4Y52I

Crystal structure of 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4y52I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4y52I02
3VMGA 3HOXI 3S1NI 2F4MA 4A3DI 3FKII 5C4XI 2R92I 3VB9A 1TWAI 4A3EI 4NBEA 2R93I 3S16I 4NBBA 3GTGI 3GKQA 1TWFI 4NB9A 3VMIA 5IP9I 1TWCI 1ZB8A 2DE7A 1USPA 3CQZI 1TFIA 2R7ZI 1RLYA 1K83I 2NVQI 3HOWI 3GTOI 2P3YA 3I4NI 3HOYI 4A3BI 4Y52I 4NB8A 1N2FA 2NVXI 1RO4A 4QTUA 4A3II 3GTPI 3S1MI 1PFTA 3HOUI 3S2DI 2RBLA 3M4OI 1USPB 3ESWA 1TWGI 4BY7I 1L1OC 2JA6I 4A3FI 1Y1VI 4NBCA 2AKLA 3GTKI 1NUIA 1I50I 3S2HI 3GTLI 5FLMI 4A3GI 2JA7I 4BXXI 1VLAA 4NBAA 3VMHA 4NBFA 2JS4A 3GTMI 3S17I 1X3WA 2YU9I 4NBGA 3H0GI 3H3VJ 1LQLA 4NOZA 4A3JI 4BBRI 3GTJI 1X3ZA 3D6WA 4NBHA 3RZDI 2B63I 1Y1VS 4A3KI 5C44I 2K5RA 1R9TI 3K7AI 4A3MI 1I6HI 3I4MI 3I07A 2NVTI 1Y1WI 3M3YI 1ML8A 1QYPA 5CM2M 3RZOI 4QTTA 2BJOA 3LUSA 3U50C 1ZB9A 3PO2I 5C4JI 2DE5A 5C3EI 1I3QI 3S1RI 4BY1I 3HOVI 4X6AI 1WW9A 2DE6A 1TWHI 3S1QI 2E2II 4XX2A 5IP7I 4BBSI 1DL6A 2E2HI 2JA5I 4A93I 2PK7A 2JA8I 2JNYA 4Y7NI 3S15I 2HF1A 4A3LI 1WCMI 4MH4A 2J6AA 3S14I 3EERA 2VUMI 4NBDA 2F4OA 3GCFA 3Q87A 1YUAA 4A3CI 2JR6A 3GTMS 3PO3I 2E2JI 3PO3S 2NVYI 3HOZI 1SFOI 3GTQI 2KPIA
chains in the Genus database with same CATH superfamily
3FKII 3CD61 1VQPZ 3J81b 3G4SZ 1QVFY 1VQL1 3VTNA 2QR1B 3KIHA 1M901 2ZAEB 1NJI1 1ZB8A 2QRDB 2G2KA 2OOXB 5D1OB 1RLYA 2NVQI 1K9M1 3CC4Z 4E2ZA 1K732 2QLVB 2H85A 4MD7A 1RO4A 4QTUA 4A3II 4MRIA 3S1MI 4HH4A 1M1K1 1QVGZ 2VPYA 3JAMf 3CC41 1M902 3F3PC 2KI7B 3NDJA 4A3GI 3CCR1 1QVFZ 3GTMI 3KIFA 2YU9I 4NBGA 3OW2Z 3H3VJ 4RVDA 1N8R2 4BBRI 3GTJI 3RZDI 1Y1VS 4A3KI 2K5RA 1YJWZ 4A3MI 3BG0B 4RV9A 2OTLZ 5T6BA 2NVTI 1Y1WI 3M3YI 1ML8A 1VQLZ 3RZOI 4DK1A 1Q7Y1 1VQ81 2DE5A 1KQSY 1ZH1A 1VQO1 1QVGY 2O4HA 2JIMA 1AA6A 3G711 2V8IA 4NH1C 3I551 1TWHI 1K8A2 5A2Qb 2VPWA 2PK7A 3JAMb 2JNYA 4Y7NI 2HF1A 4MH4A 1YJ91 2WB1A 3GCFA 3CMAZ 3NH5A 2JR6A 1KC81 2KPIA 3CCVZ 3VMGA 3S1NI 2YADA 2QEXZ 2F4MA 3CPWZ 4A3DI 2R92I 3VB9A 1TWAI 2OTJ1 3CC71 2R93I 3S16I 1VQNZ 3CMA1 1WZNA 1TWFI 1YIT1 3CME1 4NB9A 3VMIA 1N8R1 1YHQ1 3F3FC 2QA4Z 2V8KA 4E33A 1Q7Y2 2NAPA 1KD11 3GTOI 2P3YA 3D2LA 4A3BI 1VQOZ 1Q862 1N2FA 2NVXI 4MONA 2PM9A 3HOUI 3CMEZ 3S2DI 3M4OI 3ESWA 4DGLA 1TWGI 2LFUA 4NBCA 1KRLA 3EEDA 2AKLA 3GTKI 1I50I 1VQ9Z 3S2HI 3GTLI 4BXXI 2IZ3A 5A2Qf 1Z02A 1WIIA 2O53A 1KC82 3S17I 1YJN1 3H0GI 1VQM1 1VQ61 1LQLA 2E9HA 1VQ51 4E2WA 1K8A1 3D6WA 3J80f 2QEX1 2B63I 5C44I 1R9TI 3CCMZ 3CCL1 3I07A 5CM2M 2BJOA 1VQ6Z 3D9XA 1ZB9A 3PO2I 3CCU1 2EGTA 2LIYA 4X6AI 4S1TA 1FDOA 3CD6Z 2M6NA 3IFUA 3IF8A 2JUBA 2W03A 3CXCZ 1Q821 3MZKB 2E2II 4BBSI 3CXCY 3CCJZ 4E2YA 2GTHA 3I56Z 3J81f 1Q861 4A3LI 2V45A 1VQ4Z 2QKDA 1QXFA 5D1PA 2VUMI 1Z03A 3Q87A 1YIJ1 3HKZA 3CCE1 1YI21 3GTMS 4AYBA 3HOZI 1W2BY 2AYDA 2IZ4A 3GTQI 3HOXI 1M1K2 1VQP1 5FLXf 2V3VA 4NBEA 2GTIA 2QRCB 2V8JA 1JJ2Z 1YIJZ 3GTGI 3GKQA 1KQSZ 3G4S1 2JIRA 3CCLZ 1TWCI 2DE7A 1RQFA 3QWUA 1K83I 2IV2X 2W04A 3HOYI 3CCS1 4NB8A 3OW2Y 1L1OC 2JA6I 4A3FI 1Q16A 2GU2A 1Y1VI 3G71Z 4E31A 3NH4A 3I55Z 1NUIA 5IT9f 5FLMI 4MD9A 1VLAA 3MONA 4NBAA 2P28A 3VMHA 1KD12 4NBFA 3TE5B 1X0TA 4RVGA 1JJ2Y 4E32A 1VQ71 3NH8A 1YJW1 4MD8A 1X3ZA 3CPWY 2RPRA 3K7AI 1W2BZ 3I4MI 4EWCA 1NJI2 1VQ8Z 4QTTA 3G6E1 4CL1A 1JWHC 2VPZA 1I3QI 4TNUA 3S1RI 1K731 2Y0SA 2DE6A 2Q51A 2RT9A 2K3RA 2RHBA 3S1QI 3CCRZ 5D1OA 1RO0A 1WJ2A 2HU9A 2JA5I 3G6EZ 2VPXA 2JA8I 1YJ9Z 4E2XA 2PMZA 3IX0A 4RVFA 3S15I 1WCMI 2J6AA 3J80b 3EERA 3CCQ1 1YUAA 4A3CI 1S7MA 3MZLB 2OTL1 2E2JI 2NVYI 3P5JB 3CCV1 5C4XI 1VQ7Z 1K9M2 3CCQZ 4A3EI 4NBBA 1VQN1 1FDIA 5IP9I 1USPA 1YITZ 3CQZI 1TFIA 2R7ZI 3BG1B 2QA41 1YHQZ 3NFZA 3HOWI 3I4NI 5AN9F 4DQYB 4Y52I 3CC2Z 3GTPI 1NP6A 1PFTA 5IT9b 2RBLA 5T64A 2E7ZA 1Q812 4HGZA 1USPB 4BY7I 3CCUZ 3T4NB 5FLXb 5T67A 1YUKA 1VQ91 3CC21 2OTJZ 3CC7Z 2JIQA 2JA7I 5LL6f 1Q811 4HGYA 2I3CA 1YJNZ 4NFRA 2JS4A 1SIWA 1S721 1X3WA 4MXUA 1QF8A 4NOZA 4A3JI 1VQMZ 1VQ41 4NBHA 1VQK1 2VF1A 3NDIA 2OOYB 4RVHA 1I6HI 2M48A 3CCEZ 1YI2Z 3CCM1 4E30A 1QYPA 1S72Z 3LUSA 3U50C 5C4JI 3TDHB 4RS4A 2JMOA 3FQMA 5C3EI 2LEXA 2OZKA 1VQKZ 4BY1I 3HOVI 2RIQA 1WW9A 1RO2A 2VUGA 3CCJ1 4XX2A 5IP7I 1DL6A 1P9NA 2WAQA 2E2HI 4A93I 2Q4ZA 1Y8CA 3J7A4 2JIPA 3I561 1VQ5Z 3FQQA 3CCSZ 3S14I 1Q822 1RNIA 3IR7A 2R6MA 4NBDA 2F4OA 2QREB 1Z01A 2JIOA 3PO3I 3PO3S 1SFOI
chains in the Genus database with same CATH topology
3FKII 3CD61 1VQPZ 3J81b 3G4SZ 1QVFY 1VQL1 3VTNA 2QR1B 3KIHA 1M901 2ZAEB 1NJI1 1ZB8A 2QRDB 2G2KA 2OOXB 5D1OB 1RLYA 2NVQI 1K9M1 3CC4Z 4E2ZA 1K732 2QLVB 2H85A 4MD7A 1RO4A 4QTUA 4A3II 4MRIA 3S1MI 4HH4A 1M1K1 1QVGZ 3JAMf 3CC41 1M902 3F3PC 2KI7B 3NDJA 4A3GI 3CCR1 1QVFZ 3GTMI 3KIFA 2YU9I 4NBGA 3OW2Z 3H3VJ 4RVDA 1N8R2 4BBRI 3GTJI 3RZDI 1Y1VS 4A3KI 2K5RA 1YJWZ 4A3MI 3BG0B 4RV9A 2OTLZ 5T6BA 2NVTI 1Y1WI 3M3YI 1ML8A 1VQLZ 3RZOI 4DK1A 1Q7Y1 1VQ81 2DE5A 1KQSY 1ZH1A 1VQO1 1QVGY 2O4HA 3G711 2V8IA 4NH1C 3I551 1TWHI 1K8A2 5A2Qb 2PK7A 3JAMb 2JNYA 4Y7NI 2HF1A 4MH4A 1YJ91 2WB1A 3GCFA 3CMAZ 3NH5A 2JR6A 1KC81 2KPIA 3CCVZ 3VMGA 3S1NI 2YADA 2QEXZ 2F4MA 3CPWZ 4A3DI 2R92I 3VB9A 1TWAI 2OTJ1 3CC71 2R93I 3S16I 1VQNZ 3CMA1 1TWFI 1YIT1 3CME1 4NB9A 3VMIA 1N8R1 1YHQ1 3F3FC 2QA4Z 2V8KA 4E33A 1Q7Y2 1KD11 3GTOI 2P3YA 4A3BI 1VQOZ 1Q862 1N2FA 2NVXI 4MONA 2PM9A 3HOUI 3CMEZ 3S2DI 3M4OI 3ESWA 4DGLA 1TWGI 2LFUA 4NBCA 1KRLA 3EEDA 2AKLA 3GTKI 1I50I 1VQ9Z 3S2HI 3GTLI 4BXXI 2IZ3A 5A2Qf 1Z02A 1WIIA 2O53A 1KC82 3S17I 1YJN1 3H0GI 1VQM1 1VQ61 1LQLA 2E9HA 1VQ51 4E2WA 1K8A1 3D6WA 3J80f 2QEX1 2B63I 5C44I 1R9TI 3CCMZ 3CCL1 3I07A 5CM2M 2BJOA 1VQ6Z 3D9XA 1ZB9A 3PO2I 3CCU1 2EGTA 2LIYA 4X6AI 4S1TA 3CD6Z 2M6NA 3IFUA 3IF8A 2JUBA 2W03A 3CXCZ 1Q821 3MZKB 2E2II 4BBSI 3CXCY 3CCJZ 4E2YA 2GTHA 3I56Z 3J81f 1Q861 4A3LI 1VQ4Z 2QKDA 5D1PA 2VUMI 1Z03A 3Q87A 1YIJ1 3HKZA 3CCE1 1YI21 3GTMS 4AYBA 3HOZI 1W2BY 2IZ4A 3GTQI 3HOXI 1M1K2 1VQP1 5FLXf 4NBEA 2GTIA 2QRCB 2V8JA 1JJ2Z 1YIJZ 3GTGI 3GKQA 1KQSZ 3G4S1 3CCLZ 1TWCI 2DE7A 1RQFA 3QWUA 1K83I 2W04A 3HOYI 3CCS1 4NB8A 3OW2Y 1L1OC 2JA6I 4A3FI 2GU2A 1Y1VI 3G71Z 4E31A 3NH4A 3I55Z 1NUIA 5IT9f 5FLMI 4MD9A 1VLAA 3MONA 4NBAA 2P28A 3VMHA 1KD12 4NBFA 3TE5B 1X0TA 4RVGA 1JJ2Y 4E32A 1VQ71 3NH8A 1YJW1 4MD8A 1X3ZA 3CPWY 2RPRA 3K7AI 1W2BZ 3I4MI 4EWCA 1NJI2 1VQ8Z 4QTTA 3G6E1 4CL1A 1JWHC 1I3QI 4TNUA 3S1RI 1K731 2Y0SA 2DE6A 2Q51A 2RT9A 2K3RA 2RHBA 3S1QI 5D1OA 3CCRZ 1RO0A 2HU9A 2JA5I 3G6EZ 2JA8I 1YJ9Z 4E2XA 2PMZA 3IX0A 4RVFA 3S15I 1WCMI 2J6AA 3J80b 3EERA 3CCQ1 1YUAA 4A3CI 1S7MA 3MZLB 2OTL1 2E2JI 2NVYI 3P5JB 3CCV1 5C4XI 1VQ7Z 1K9M2 3CCQZ 4A3EI 4NBBA 1VQN1 5IP9I 1USPA 1YITZ 3CQZI 1TFIA 2R7ZI 3BG1B 2QA41 1YHQZ 3NFZA 3HOWI 3I4NI 5AN9F 4DQYB 4Y52I 3CC2Z 3GTPI 1NP6A 1PFTA 5IT9b 2RBLA 5T64A 1Q812 4HGZA 1USPB 4BY7I 3CCUZ 3T4NB 5FLXb 5T67A 1YUKA 1VQ91 3CC21 2OTJZ 3CC7Z 2JA7I 5LL6f 1Q811 4HGYA 2I3CA 1YJNZ 4NFRA 2JS4A 1S721 1X3WA 4MXUA 1QF8A 4NOZA 4A3JI 1VQMZ 1VQ41 4NBHA 1VQK1 2VF1A 3NDIA 2OOYB 4RVHA 1I6HI 2M48A 3CCEZ 1YI2Z 3CCM1 4E30A 1QYPA 1S72Z 3LUSA 3U50C 5C4JI 3TDHB 4RS4A 2JMOA 3FQMA 5C3EI 2OZKA 1VQKZ 4BY1I 3HOVI 2RIQA 1WW9A 1RO2A 2VUGA 3CCJ1 4XX2A 5IP7I 1DL6A 1P9NA 2WAQA 2E2HI 4A93I 2Q4ZA 3J7A4 3I561 1VQ5Z 3FQQA 3CCSZ 3S14I 1Q822 1RNIA 2R6MA 4NBDA 2F4OA 2QREB 1Z01A 3PO3I 3PO3S 1SFOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMG A;  3HOX I;  3S1N I;  2F4M A;  4A3D I;  3FKI I;  5C4X I;  2R92 I;  3VB9 A;  1TWA I;  4A3E I;  4NBE A;  2R93 I;  3S16 I;  4NBB A;  3GTG I;  3GKQ A;  1TWF I;  4NB9 A;  3VMI A;  5IP9 I;  1TWC I;  1ZB8 A;  2DE7 A;  1USP A;  3CQZ I;  1TFI A;  2R7Z I;  1RLY A;  1K83 I;  2NVQ I;  3HOW I;  3GTO I;  2P3Y A;  3I4N I;  3HOY I;  4A3B I;  4Y52 I;  4NB8 A;  1N2F A;  2NVX I;  1RO4 A;  4QTU A;  4A3I I;  3GTP I;  3S1M I;  1PFT A;  3HOU I;  3S2D I;  2RBL A;  3M4O I;  1USP B;  3ESW A;  1TWG I;  4BY7 I;  1L1O C;  2JA6 I;  4A3F I;  1Y1V I;  4NBC A;  2AKL A;  3GTK I;  1NUI A;  1I50 I;  3S2H I;  3GTL I;  5FLM I;  4A3G I;  2JA7 I;  4BXX I;  1VLA A;  4NBA A;  3VMH A;  4NBF A;  2JS4 A;  3GTM I;  3S17 I;  1X3W A;  2YU9 I;  4NBG A;  3H0G I;  3H3V J;  1LQL A;  4NOZ A;  4A3J I;  4BBR I;  3GTJ I;  1X3Z A;  3D6W A;  4NBH A;  3RZD I;  2B63 I;  1Y1V S;  4A3K I;  5C44 I;  2K5R A;  1R9T I;  3K7A I;  4A3M I;  1I6H I;  3I4M I;  3I07 A;  2NVT I;  1Y1W I;  3M3Y I;  1ML8 A;  1QYP A;  5CM2 M;  3RZO I;  4QTT A;  2BJO A;  3LUS A;  3U50 C;  1ZB9 A;  3PO2 I;  5C4J I;  2DE5 A;  5C3E I;  1I3Q I;  3S1R I;  4BY1 I;  3HOV I;  4X6A I;  1WW9 A;  2DE6 A;  1TWH I;  3S1Q I;  2E2I I;  4XX2 A;  5IP7 I;  4BBS I;  1DL6 A;  2E2H I;  2JA5 I;  4A93 I;  2PK7 A;  2JA8 I;  2JNY A;  4Y7N I;  3S15 I;  2HF1 A;  4A3L I;  1WCM I;  4MH4 A;  2J6A A;  3S14 I;  3EER A;  2VUM I;  4NBD A;  2F4O A;  3GCF A;  3Q87 A;  1YUA A;  4A3C I;  2JR6 A;  3GTM S;  3PO3 I;  2E2J I;  3PO3 S;  2NVY I;  3HOZ I;  1SFO I;  3GTQ I;  2KPI A; 
#chains in the Genus database with same CATH topology
 3FKI I;  3CD6 1;  1VQP Z;  3J81 b;  3G4S Z;  1QVF Y;  1VQL 1;  3VTN A;  2QR1 B;  3KIH A;  1M90 1;  2ZAE B;  1NJI 1;  1ZB8 A;  2QRD B;  2G2K A;  2OOX B;  5D1O B;  1RLY A;  2NVQ I;  1K9M 1;  3CC4 Z;  4E2Z A;  1K73 2;  2QLV B;  2H85 A;  4MD7 A;  1RO4 A;  4QTU A;  4A3I I;  4MRI A;  3S1M I;  4HH4 A;  1M1K 1;  1QVG Z;  2VPY A;  3JAM f;  3CC4 1;  1M90 2;  3F3P C;  2KI7 B;  3NDJ A;  4A3G I;  3CCR 1;  1QVF Z;  3GTM I;  3KIF A;  2YU9 I;  4NBG A;  3OW2 Z;  3H3V J;  4RVD A;  1N8R 2;  4BBR I;  3GTJ I;  3RZD I;  1Y1V S;  4A3K I;  2K5R A;  1YJW Z;  4A3M I;  3BG0 B;  4RV9 A;  2OTL Z;  5T6B A;  2NVT I;  1Y1W I;  3M3Y I;  1ML8 A;  1VQL Z;  3RZO I;  4DK1 A;  1Q7Y 1;  1VQ8 1;  2DE5 A;  1KQS Y;  1ZH1 A;  1VQO 1;  1QVG Y;  2O4H A;  2JIM A;  1AA6 A;  3G71 1;  2V8I A;  4NH1 C;  3I55 1;  1TWH I;  1K8A 2;  5A2Q b;  2VPW A;  2PK7 A;  3JAM b;  2JNY A;  4Y7N I;  2HF1 A;  4MH4 A;  1YJ9 1;  2WB1 A;  3GCF A;  3CMA Z;  3NH5 A;  2JR6 A;  1KC8 1;  2KPI A;  3CCV Z;  3VMG A;  3S1N I;  2YAD A;  2QEX Z;  2F4M A;  3CPW Z;  4A3D I;  2R92 I;  3VB9 A;  1TWA I;  2OTJ 1;  3CC7 1;  2R93 I;  3S16 I;  1VQN Z;  3CMA 1;  1WZN A;  1TWF I;  1YIT 1;  3CME 1;  4NB9 A;  3VMI A;  1N8R 1;  1YHQ 1;  3F3F C;  2QA4 Z;  2V8K A;  4E33 A;  1Q7Y 2;  2NAP A;  1KD1 1;  3GTO I;  2P3Y A;  3D2L A;  4A3B I;  1VQO Z;  1Q86 2;  1N2F A;  2NVX I;  4MON A;  2PM9 A;  3HOU I;  3CME Z;  3S2D I;  3M4O I;  3ESW A;  4DGL A;  1TWG I;  2LFU A;  4NBC A;  1KRL A;  3EED A;  2AKL A;  3GTK I;  1I50 I;  1VQ9 Z;  3S2H I;  3GTL I;  4BXX I;  2IZ3 A;  5A2Q f;  1Z02 A;  1WII A;  2O53 A;  1KC8 2;  3S17 I;  1YJN 1;  3H0G I;  1VQM 1;  1VQ6 1;  1LQL A;  2E9H A;  1VQ5 1;  4E2W A;  1K8A 1;  3D6W A;  3J80 f;  2QEX 1;  2B63 I;  5C44 I;  1R9T I;  3CCM Z;  3CCL 1;  3I07 A;  5CM2 M;  2BJO A;  1VQ6 Z;  3D9X A;  1ZB9 A;  3PO2 I;  3CCU 1;  2EGT A;  2LIY A;  4X6A I;  4S1T A;  1FDO A;  3CD6 Z;  2M6N A;  3IFU A;  3IF8 A;  2JUB A;  2W03 A;  3CXC Z;  1Q82 1;  3MZK B;  2E2I I;  4BBS I;  3CXC Y;  3CCJ Z;  4E2Y A;  2GTH A;  3I56 Z;  3J81 f;  1Q86 1;  4A3L I;  2V45 A;  1VQ4 Z;  2QKD A;  1QXF A;  5D1P A;  2VUM I;  1Z03 A;  3Q87 A;  1YIJ 1;  3HKZ A;  3CCE 1;  1YI2 1;  3GTM S;  4AYB A;  3HOZ I;  1W2B Y;  2AYD A;  2IZ4 A;  3GTQ I;  3HOX I;  1M1K 2;  1VQP 1;  5FLX f;  2V3V A;  4NBE A;  2GTI A;  2QRC B;  2V8J A;  1JJ2 Z;  1YIJ Z;  3GTG I;  3GKQ A;  1KQS Z;  3G4S 1;  2JIR A;  3CCL Z;  1TWC I;  2DE7 A;  1RQF A;  3QWU A;  1K83 I;  2IV2 X;  2W04 A;  3HOY I;  3CCS 1;  4NB8 A;  3OW2 Y;  1L1O C;  2JA6 I;  4A3F I;  1Q16 A;  2GU2 A;  1Y1V I;  3G71 Z;  4E31 A;  3NH4 A;  3I55 Z;  1NUI A;  5IT9 f;  5FLM I;  4MD9 A;  1VLA A;  3MON A;  4NBA A;  2P28 A;  3VMH A;  1KD1 2;  4NBF A;  3TE5 B;  1X0T A;  4RVG A;  1JJ2 Y;  4E32 A;  1VQ7 1;  3NH8 A;  1YJW 1;  4MD8 A;  1X3Z A;  3CPW Y;  2RPR A;  3K7A I;  1W2B Z;  3I4M I;  4EWC A;  1NJI 2;  1VQ8 Z;  4QTT A;  3G6E 1;  4CL1 A;  1JWH C;  2VPZ A;  1I3Q I;  4TNU A;  3S1R I;  1K73 1;  2Y0S A;  2DE6 A;  2Q51 A;  2RT9 A;  2K3R A;  2RHB A;  3S1Q I;  3CCR Z;  5D1O A;  1RO0 A;  1WJ2 A;  2HU9 A;  2JA5 I;  3G6E Z;  2VPX A;  2JA8 I;  1YJ9 Z;  4E2X A;  2PMZ A;  3IX0 A;  4RVF A;  3S15 I;  1WCM I;  2J6A A;  3J80 b;  3EER A;  3CCQ 1;  1YUA A;  4A3C I;  1S7M A;  3MZL B;  2OTL 1;  2E2J I;  2NVY I;  3P5J B;  3CCV 1;  5C4X I;  1VQ7 Z;  1K9M 2;  3CCQ Z;  4A3E I;  4NBB A;  1VQN 1;  1FDI A;  5IP9 I;  1USP A;  1YIT Z;  3CQZ I;  1TFI A;  2R7Z I;  3BG1 B;  2QA4 1;  1YHQ Z;  3NFZ A;  3HOW I;  3I4N I;  5AN9 F;  4DQY B;  4Y52 I;  3CC2 Z;  3GTP I;  1NP6 A;  1PFT A;  5IT9 b;  2RBL A;  5T64 A;  2E7Z A;  1Q81 2;  4HGZ A;  1USP B;  4BY7 I;  3CCU Z;  3T4N B;  5FLX b;  5T67 A;  1YUK A;  1VQ9 1;  3CC2 1;  2OTJ Z;  3CC7 Z;  2JIQ A;  2JA7 I;  5LL6 f;  1Q81 1;  4HGY A;  2I3C A;  1YJN Z;  4NFR A;  2JS4 A;  1SIW A;  1S72 1;  1X3W A;  4MXU A;  1QF8 A;  4NOZ A;  4A3J I;  1VQM Z;  1VQ4 1;  4NBH A;  1VQK 1;  2VF1 A;  3NDI A;  2OOY B;  4RVH A;  1I6H I;  2M48 A;  3CCE Z;  1YI2 Z;  3CCM 1;  4E30 A;  1QYP A;  1S72 Z;  3LUS A;  3U50 C;  5C4J I;  3TDH B;  4RS4 A;  2JMO A;  3FQM A;  5C3E I;  2LEX A;  2OZK A;  1VQK Z;  4BY1 I;  3HOV I;  2RIQ A;  1WW9 A;  1RO2 A;  2VUG A;  3CCJ 1;  4XX2 A;  5IP7 I;  1DL6 A;  1P9N A;  2WAQ A;  2E2H I;  4A93 I;  2Q4Z A;  1Y8C A;  3J7A 4;  2JIP A;  3I56 1;  1VQ5 Z;  3FQQ A;  3CCS Z;  3S14 I;  1Q82 2;  1RNI A;  3IR7 A;  2R6M A;  4NBD A;  2F4O A;  2QRE B;  1Z01 A;  2JIO A;  3PO3 I;  3PO3 S;  1SFO I; 
#chains in the Genus database with same CATH homology
 3FKI I;  3CD6 1;  1VQP Z;  3J81 b;  3G4S Z;  1QVF Y;  1VQL 1;  3VTN A;  2QR1 B;  3KIH A;  1M90 1;  2ZAE B;  1NJI 1;  1ZB8 A;  2QRD B;  2G2K A;  2OOX B;  5D1O B;  1RLY A;  2NVQ I;  1K9M 1;  3CC4 Z;  4E2Z A;  1K73 2;  2QLV B;  2H85 A;  4MD7 A;  1RO4 A;  4QTU A;  4A3I I;  4MRI A;  3S1M I;  4HH4 A;  1M1K 1;  1QVG Z;  3JAM f;  3CC4 1;  1M90 2;  3F3P C;  2KI7 B;  3NDJ A;  4A3G I;  3CCR 1;  1QVF Z;  3GTM I;  3KIF A;  2YU9 I;  4NBG A;  3OW2 Z;  3H3V J;  4RVD A;  1N8R 2;  4BBR I;  3GTJ I;  3RZD I;  1Y1V S;  4A3K I;  2K5R A;  1YJW Z;  4A3M I;  3BG0 B;  4RV9 A;  2OTL Z;  5T6B A;  2NVT I;  1Y1W I;  3M3Y I;  1ML8 A;  1VQL Z;  3RZO I;  4DK1 A;  1Q7Y 1;  1VQ8 1;  2DE5 A;  1KQS Y;  1ZH1 A;  1VQO 1;  1QVG Y;  2O4H A;  3G71 1;  2V8I A;  4NH1 C;  3I55 1;  1TWH I;  1K8A 2;  5A2Q b;  2PK7 A;  3JAM b;  2JNY A;  4Y7N I;  2HF1 A;  4MH4 A;  1YJ9 1;  2WB1 A;  3GCF A;  3CMA Z;  3NH5 A;  2JR6 A;  1KC8 1;  2KPI A;  3CCV Z;  3VMG A;  3S1N I;  2YAD A;  2QEX Z;  2F4M A;  3CPW Z;  4A3D I;  2R92 I;  3VB9 A;  1TWA I;  2OTJ 1;  3CC7 1;  2R93 I;  3S16 I;  1VQN Z;  3CMA 1;  1TWF I;  1YIT 1;  3CME 1;  4NB9 A;  3VMI A;  1N8R 1;  1YHQ 1;  3F3F C;  2QA4 Z;  2V8K A;  4E33 A;  1Q7Y 2;  1KD1 1;  3GTO I;  2P3Y A;  4A3B I;  1VQO Z;  1Q86 2;  1N2F A;  2NVX I;  4MON A;  2PM9 A;  3HOU I;  3CME Z;  3S2D I;  3M4O I;  3ESW A;  4DGL A;  1TWG I;  2LFU A;  4NBC A;  1KRL A;  3EED A;  2AKL A;  3GTK I;  1I50 I;  1VQ9 Z;  3S2H I;  3GTL I;  4BXX I;  2IZ3 A;  5A2Q f;  1Z02 A;  1WII A;  2O53 A;  1KC8 2;  3S17 I;  1YJN 1;  3H0G I;  1VQM 1;  1VQ6 1;  1LQL A;  2E9H A;  1VQ5 1;  4E2W A;  1K8A 1;  3D6W A;  3J80 f;  2QEX 1;  2B63 I;  5C44 I;  1R9T I;  3CCM Z;  3CCL 1;  3I07 A;  5CM2 M;  2BJO A;  1VQ6 Z;  3D9X A;  1ZB9 A;  3PO2 I;  3CCU 1;  2EGT A;  2LIY A;  4X6A I;  4S1T A;  3CD6 Z;  2M6N A;  3IFU A;  3IF8 A;  2JUB A;  2W03 A;  3CXC Z;  1Q82 1;  3MZK B;  2E2I I;  4BBS I;  3CXC Y;  3CCJ Z;  4E2Y A;  2GTH A;  3I56 Z;  3J81 f;  1Q86 1;  4A3L I;  1VQ4 Z;  2QKD A;  5D1P A;  2VUM I;  1Z03 A;  3Q87 A;  1YIJ 1;  3HKZ A;  3CCE 1;  1YI2 1;  3GTM S;  4AYB A;  3HOZ I;  1W2B Y;  2IZ4 A;  3GTQ I;  3HOX I;  1M1K 2;  1VQP 1;  5FLX f;  4NBE A;  2GTI A;  2QRC B;  2V8J A;  1JJ2 Z;  1YIJ Z;  3GTG I;  3GKQ A;  1KQS Z;  3G4S 1;  3CCL Z;  1TWC I;  2DE7 A;  1RQF A;  3QWU A;  1K83 I;  2W04 A;  3HOY I;  3CCS 1;  4NB8 A;  3OW2 Y;  1L1O C;  2JA6 I;  4A3F I;  2GU2 A;  1Y1V I;  3G71 Z;  4E31 A;  3NH4 A;  3I55 Z;  1NUI A;  5IT9 f;  5FLM I;  4MD9 A;  1VLA A;  3MON A;  4NBA A;  2P28 A;  3VMH A;  1KD1 2;  4NBF A;  3TE5 B;  1X0T A;  4RVG A;  1JJ2 Y;  4E32 A;  1VQ7 1;  3NH8 A;  1YJW 1;  4MD8 A;  1X3Z A;  3CPW Y;  2RPR A;  3K7A I;  1W2B Z;  3I4M I;  4EWC A;  1NJI 2;  1VQ8 Z;  4QTT A;  3G6E 1;  4CL1 A;  1JWH C;  1I3Q I;  4TNU A;  3S1R I;  1K73 1;  2Y0S A;  2DE6 A;  2Q51 A;  2RT9 A;  2K3R A;  2RHB A;  3S1Q I;  5D1O A;  3CCR Z;  1RO0 A;  2HU9 A;  2JA5 I;  3G6E Z;  2JA8 I;  1YJ9 Z;  4E2X A;  2PMZ A;  3IX0 A;  4RVF A;  3S15 I;  1WCM I;  2J6A A;  3J80 b;  3EER A;  3CCQ 1;  1YUA A;  4A3C I;  1S7M A;  3MZL B;  2OTL 1;  2E2J I;  2NVY I;  3P5J B;  3CCV 1;  5C4X I;  1VQ7 Z;  1K9M 2;  3CCQ Z;  4A3E I;  4NBB A;  1VQN 1;  5IP9 I;  1USP A;  1YIT Z;  3CQZ I;  1TFI A;  2R7Z I;  3BG1 B;  2QA4 1;  1YHQ Z;  3NFZ A;  3HOW I;  3I4N I;  5AN9 F;  4DQY B;  4Y52 I;  3CC2 Z;  3GTP I;  1NP6 A;  1PFT A;  5IT9 b;  2RBL A;  5T64 A;  1Q81 2;  4HGZ A;  1USP B;  4BY7 I;  3CCU Z;  3T4N B;  5FLX b;  5T67 A;  1YUK A;  1VQ9 1;  3CC2 1;  2OTJ Z;  3CC7 Z;  2JA7 I;  5LL6 f;  1Q81 1;  4HGY A;  2I3C A;  1YJN Z;  4NFR A;  2JS4 A;  1S72 1;  1X3W A;  4MXU A;  1QF8 A;  4NOZ A;  4A3J I;  1VQM Z;  1VQ4 1;  4NBH A;  1VQK 1;  2VF1 A;  3NDI A;  2OOY B;  4RVH A;  1I6H I;  2M48 A;  3CCE Z;  1YI2 Z;  3CCM 1;  4E30 A;  1QYP A;  1S72 Z;  3LUS A;  3U50 C;  5C4J I;  3TDH B;  4RS4 A;  2JMO A;  3FQM A;  5C3E I;  2OZK A;  1VQK Z;  4BY1 I;  3HOV I;  2RIQ A;  1WW9 A;  1RO2 A;  2VUG A;  3CCJ 1;  4XX2 A;  5IP7 I;  1DL6 A;  1P9N A;  2WAQ A;  2E2H I;  4A93 I;  2Q4Z A;  3J7A 4;  3I56 1;  1VQ5 Z;  3FQQ A;  3CCS Z;  3S14 I;  1Q82 2;  1RNI A;  2R6M A;  4NBD A;  2F4O A;  2QRE B;  1Z01 A;  3PO3 I;  3PO3 S;  1SFO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...