4XT0A

Crystal structure of beta-etherase ligf from sphingobium sp. strain syk-6
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
243
structure length
243
Chain Sequence
MTLKLYSFGPGANSLKPLATLYEKGLEFEQVFVDPSKFEQHSDWFKKINPRGQVPALWHDGKVVTESTVICEYLEDVFPESGNSLRPADPFKRAEMRVWTKWVDEYFCWCVSTIGWAFGIKAIAQKMSDEEFEEHINKNVPIPEQQLKWRRARNGFPQEMLDEEFRKVGVSVARLEETLSKQDYLVDTGYSLADICNFAIANGLQRPGGFFGDYVNQEKTPGLCAWLDRINARPAIKEMFEKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Stereospecificity in the Bacterial Enzymatic Cleavage of beta-Aryl Ether Bonds in Lignin.
pubmed doi rcsb
molecule tags Transferase
source organism Sphingobium sp. syk-6
molecule keywords Protein LigF
total genus 89
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...