BT1 U;  1JE9 A;  3PLC A;  1CDT A;  3EBX A;  1RGJ A;  1IKC A;  1LXH A;  3HH7 A;  1IQ9 A;  1COD A;  2QJB C;  4ZQY A;  2MJ0 A;  1HAA A;  2FD6 U;  3BT2 U;  1IDG A;  5DU1 A;  4BIK B;  1V6P A;  1HAJ A;  1KC4 A;  1ABT A;  1CDR A;  1XT3 A;  1G6M A;  1BXP A;  4RUD A;  1CCQ A;  2H64 B;  4XJJ A;  1CDS A;  1NEA A;  4OM5 A;  4P7U A;  1IJC A;  1KU6 B;  1I02 A;  4FAO C;  3U73 U;  2NBT A;  1ONJ A;  4UY2 C;  2CTX A;  1LJZ A;  1CRF A;  1IDI A;  2HLR A;  1M9Z A;  1UG4 A;  3QB4 B;  1CB9 A;  4OM4 A;  1CRE A;  1L4W A;  2L03 A;  1FFJ A;  1CTX A;  2MJY A;  6EBX A;  2QJ9 C;  1LSI A;  1FSS B;  1MR6 A;  1IK8 A;  1NXB A;  2UX2 A;  2ABX A;  2VLW A;  1NOR A;  1QM7 A;  1S4Y A;  2J8B A;  4FAO E;  2H7Z A;  1ERA A;  1ZAD A;  1KFH A;  1NYS A; 
#chains in the Genus database with same CATH topology
 2H7Z B;  2MUO A;  5DO6 A;  1QKE A;  2L5S A;  2MUP A;  1IDL A;  1KBT A;  2JQP A;  2K3G A;  4HQP F;  4IYE A;  2MHY A;  1NTX A;  5IMY C;  1COE A;  1ES7 B;  2H62 C;  1KS6 A;  4BDT B;  1LX5 B;  2ERA A;  1VB0 A;  2QJA C;  2CCX A;  2H64 C;  1LXG A;  2JVE A;  3VTS A;  2H62 D;  3KFD E;  4DO8 A;  2CDX A;  5DZ5 A;  4QTI U;  1F8U B;  1W6B A;  2LA1 A;  1TXA A;  2UWR A;  2MFA A;  2OFS A;  1KXI A;  1CDQ A;  1QKD A;  1B41 B;  2QC1 A;  1JBD A;  1IDH A;  3ERA A;  1PLO A;  2CRT A;  3NDS A;  1MAH F;  2HLQ A;  5IMT D;  3LAQ U;  4AEA A;  1KL8 A;  1TGX A;  1TXB A;  1FAS A;  1HC9 B;  2X8B B;  3KFD I;  1FSC A;  2N99 A;  2BHI A;  1CVO A;  1NYU A;  5EBX A;  4EY8 B;  2H8U A;  3EVS C;  1BTE A;  2MJ4 A;  1KTZ B;  3NEQ A;  1HC9 A;  1CHV S;  2LCR A;  1CXO A;  3U74 U;  2GOO C;  2PJY B;  1KBS A;  1YWH A;  1FF4 A;  4LFT A;  1FRA A;  1ERG A;  2I9B E;  1NTN A;  2BTX A;  1H0J A;  2CRS A;  2H5F A;  1F94 A;  1KBA A;  1TFS A;  1RL5 A;  1JGK A;  1REW C;  3FEV A;  1CXN A;  1DRS A;  3NH7 A;  2GOO B;  2PJY C;  1HOY A;  3BT1 U;  1JE9 A;  3PLC A;  1CDT A;  3EBX A;  1RGJ A;  1IKC A;  1LXH A;  3HH7 A;  1IQ9 A;  1COD A;  2QJB C;  4ZQY A;  2MJ0 A;  1HAA A;  2FD6 U;  3BT2 U;  1IDG A;  5DU1 A;  4BIK B;  1V6P A;  1HAJ A;  1KC4 A;  4KSN A;  1ABT A;  1CDR A;  1XT3 A;  1G6M A;  1BXP A;  4RUD A;  1CCQ A;  2H64 B;  4XJJ A;  1CDS A;  1NEA A;  4OM5 A;  4P7U A;  1IJC A;  1KU6 B;  1I02 A;  4FAO C;  3U73 U;  2NBT A;  1ONJ A;  4UY2 C;  2CTX A;  1LJZ A;  1CRF A;  1IDI A;  2HLR A;  1M9Z A;  1UG4 A;  3QB4 B;  1CB9 A;  4OM4 A;  1CRE A;  1L4W A;  2L03 A;  1FFJ A;  1CTX A;  2MJY A;  6EBX A;  2QJ9 C;  1LSI A;  1FSS B;  1MR6 A;  1IK8 A;  1NXB A;  2UX2 A;  2ABX A;  2VLW A;  1NOR A;  1QM7 A;  1S4Y A;  2J8B A;  4FAO E;  2H7Z A;  1ERA A;  1ZAD A;  1KFH A;  1NYS A; 
#chains in the Genus database with same CATH homology
 2H7Z B;  2MUO A;  5DO6 A;  1QKE A;  2L5S A;  2MUP A;  1IDL A;  1KBT A;  2JQP A;  2K3G A;  4HQP F;  4IYE A;  2MHY A;  1NTX A;  5IMY C;  1COE A;  1ES7 B;  2H62 C;  1KS6 A;  4BDT B;  1LX5 B;  2ERA A;  1VB0 A;  2QJA C;  2CCX A;  2H64 C;  1LXG A;  2JVE A;  3VTS A;  2H62 D;  3KFD E;  4DO8 A;  2CDX A;  5DZ5 A;  4QTI U;  1F8U B;  1W6B A;  2LA1 A;  1TXA A;  2UWR A;  2MFA A;  2OFS A;  1KXI A;  1CDQ A;  1QKD A;  1B41 B;  2QC1 A;  1JBD A;  1IDH A;  3ERA A;  1PLO A;  2CRT A;  3NDS A;  1MAH F;  2HLQ A;  5IMT D;  3LAQ U;  4AEA A;  1KL8 A;  1TGX A;  1TXB A;  1FAS A;  1HC9 B;  2X8B B;  3KFD I;  1FSC A;  2N99 A;  2BHI A;  1CVO A;  1NYU A;  5EBX A;  4EY8 B;  2H8U A;  3EVS C;  1BTE A;  2MJ4 A;  1KTZ B;  3NEQ A;  1HC9 A;  1CHV S;  2LCR A;  1CXO A;  3U74 U;  2GOO C;  2PJY B;  1KBS A;  1YWH A;  1FF4 A;  4LFT A;  1FRA A;  1ERG A;  2I9B E;  1NTN A;  2BTX A;  1H0J A;  2CRS A;  2H5F A;  1F94 A;  1KBA A;  1TFS A;  1RL5 A;  1JGK A;  1REW C;  3FEV A;  1CXN A;  1DRS A;  3NH7 A;  2GOO B;  2PJY C;  1HOY A;  3BT1 U;  1JE9 A;  3PLC A;  1CDT A;  3EBX A;  1RGJ A;  1IKC A;  1LXH A;  3HH7 A;  1IQ9 A;  1COD A;  2QJB C;  4ZQY A;  2MJ0 A;  1HAA A;  2FD6 U;  3BT2 U;  1IDG A;  5DU1 A;  4BIK B;  1V6P A;  1HAJ A;  1KC4 A;  4KSN A;  1ABT A;  1CDR A;  1XT3 A;  1G6M A;  1BXP A;  4RUD A;  1CCQ A;  2H64 B;  4XJJ A;  1CDS A;  1NEA A;  4OM5 A;  4P7U A;  1IJC A;  1KU6 B;  1I02 A;  4FAO C;  3U73 U;  2NBT A;  1ONJ A;  4UY2 C;  2CTX A;  1LJZ A;  1CRF A;  1IDI A;  2HLR A;  1M9Z A;  1UG4 A;  3QB4 B;  1CB9 A;  4OM4 A;  1CRE A;  1L4W A;  2L03 A;  1FFJ A;  1CTX A;  2MJY A;  6EBX A;  2QJ9 C;  1LSI A;  1FSS B;  1MR6 A;  1IK8 A;  1NXB A;  2UX2 A;  2ABX A;  2VLW A;  1NOR A;  1QM7 A;  1S4Y A;  2J8B A;  4FAO E;  2H7Z A;  1ERA A;  1ZAD A;  1KFH A;  1NYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...