4Y7BB

Factor xa complex with gtc000441
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
53
structure length
52
Chain Sequence
RKLCSLDNGDCDQFCHEEQNVVCSCARGYTLADNGKACIPTGPYPCGKQTLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Factor Xa inhibitors: S1 binding interactions of a series of N-{(3S)-1-[(1S)-1-methyl-2-morpholin-4-yl-2-oxoethyl]-2-oxopyrrolidin-3-yl}sulfonamides.
pubmed doi rcsb
molecule keywords Coagulation factor X
molecule tags Hydrolase
total genus 12
structure length 52
sequence length 53
ec nomenclature ec 3.4.21.6: Coagulation factor Xa.
pdb deposition date 2015-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00008 EGF EGF-like domain
B PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4y7bB00
3K9XA 4Z0LA 2WPLE 1HAEA 2Y5GL 1W7XL 4D0EA 1IOXA 1KLOA 1LPKA 1CEJA 3CS7L 1FJSL 1L3YA 1IQNL 3HPTA 4BXSA 1G1RA 2AYLA 3N8ZA 3OLUA 4X8SL 4XL1A 5CKMA 2Q1JB 4BTUA 1F0RB 4O1ZA 3P5BL 5CKNA 5F19A 3TH3L 2P16L 3V65B 1IGXA 2P26A 4X8VL 1CCVA 1LMJA 2VJ3A 2VVCK 2Y5HL 3NTGA 2K2SB 4RRWA 3Q3KB 3KL6B 1XKBA 3NJPC 4D90A 3QCWA 3LN1A 2WYGB 1YUFA 1G1TA 1MQ5L 5JVZA 2EI6B 1HRFA 5L30L 2YGOA 1EGFA 1TLEA 4A7IA 1PFXL 1N1IA 1XDTR 1FF7A 3QMOA 2I9BA 1MQ6L 4RRZA 1IQKL 2PHBB 2WFXB 3HS6A 2VWOL 2KV4A 1EQGA 4D0FA 1KLJL 4O02B 2WPHE 4Y7AB 1HAFA 1TPGA 2VVVL 2BOHA 4NA9L 2VH6B 2WG3C 2FZZL 2WPJE 2Y5FL 1FE2A 1AUTL 4BDXA 4RRYA 3LN0A 4BDWA 2OYUP 4OTJA 4G1MB 1F7MA 1EAIC 5JBBE 4ZHAB 3LTGD 2W2PE 1ATBA 3HO5A 1UZQA 2MHPA 3KQEL 1JV2B 4LORA 2UWLB 5CISA 5JVYA 1HX2A 2H9EL 1IQIL 2TGFA 1FSBA 3F6UL 3ZYGA 3GCWE 3U73A 3ASIA 1DX5I 3KQBL 5L2ZL 2WPME 5COXA 3BT1A 2KB9A 1CX2A 5KIRA 1FAKL 1KSNB 4Y6DB 4YZUB 4CUEA 1DDXA 2P3FL 2KL7A 3CA7A 1M1XB 1P0SL 1XKAL 2XBWL 3RR3A 1URKA 1IQJL 3KCGL 3TGFA 1V3XB 3FCSB 5F1AA 5KN5C 3NT1A 2EI7B 1ATDA 4TGFA 2XBXL 1PRHA 1WU1B 4ISIL 1FAXL 2W3KB 3LAQA 1CVWL 3FBYA 1L5GB 3SW2A 3POYA 2J4IB 3LIWB 2EI8B 4ZXXL 1Z6EL 4AQTA 3N8VA 1WHFA 2BOXA 2MGPA 3KQDL 4LMFA 1EMOA 2P95L 1JL9A 1KLIL 1ATAA 2JKHL 1IQEL 4Z6AL 4RUTA 3TK5B 5FDQA 5JB9E 3F1SB 2P3FN 3N8WA 5IKQA 3IJEB 2CJIB 1Z6CA 2OYEP 2P94L 1X7AL 2BQ7A 1NPEB 5L2YL 1P9JA 1U8CB 3IITB 1NFYB 3N8XA 1QFKL 4C16A 1NT0A 1DVAL 4Y71B 3HO4A 1LQDA 4JZEL 5JW1A 1LPGA 1APOA 1F0SB 2P3TA 1N7DA 1PGEA 1G1SA 2BQWA 1IQHL 2PUQL 2GD4A 4PH9A 1NZIA 1EQHA 1IGZA 4M11A 1TOZA 3LTFB 1EBVA 2WFTA 2WPKE 4BTTA 1XFEA 2W3IB 4COXA 2Y82B 1UZJA 1U67A 3BT2A 1J9CL 2XBVL 3MQEA 3LC3B 4ZXYL 2Y7XB 1BF9A 4MMXB 3NTBA 2J34B 2J38B 4ZH8B 1DQBA 3HO3A 4ZAEB 2F9BL 4YT7L 1SZBA 4X8UL 2W86A 4BTIA 1IQML 1C5MF 3C9AC 2FLGA 3LC5B 1PXXA 1EPIA 3OLTA 1NFUB 2BOUA 3EGFA 1LPZA 1B9WA 3KQCL 1NFXB 2J95B 1K37A 4RS0A 4YT6L 2XC0L 4BXWA 2P3UA 5JBCE 3ELAL 3ENSA 1EPJA 2FD6A 1ZAQA 2XC5L 3KRKA 3SOBB 2DDUA 3TZIA 2UWOB 2P28B 1O5DL 1IVOC 1OB1C 2M74A 4JYUL 3M36L 2NPRA 2PR3B 3M37L 3N8WB 2RA0L 2I9AA 1COUA 1EPGA 1G1QA 2ADXA 2BZ6L 4M10A 3TK6B 2XBYL 4Y7BB 3SOQA 1K36A 2VWMK 4CSYA 4RRXA 2W2NE 1HCGB 1W8BL 3QH0A 1F7EA 1DIYA 2WG4B 2W2QE 1JBUL 2Y80B 2G00L 2VWNL 4JYVL 4X8TL 2RHPA 3H5CB 2J2UB 3N8YA 1FFMA 4MMYB 2W26B 1IQLL 2FLRL 2D1JB 4XBMA 3R05A 3GCXE 1UZPA 1IOEL 4CUDA 2VH0B 3DEMA 1YUGA 1IQFL 1I0UA 2Y38A 4Y79B 3CFWA 1HJ7A 1CVUA 1EZQB 3KK6A 4E1GA 2Y7ZB 5I46L 3TBDA 2Y81B 1G2LB 4FM5A 3ZYJB 5IKVA 1ADXA 4XLWA 5IKTA 2WYJB 4MMZB 2UWPB 2P93L 1HT5A 1EMNA 2B7DL 3V64C 5E8DA 3Q7DA 2MGRA 1HREA 3GISX 1IQGL 5JB8E 4JZDL 2XC4L 1ATEA 1KIGL 4Z0KB 1CCFA 1MOXC 2WPIE 1HT8A 1NFWB 4NG9L 5CKQA 2BOKL 1UZKA 1CQEA 2W2ME 2BMGA 3CENL 2YGPA 1YGCL 4OTYA 1HZ8A 1GK5A 1APQA 5JBAE 1RFNB 1PTHA 2W2OE 6COXA 4ISHL 2BO2A 2K2TA 2VWLL 2VVUL 3U7UG 3HS5A 2FLBL 1IJQA 3FFGL 5IKRA 3PGHA 3ZYIB 2J94B 4Y76B 1NQLB 3N8YB 4CUFA 3SOVA 5K0HB 1YO8A 1WHEA 2RNLA 5EGMB 1G2MB 3HS7A 1IP0A 1YUKB 4JZFL 1EPHA 1A3PA 2BQ6A 1Q4GA 4NGAL 3BPSE 3MDLA
chains in the Genus database with same CATH superfamily
3K9XA 4Z0LA 2WPLE 1HAEA 2Y5GL 4GU3A 1W7XL 4D0EA 1IOXA 1KLOA 1LPKA 1CEJA 3CS7L 1FJSL 1L3YA 1IQNL 3HPTA 4BXSA 1G1RA 2AYLA 3N8ZA 3OLUA 4X8SL 4XL1A 5CKMA 2Q1JB 4BTUA 1F0RB 4O1ZA 3P5BL 5CKNA 5F19A 2YGQA 3TH3L 2P16L 3V65B 1IGXA 2P26A 4X8VL 1CCVA 1LMJA 2VJ3A 2VVCK 2Y5HL 3NTGA 2K2SB 4RRWA 3Q3KB 3KL6B 1XKBA 3NJPC 4D90A 3QCWA 3LN1A 2WYGB 1YUFA 1G1TA 1MQ5L 5JVZA 2EI6B 1HRFA 5L30L 2YGOA 1EGFA 1TLEA 4A7IA 1PFXL 1N1IA 1XDTR 1FF7A 2H9EC 3QMOA 2I9BA 1MQ6L 4RRZA 1IQKL 2PHBB 2WFXB 3HS6A 2VWOL 2KV4A 1EQGA 4D0FA 1KLJL 4O02B 2WPHE 4Y7AB 1HAFA 1TPGA 1QIUA 2VVVL 2BOHA 4NA9L 2VH6B 2WG3C 2FZZL 2WPJE 2Y5FL 1FE2A 1AUTL 4BDXA 4RRYA 3LN0A 4BDWA 2OYUP 4OTJA 4G1MB 1F7MA 1EAIC 5JBBE 4ZHAB 3LTGD 2W2PE 1ATBA 3HO5A 1UZQA 2MHPA 3KQEL 1JV2B 4LORA 2UWLB 5CISA 5JVYA 1HX2A 4GU4A 2H9EL 1IQIL 1V1HA 2TGFA 2HORA 1FSBA 3F6UL 3ZYGA 3GCWE 3U73A 3ASIA 1DX5I 2JJLA 3KQBL 5L2ZL 2WPME 5COXA 3BT1A 2KB9A 1CX2A 5KIRA 1FAKL 1KSNB 4Y6DB 4YZUB 4CUEA 1DDXA 2P3FL 2KL7A 3CA7A 1M1XB 1P0SL 1XKAL 2XBWL 3RR3A 1URKA 1IQJL 3KCGL 3TGFA 1V3XB 3FCSB 5F1AA 5KN5C 3NT1A 2EI7B 1ATDA 4TGFA 2XBXL 1PRHA 1WU1B 4ISIL 1FAXL 2W3KB 3LAQA 1CVWL 3FBYA 1L5GB 3SW2A 3POYA 2J4IB 3LIWB 2EI8B 4ZXXL 1Z6EL 4AQTA 3N8VA 1WHFA 2BOXA 2MGPA 2BT8A 3KQDL 4LMFA 1EMOA 2P95L 1JL9A 2KNIA 1KLIL 1ATAA 2JKHL 1IQEL 4Z6AL 4RUTA 3TK5B 5FDQA 5JB9E 3F1SB 2P3FN 3N8WA 5IKQA 3IJEB 2CJIB 1Z6CA 2OYEP 2P94L 1X7AL 2BQ7A 1NPEB 5L2YL 1P9JA 1U8CB 3IITB 1NFYB 3N8XA 1QFKL 4C16A 1NT0A 1DVAL 4Y71B 3HO4A 1LQDA 4JZEL 5JW1A 1LPGA 1APOA 1F0SB 2P3TA 1N7DA 1PGEA 1G1SA 2BSFA 2BQWA 1IQHL 2PUQL 2GD4A 4PH9A 1NZIA 1EQHA 1IGZA 4M11A 2WZPP 1TOZA 3LTFB 1EBVA 2WFTA 2WPKE 4BTTA 1XFEA 2W3IB 4COXA 2Y82B 1UZJA 1U67A 3BT2A 1J9CL 2XBVL 3MQEA 3LC3B 4ZXYL 2Y7XB 1KKEA 1BF9A 4MMXB 2HOXA 3NTBA 2J34B 2J38B 4ZH8B 1DQBA 3HO3A 4ZAEB 2F9BL 4YT7L 1SZBA 4X8UL 2W86A 4BTIA 1IQML 1C5MF 3C9AC 2FLGA 3LC5B 1PXXA 1EPIA 3OLTA 1NFUB 2BOUA 3EGFA 1LPZA 1B9WA 3KQCL 1NFXB 2J95B 1K37A 1LK9A 4RS0A 4YT6L 2XC0L 4BXWA 2P3UA 5JBCE 3ELAL 3ENSA 1EPJA 2FD6A 1ZAQA 2XC5L 3KRKA 3SOBB 2DDUA 3TZIA 2UWOB 2P28B 1O5DL 1IVOC 1OB1C 2M74A 4JYUL 3M36L 2NPRA 2PR3B 3M37L 3N8WB 2RA0L 2I9AA 1COUA 1EPGA 1G1QA 2ADXA 2BZ6L 4M10A 3TK6B 2XBYL 2VRSA 4Y7BB 3SOQA 1K36A 2VWMK 4CSYA 4RRXA 2W2NE 1HCGB 1W8BL 3QH0A 1F7EA 1DIYA 2WG4B 2W2QE 1JBUL 2Y80B 2G00L 2VWNL 4JYVL 4X8TL 1LMMA 1V1IA 2RHPA 3H5CB 2J2UB 1FFMA 3N8YA 4MMYB 2W26B 1IQLL 2FLRL 2D1JB 4XBMA 3R05A 3GCXE 1UZPA 1IOEL 4CUDA 2VH0B 3DEMA 1YUGA 1IQFL 1I0UA 2Y38A 4Y79B 3CFWA 1HJ7A 1CVUA 1EZQB 3KK6A 4E1GA 2Y7ZB 5I46L 3TBDA 2Y81B 1G2LB 4FM5A 3ZYJB 5IKVA 1ADXA 4XLWA 5IKTA 3S6XA 2WYJB 4MMZB 2UWPB 2BT7A 2P93L 1HT5A 1EMNA 2B7DL 3V64C 5E8DA 3Q7DA 2MGRA 1HREA 3GISX 1IQGL 5JB8E 4JZDL 2XC4L 1ATEA 1KIGL 4Z0KB 1CCFA 1MOXC 2WPIE 1HT8A 1NFWB 4NG9L 5CKQA 2BOKL 1UZKA 1CQEA 2W2ME 2BMGA 3CENL 2YGPA 1YGCL 4OTYA 1HZ8A 1GK5A 1APQA 5JBAE 1RFNB 1PTHA 2W2OE 6COXA 4ISHL 2BO2A 2K2TA 2VWLL 4A94C 2VVUL 3U7UG 3HS5A 2FLBL 1IJQA 3FFGL 5IKRA 3PGHA 3ZYIB 2J94B 4Y76B 1NQLB 3N8YB 4CUFA 3SOVA 5K0HB 1YO8A 1WHEA 2RNLA 5EGMB 1G2MB 3HS7A 1IP0A 1YUKB 4JZFL 1EPHA 1A3PA 2BQ6A 1Q4GA 4NGAL 3BPSE 3MDLA
chains in the Genus database with same CATH topology
3K9XA 4Z0LA 2WPLE 1HAEA 2Y5GL 1W7XL 4D0EA 1IOXA 1KLOA 1LPKA 1CEJA 3CS7L 1FJSL 1L3YA 1IQNL 3HPTA 4BXSA 1G1RA 2AYLA 3N8ZA 3OLUA 4X8SL 4XL1A 5CKMA 2Q1JB 4BTUA 1F0RB 4O1ZA 3P5BL 5CKNA 5F19A 2YGQA 3TH3L 2P16L 3V65B 1IGXA 2P26A 4X8VL 1CCVA 1LMJA 2VJ3A 2VVCK 2Y5HL 3NTGA 2K2SB 4RRWA 3Q3KB 3KL6B 1XKBA 3NJPC 4D90A 3QCWA 3LN1A 2WYGB 1YUFA 1G1TA 1MQ5L 5JVZA 2EI6B 1HRFA 5L30L 2YGOA 1EGFA 1TLEA 4A7IA 1PFXL 1N1IA 1XDTR 1FF7A 2H9EC 3QMOA 2I9BA 1MQ6L 4RRZA 1IQKL 2PHBB 2WFXB 3HS6A 2VWOL 2KV4A 1EQGA 4D0FA 1KLJL 4O02B 2WPHE 4Y7AB 1HAFA 1TPGA 2VVVL 2BOHA 4NA9L 2VH6B 2WG3C 2FZZL 2WPJE 2Y5FL 1FE2A 1AUTL 4BDXA 4RRYA 3LN0A 4BDWA 2OYUP 4OTJA 4G1MB 1F7MA 1EAIC 5JBBE 4ZHAB 3LTGD 2W2PE 1ATBA 3HO5A 1UZQA 2MHPA 3KQEL 1JV2B 4LORA 2UWLB 5CISA 5JVYA 1HX2A 2H9EL 1IQIL 2TGFA 1FSBA 3F6UL 3ZYGA 3GCWE 3U73A 3ASIA 1DX5I 3KQBL 5L2ZL 2WPME 5COXA 3BT1A 2KB9A 1CX2A 5KIRA 1FAKL 1KSNB 4Y6DB 4YZUB 4CUEA 1DDXA 2P3FL 2KL7A 3CA7A 1M1XB 1P0SL 1XKAL 2XBWL 3RR3A 1URKA 1IQJL 3KCGL 3TGFA 1V3XB 3FCSB 5F1AA 5KN5C 3NT1A 2EI7B 1ATDA 4TGFA 2XBXL 1PRHA 1WU1B 4ISIL 1FAXL 2W3KB 3LAQA 1CVWL 3FBYA 1L5GB 3SW2A 3POYA 2J4IB 3LIWB 2EI8B 4ZXXL 1Z6EL 4AQTA 3N8VA 1WHFA 2BOXA 2MGPA 3KQDL 4LMFA 1EMOA 2P95L 1JL9A 2KNIA 1KLIL 1ATAA 2JKHL 1IQEL 4Z6AL 4RUTA 3TK5B 5FDQA 5JB9E 3F1SB 2P3FN 3N8WA 5IKQA 3IJEB 2CJIB 1Z6CA 2OYEP 2P94L 1X7AL 2BQ7A 1NPEB 5L2YL 1P9JA 1U8CB 3IITB 1NFYB 3N8XA 1QFKL 4C16A 1NT0A 1DVAL 4Y71B 3HO4A 1LQDA 4JZEL 5JW1A 1LPGA 1APOA 1F0SB 2P3TA 1N7DA 1PGEA 1G1SA 2BQWA 1IQHL 2PUQL 2GD4A 4PH9A 1NZIA 1EQHA 1IGZA 4M11A 2WZPP 1TOZA 3LTFB 1EBVA 2WFTA 2WPKE 4BTTA 1XFEA 2W3IB 4COXA 2Y82B 1UZJA 1U67A 3BT2A 1J9CL 2XBVL 3MQEA 3LC3B 4ZXYL 2Y7XB 1BF9A 4MMXB 3NTBA 2J34B 2J38B 4ZH8B 1DQBA 3HO3A 4ZAEB 2F9BL 4YT7L 1SZBA 4X8UL 2W86A 4BTIA 1IQML 1C5MF 3C9AC 2FLGA 3LC5B 1PXXA 1EPIA 3OLTA 1NFUB 2BOUA 3EGFA 1LPZA 1B9WA 3KQCL 1NFXB 2J95B 1K37A 4RS0A 4YT6L 2XC0L 4BXWA 2P3UA 5JBCE 3ELAL 3ENSA 1EPJA 2FD6A 1ZAQA 2XC5L 3KRKA 3SOBB 2DDUA 3TZIA 2UWOB 2P28B 1O5DL 1IVOC 1OB1C 2M74A 4JYUL 3M36L 2NPRA 2PR3B 3M37L 3N8WB 2RA0L 2I9AA 1COUA 1EPGA 1G1QA 2ADXA 2BZ6L 4M10A 3TK6B 2XBYL 4Y7BB 3SOQA 1K36A 2VWMK 4CSYA 4RRXA 2W2NE 1HCGB 1W8BL 3QH0A 1F7EA 1DIYA 2WG4B 2W2QE 1JBUL 2Y80B 2G00L 2VWNL 4JYVL 4X8TL 1LMMA 2RHPA 3H5CB 2J2UB 3N8YA 1FFMA 4MMYB 2W26B 1IQLL 2FLRL 2D1JB 4XBMA 3R05A 3GCXE 1UZPA 1IOEL 4CUDA 2VH0B 3DEMA 1YUGA 1IQFL 1I0UA 2Y38A 4Y79B 3CFWA 1HJ7A 1CVUA 1EZQB 3KK6A 4E1GA 2Y7ZB 5I46L 3TBDA 2Y81B 1G2LB 4FM5A 3ZYJB 5IKVA 1ADXA 4XLWA 5IKTA 3S6XA 2WYJB 4MMZB 2UWPB 2P93L 1HT5A 1EMNA 2B7DL 3V64C 5E8DA 3Q7DA 2MGRA 1HREA 3GISX 1IQGL 5JB8E 4JZDL 2XC4L 1ATEA 1KIGL 4Z0KB 1CCFA 1MOXC 2WPIE 1HT8A 1NFWB 4NG9L 5CKQA 2BOKL 1UZKA 1CQEA 2W2ME 2BMGA 3CENL 2YGPA 1YGCL 4OTYA 1HZ8A 1GK5A 1APQA 5JBAE 1RFNB 1PTHA 2W2OE 6COXA 4ISHL 2BO2A 2K2TA 2VWLL 4A94C 2VVUL 3U7UG 3HS5A 2FLBL 1IJQA 3FFGL 5IKRA 3PGHA 3ZYIB 2J94B 4Y76B 1NQLB 3N8YB 4CUFA 3SOVA 5K0HB 1YO8A 1WHEA 2RNLA 5EGMB 1G2MB 3HS7A 1IP0A 1YUKB 4JZFL 1EPHA 1A3PA 2BQ6A 1Q4GA 4NGAL 3BPSE 3MDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9X A;  4Z0L A;  2WPL E;  1HAE A;  2Y5G L;  1W7X L;  4D0E A;  1IOX A;  1KLO A;  1LPK A;  1CEJ A;  3CS7 L;  1FJS L;  1L3Y A;  1IQN L;  3HPT A;  4BXS A;  1G1R A;  2AYL A;  3N8Z A;  3OLU A;  4X8S L;  4XL1 A;  5CKM A;  2Q1J B;  4BTU A;  1F0R B;  4O1Z A;  3P5B L;  5CKN A;  5F19 A;  3TH3 L;  2P16 L;  3V65 B;  1IGX A;  2P26 A;  4X8V L;  1CCV A;  1LMJ A;  2VJ3 A;  2VVC K;  2Y5H L;  3NTG A;  2K2S B;  4RRW A;  3Q3K B;  3KL6 B;  1XKB A;  3NJP C;  4D90 A;  3QCW A;  3LN1 A;  2WYG B;  1YUF A;  1G1T A;  1MQ5 L;  5JVZ A;  2EI6 B;  1HRF A;  5L30 L;  2YGO A;  1EGF A;  1TLE A;  4A7I A;  1PFX L;  1N1I A;  1XDT R;  1FF7 A;  3QMO A;  2I9B A;  1MQ6 L;  4RRZ A;  1IQK L;  2PHB B;  2WFX B;  3HS6 A;  2VWO L;  2KV4 A;  1EQG A;  4D0F A;  1KLJ L;  4O02 B;  2WPH E;  4Y7A B;  1HAF A;  1TPG A;  2VVV L;  2BOH A;  4NA9 L;  2VH6 B;  2WG3 C;  2FZZ L;  2WPJ E;  2Y5F L;  1FE2 A;  1AUT L;  4BDX A;  4RRY A;  3LN0 A;  4BDW A;  2OYU P;  4OTJ A;  4G1M B;  1F7M A;  1EAI C;  5JBB E;  4ZHA B;  3LTG D;  2W2P E;  1ATB A;  3HO5 A;  1UZQ A;  2MHP A;  3KQE L;  1JV2 B;  4LOR A;  2UWL B;  5CIS A;  5JVY A;  1HX2 A;  2H9E L;  1IQI L;  2TGF A;  1FSB A;  3F6U L;  3ZYG A;  3GCW E;  3U73 A;  3ASI A;  1DX5 I;  3KQB L;  5L2Z L;  2WPM E;  5COX A;  3BT1 A;  2KB9 A;  1CX2 A;  5KIR A;  1FAK L;  1KSN B;  4Y6D B;  4YZU B;  4CUE A;  1DDX A;  2P3F L;  2KL7 A;  3CA7 A;  1M1X B;  1P0S L;  1XKA L;  2XBW L;  3RR3 A;  1URK A;  1IQJ L;  3KCG L;  3TGF A;  1V3X B;  3FCS B;  5F1A A;  5KN5 C;  3NT1 A;  2EI7 B;  1ATD A;  4TGF A;  2XBX L;  1PRH A;  1WU1 B;  4ISI L;  1FAX L;  2W3K B;  3LAQ A;  1CVW L;  3FBY A;  1L5G B;  3SW2 A;  3POY A;  2J4I B;  3LIW B;  2EI8 B;  4ZXX L;  1Z6E L;  4AQT A;  3N8V A;  1WHF A;  2BOX A;  2MGP A;  3KQD L;  4LMF A;  1EMO A;  2P95 L;  1JL9 A;  1KLI L;  1ATA A;  2JKH L;  1IQE L;  4Z6A L;  4RUT A;  3TK5 B;  5FDQ A;  5JB9 E;  3F1S B;  2P3F N;  3N8W A;  5IKQ A;  3IJE B;  2CJI B;  1Z6C A;  2OYE P;  2P94 L;  1X7A L;  2BQ7 A;  1NPE B;  5L2Y L;  1P9J A;  1U8C B;  3IIT B;  1NFY B;  3N8X A;  1QFK L;  4C16 A;  1NT0 A;  1DVA L;  4Y71 B;  3HO4 A;  1LQD A;  4JZE L;  5JW1 A;  1LPG A;  1APO A;  1F0S B;  2P3T A;  1N7D A;  1PGE A;  1G1S A;  2BQW A;  1IQH L;  2PUQ L;  2GD4 A;  4PH9 A;  1NZI A;  1EQH A;  1IGZ A;  4M11 A;  1TOZ A;  3LTF B;  1EBV A;  2WFT A;  2WPK E;  4BTT A;  1XFE A;  2W3I B;  4COX A;  2Y82 B;  1UZJ A;  1U67 A;  3BT2 A;  1J9C L;  2XBV L;  3MQE A;  3LC3 B;  4ZXY L;  2Y7X B;  1BF9 A;  4MMX B;  3NTB A;  2J34 B;  2J38 B;  4ZH8 B;  1DQB A;  3HO3 A;  4ZAE B;  2F9B L;  4YT7 L;  1SZB A;  4X8U L;  2W86 A;  4BTI A;  1IQM L;  1C5M F;  3C9A C;  2FLG A;  3LC5 B;  1PXX A;  1EPI A;  3OLT A;  1NFU B;  2BOU A;  3EGF A;  1LPZ A;  1B9W A;  3KQC L;  1NFX B;  2J95 B;  1K37 A;  4RS0 A;  4YT6 L;  2XC0 L;  4BXW A;  2P3U A;  5JBC E;  3ELA L;  3ENS A;  1EPJ A;  2FD6 A;  1ZAQ A;  2XC5 L;  3KRK A;  3SOB B;  2DDU A;  3TZI A;  2UWO B;  2P28 B;  1O5D L;  1IVO C;  1OB1 C;  2M74 A;  4JYU L;  3M36 L;  2NPR A;  2PR3 B;  3M37 L;  3N8W B;  2RA0 L;  2I9A A;  1COU A;  1EPG A;  1G1Q A;  2ADX A;  2BZ6 L;  4M10 A;  3TK6 B;  2XBY L;  4Y7B B;  3SOQ A;  1K36 A;  2VWM K;  4CSY A;  4RRX A;  2W2N E;  1HCG B;  1W8B L;  3QH0 A;  1F7E A;  1DIY A;  2WG4 B;  2W2Q E;  1JBU L;  2Y80 B;  2G00 L;  2VWN L;  4JYV L;  4X8T L;  2RHP A;  3H5C B;  2J2U B;  3N8Y A;  1FFM A;  4MMY B;  2W26 B;  1IQL L;  2FLR L;  2D1J B;  4XBM A;  3R05 A;  3GCX E;  1UZP A;  1IOE L;  4CUD A;  2VH0 B;  3DEM A;  1YUG A;  1IQF L;  1I0U A;  2Y38 A;  4Y79 B;  3CFW A;  1HJ7 A;  1CVU A;  1EZQ B;  3KK6 A;  4E1G A;  2Y7Z B;  5I46 L;  3TBD A;  2Y81 B;  1G2L B;  4FM5 A;  3ZYJ B;  5IKV A;  1ADX A;  4XLW A;  5IKT A;  2WYJ B;  4MMZ B;  2UWP B;  2P93 L;  1HT5 A;  1EMN A;  2B7D L;  3V64 C;  5E8D A;  3Q7D A;  2MGR A;  1HRE A;  3GIS X;  1IQG L;  5JB8 E;  4JZD L;  2XC4 L;  1ATE A;  1KIG L;  4Z0K B;  1CCF A;  1MOX C;  2WPI E;  1HT8 A;  1NFW B;  4NG9 L;  5CKQ A;  2BOK L;  1UZK A;  1CQE A;  2W2M E;  2BMG A;  3CEN L;  2YGP A;  1YGC L;  4OTY A;  1HZ8 A;  1GK5 A;  1APQ A;  5JBA E;  1RFN B;  1PTH A;  2W2O E;  6COX A;  4ISH L;  2BO2 A;  2K2T A;  2VWL L;  2VVU L;  3U7U G;  3HS5 A;  2FLB L;  1IJQ A;  3FFG L;  5IKR A;  3PGH A;  3ZYI B;  2J94 B;  4Y76 B;  1NQL B;  3N8Y B;  4CUF A;  3SOV A;  5K0H B;  1YO8 A;  1WHE A;  2RNL A;  5EGM B;  1G2M B;  3HS7 A;  1IP0 A;  1YUK B;  4JZF L;  1EPH A;  1A3P A;  2BQ6 A;  1Q4G A;  4NGA L;  3BPS E;  3MDL A; 
#chains in the Genus database with same CATH topology
 3K9X A;  4Z0L A;  2WPL E;  1HAE A;  2Y5G L;  4GU3 A;  1W7X L;  4D0E A;  1IOX A;  1KLO A;  1LPK A;  1CEJ A;  3CS7 L;  1FJS L;  1L3Y A;  1IQN L;  3HPT A;  4BXS A;  1G1R A;  2AYL A;  3N8Z A;  3OLU A;  4X8S L;  4XL1 A;  5CKM A;  2Q1J B;  4BTU A;  1F0R B;  4O1Z A;  3P5B L;  5CKN A;  5F19 A;  2YGQ A;  3TH3 L;  2P16 L;  3V65 B;  1IGX A;  2P26 A;  4X8V L;  1CCV A;  1LMJ A;  2VJ3 A;  2VVC K;  2Y5H L;  3NTG A;  2K2S B;  4RRW A;  3Q3K B;  3KL6 B;  1XKB A;  3NJP C;  4D90 A;  3QCW A;  3LN1 A;  2WYG B;  1YUF A;  1G1T A;  1MQ5 L;  5JVZ A;  2EI6 B;  1HRF A;  5L30 L;  2YGO A;  1EGF A;  1TLE A;  4A7I A;  1PFX L;  1N1I A;  1XDT R;  1FF7 A;  2H9E C;  3QMO A;  2I9B A;  1MQ6 L;  4RRZ A;  1IQK L;  2PHB B;  2WFX B;  3HS6 A;  2VWO L;  2KV4 A;  1EQG A;  4D0F A;  1KLJ L;  4O02 B;  2WPH E;  4Y7A B;  1HAF A;  1TPG A;  1QIU A;  2VVV L;  2BOH A;  4NA9 L;  2VH6 B;  2WG3 C;  2FZZ L;  2WPJ E;  2Y5F L;  1FE2 A;  1AUT L;  4BDX A;  4RRY A;  3LN0 A;  4BDW A;  2OYU P;  4OTJ A;  4G1M B;  1F7M A;  1EAI C;  5JBB E;  4ZHA B;  3LTG D;  2W2P E;  1ATB A;  3HO5 A;  1UZQ A;  2MHP A;  3KQE L;  1JV2 B;  4LOR A;  2UWL B;  5CIS A;  5JVY A;  1HX2 A;  4GU4 A;  2H9E L;  1IQI L;  1V1H A;  2TGF A;  2HOR A;  1FSB A;  3F6U L;  3ZYG A;  3GCW E;  3U73 A;  3ASI A;  1DX5 I;  2JJL A;  3KQB L;  5L2Z L;  2WPM E;  5COX A;  3BT1 A;  2KB9 A;  1CX2 A;  5KIR A;  1FAK L;  1KSN B;  4Y6D B;  4YZU B;  4CUE A;  1DDX A;  2P3F L;  2KL7 A;  3CA7 A;  1M1X B;  1P0S L;  1XKA L;  2XBW L;  3RR3 A;  1URK A;  1IQJ L;  3KCG L;  3TGF A;  1V3X B;  3FCS B;  5F1A A;  5KN5 C;  3NT1 A;  2EI7 B;  1ATD A;  4TGF A;  2XBX L;  1PRH A;  1WU1 B;  4ISI L;  1FAX L;  2W3K B;  3LAQ A;  1CVW L;  3FBY A;  1L5G B;  3SW2 A;  3POY A;  2J4I B;  3LIW B;  2EI8 B;  4ZXX L;  1Z6E L;  4AQT A;  3N8V A;  1WHF A;  2BOX A;  2MGP A;  2BT8 A;  3KQD L;  4LMF A;  1EMO A;  2P95 L;  1JL9 A;  2KNI A;  1KLI L;  1ATA A;  2JKH L;  1IQE L;  4Z6A L;  4RUT A;  3TK5 B;  5FDQ A;  5JB9 E;  3F1S B;  2P3F N;  3N8W A;  5IKQ A;  3IJE B;  2CJI B;  1Z6C A;  2OYE P;  2P94 L;  1X7A L;  2BQ7 A;  1NPE B;  5L2Y L;  1P9J A;  1U8C B;  3IIT B;  1NFY B;  3N8X A;  1QFK L;  4C16 A;  1NT0 A;  1DVA L;  4Y71 B;  3HO4 A;  1LQD A;  4JZE L;  5JW1 A;  1LPG A;  1APO A;  1F0S B;  2P3T A;  1N7D A;  1PGE A;  1G1S A;  2BSF A;  2BQW A;  1IQH L;  2PUQ L;  2GD4 A;  4PH9 A;  1NZI A;  1EQH A;  1IGZ A;  4M11 A;  2WZP P;  1TOZ A;  3LTF B;  1EBV A;  2WFT A;  2WPK E;  4BTT A;  1XFE A;  2W3I B;  4COX A;  2Y82 B;  1UZJ A;  1U67 A;  3BT2 A;  1J9C L;  2XBV L;  3MQE A;  3LC3 B;  4ZXY L;  2Y7X B;  1KKE A;  1BF9 A;  4MMX B;  2HOX A;  3NTB A;  2J34 B;  2J38 B;  4ZH8 B;  1DQB A;  3HO3 A;  4ZAE B;  2F9B L;  4YT7 L;  1SZB A;  4X8U L;  2W86 A;  4BTI A;  1IQM L;  1C5M F;  3C9A C;  2FLG A;  3LC5 B;  1PXX A;  1EPI A;  3OLT A;  1NFU B;  2BOU A;  3EGF A;  1LPZ A;  1B9W A;  3KQC L;  1NFX B;  2J95 B;  1K37 A;  1LK9 A;  4RS0 A;  4YT6 L;  2XC0 L;  4BXW A;  2P3U A;  5JBC E;  3ELA L;  3ENS A;  1EPJ A;  2FD6 A;  1ZAQ A;  2XC5 L;  3KRK A;  3SOB B;  2DDU A;  3TZI A;  2UWO B;  2P28 B;  1O5D L;  1IVO C;  1OB1 C;  2M74 A;  4JYU L;  3M36 L;  2NPR A;  2PR3 B;  3M37 L;  3N8W B;  2RA0 L;  2I9A A;  1COU A;  1EPG A;  1G1Q A;  2ADX A;  2BZ6 L;  4M10 A;  3TK6 B;  2XBY L;  2VRS A;  4Y7B B;  3SOQ A;  1K36 A;  2VWM K;  4CSY A;  4RRX A;  2W2N E;  1HCG B;  1W8B L;  3QH0 A;  1F7E A;  1DIY A;  2WG4 B;  2W2Q E;  1JBU L;  2Y80 B;  2G00 L;  2VWN L;  4JYV L;  4X8T L;  1LMM A;  1V1I A;  2RHP A;  3H5C B;  2J2U B;  1FFM A;  3N8Y A;  4MMY B;  2W26 B;  1IQL L;  2FLR L;  2D1J B;  4XBM A;  3R05 A;  3GCX E;  1UZP A;  1IOE L;  4CUD A;  2VH0 B;  3DEM A;  1YUG A;  1IQF L;  1I0U A;  2Y38 A;  4Y79 B;  3CFW A;  1HJ7 A;  1CVU A;  1EZQ B;  3KK6 A;  4E1G A;  2Y7Z B;  5I46 L;  3TBD A;  2Y81 B;  1G2L B;  4FM5 A;  3ZYJ B;  5IKV A;  1ADX A;  4XLW A;  5IKT A;  3S6X A;  2WYJ B;  4MMZ B;  2UWP B;  2BT7 A;  2P93 L;  1HT5 A;  1EMN A;  2B7D L;  3V64 C;  5E8D A;  3Q7D A;  2MGR A;  1HRE A;  3GIS X;  1IQG L;  5JB8 E;  4JZD L;  2XC4 L;  1ATE A;  1KIG L;  4Z0K B;  1CCF A;  1MOX C;  2WPI E;  1HT8 A;  1NFW B;  4NG9 L;  5CKQ A;  2BOK L;  1UZK A;  1CQE A;  2W2M E;  2BMG A;  3CEN L;  2YGP A;  1YGC L;  4OTY A;  1HZ8 A;  1GK5 A;  1APQ A;  5JBA E;  1RFN B;  1PTH A;  2W2O E;  6COX A;  4ISH L;  2BO2 A;  2K2T A;  2VWL L;  4A94 C;  2VVU L;  3U7U G;  3HS5 A;  2FLB L;  1IJQ A;  3FFG L;  5IKR A;  3PGH A;  3ZYI B;  2J94 B;  4Y76 B;  1NQL B;  3N8Y B;  4CUF A;  3SOV A;  5K0H B;  1YO8 A;  1WHE A;  2RNL A;  5EGM B;  1G2M B;  3HS7 A;  1IP0 A;  1YUK B;  4JZF L;  1EPH A;  1A3P A;  2BQ6 A;  1Q4G A;  4NGA L;  3BPS E;  3MDL A; 
#chains in the Genus database with same CATH homology
 3K9X A;  4Z0L A;  2WPL E;  1HAE A;  2Y5G L;  1W7X L;  4D0E A;  1IOX A;  1KLO A;  1LPK A;  1CEJ A;  3CS7 L;  1FJS L;  1L3Y A;  1IQN L;  3HPT A;  4BXS A;  1G1R A;  2AYL A;  3N8Z A;  3OLU A;  4X8S L;  4XL1 A;  5CKM A;  2Q1J B;  4BTU A;  1F0R B;  4O1Z A;  3P5B L;  5CKN A;  5F19 A;  2YGQ A;  3TH3 L;  2P16 L;  3V65 B;  1IGX A;  2P26 A;  4X8V L;  1CCV A;  1LMJ A;  2VJ3 A;  2VVC K;  2Y5H L;  3NTG A;  2K2S B;  4RRW A;  3Q3K B;  3KL6 B;  1XKB A;  3NJP C;  4D90 A;  3QCW A;  3LN1 A;  2WYG B;  1YUF A;  1G1T A;  1MQ5 L;  5JVZ A;  2EI6 B;  1HRF A;  5L30 L;  2YGO A;  1EGF A;  1TLE A;  4A7I A;  1PFX L;  1N1I A;  1XDT R;  1FF7 A;  2H9E C;  3QMO A;  2I9B A;  1MQ6 L;  4RRZ A;  1IQK L;  2PHB B;  2WFX B;  3HS6 A;  2VWO L;  2KV4 A;  1EQG A;  4D0F A;  1KLJ L;  4O02 B;  2WPH E;  4Y7A B;  1HAF A;  1TPG A;  2VVV L;  2BOH A;  4NA9 L;  2VH6 B;  2WG3 C;  2FZZ L;  2WPJ E;  2Y5F L;  1FE2 A;  1AUT L;  4BDX A;  4RRY A;  3LN0 A;  4BDW A;  2OYU P;  4OTJ A;  4G1M B;  1F7M A;  1EAI C;  5JBB E;  4ZHA B;  3LTG D;  2W2P E;  1ATB A;  3HO5 A;  1UZQ A;  2MHP A;  3KQE L;  1JV2 B;  4LOR A;  2UWL B;  5CIS A;  5JVY A;  1HX2 A;  2H9E L;  1IQI L;  2TGF A;  1FSB A;  3F6U L;  3ZYG A;  3GCW E;  3U73 A;  3ASI A;  1DX5 I;  3KQB L;  5L2Z L;  2WPM E;  5COX A;  3BT1 A;  2KB9 A;  1CX2 A;  5KIR A;  1FAK L;  1KSN B;  4Y6D B;  4YZU B;  4CUE A;  1DDX A;  2P3F L;  2KL7 A;  3CA7 A;  1M1X B;  1P0S L;  1XKA L;  2XBW L;  3RR3 A;  1URK A;  1IQJ L;  3KCG L;  3TGF A;  1V3X B;  3FCS B;  5F1A A;  5KN5 C;  3NT1 A;  2EI7 B;  1ATD A;  4TGF A;  2XBX L;  1PRH A;  1WU1 B;  4ISI L;  1FAX L;  2W3K B;  3LAQ A;  1CVW L;  3FBY A;  1L5G B;  3SW2 A;  3POY A;  2J4I B;  3LIW B;  2EI8 B;  4ZXX L;  1Z6E L;  4AQT A;  3N8V A;  1WHF A;  2BOX A;  2MGP A;  3KQD L;  4LMF A;  1EMO A;  2P95 L;  1JL9 A;  2KNI A;  1KLI L;  1ATA A;  2JKH L;  1IQE L;  4Z6A L;  4RUT A;  3TK5 B;  5FDQ A;  5JB9 E;  3F1S B;  2P3F N;  3N8W A;  5IKQ A;  3IJE B;  2CJI B;  1Z6C A;  2OYE P;  2P94 L;  1X7A L;  2BQ7 A;  1NPE B;  5L2Y L;  1P9J A;  1U8C B;  3IIT B;  1NFY B;  3N8X A;  1QFK L;  4C16 A;  1NT0 A;  1DVA L;  4Y71 B;  3HO4 A;  1LQD A;  4JZE L;  5JW1 A;  1LPG A;  1APO A;  1F0S B;  2P3T A;  1N7D A;  1PGE A;  1G1S A;  2BQW A;  1IQH L;  2PUQ L;  2GD4 A;  4PH9 A;  1NZI A;  1EQH A;  1IGZ A;  4M11 A;  2WZP P;  1TOZ A;  3LTF B;  1EBV A;  2WFT A;  2WPK E;  4BTT A;  1XFE A;  2W3I B;  4COX A;  2Y82 B;  1UZJ A;  1U67 A;  3BT2 A;  1J9C L;  2XBV L;  3MQE A;  3LC3 B;  4ZXY L;  2Y7X B;  1BF9 A;  4MMX B;  3NTB A;  2J34 B;  2J38 B;  4ZH8 B;  1DQB A;  3HO3 A;  4ZAE B;  2F9B L;  4YT7 L;  1SZB A;  4X8U L;  2W86 A;  4BTI A;  1IQM L;  1C5M F;  3C9A C;  2FLG A;  3LC5 B;  1PXX A;  1EPI A;  3OLT A;  1NFU B;  2BOU A;  3EGF A;  1LPZ A;  1B9W A;  3KQC L;  1NFX B;  2J95 B;  1K37 A;  4RS0 A;  4YT6 L;  2XC0 L;  4BXW A;  2P3U A;  5JBC E;  3ELA L;  3ENS A;  1EPJ A;  2FD6 A;  1ZAQ A;  2XC5 L;  3KRK A;  3SOB B;  2DDU A;  3TZI A;  2UWO B;  2P28 B;  1O5D L;  1IVO C;  1OB1 C;  2M74 A;  4JYU L;  3M36 L;  2NPR A;  2PR3 B;  3M37 L;  3N8W B;  2RA0 L;  2I9A A;  1COU A;  1EPG A;  1G1Q A;  2ADX A;  2BZ6 L;  4M10 A;  3TK6 B;  2XBY L;  4Y7B B;  3SOQ A;  1K36 A;  2VWM K;  4CSY A;  4RRX A;  2W2N E;  1HCG B;  1W8B L;  3QH0 A;  1F7E A;  1DIY A;  2WG4 B;  2W2Q E;  1JBU L;  2Y80 B;  2G00 L;  2VWN L;  4JYV L;  4X8T L;  1LMM A;  2RHP A;  3H5C B;  2J2U B;  3N8Y A;  1FFM A;  4MMY B;  2W26 B;  1IQL L;  2FLR L;  2D1J B;  4XBM A;  3R05 A;  3GCX E;  1UZP A;  1IOE L;  4CUD A;  2VH0 B;  3DEM A;  1YUG A;  1IQF L;  1I0U A;  2Y38 A;  4Y79 B;  3CFW A;  1HJ7 A;  1CVU A;  1EZQ B;  3KK6 A;  4E1G A;  2Y7Z B;  5I46 L;  3TBD A;  2Y81 B;  1G2L B;  4FM5 A;  3ZYJ B;  5IKV A;  1ADX A;  4XLW A;  5IKT A;  3S6X A;  2WYJ B;  4MMZ B;  2UWP B;  2P93 L;  1HT5 A;  1EMN A;  2B7D L;  3V64 C;  5E8D A;  3Q7D A;  2MGR A;  1HRE A;  3GIS X;  1IQG L;  5JB8 E;  4JZD L;  2XC4 L;  1ATE A;  1KIG L;  4Z0K B;  1CCF A;  1MOX C;  2WPI E;  1HT8 A;  1NFW B;  4NG9 L;  5CKQ A;  2BOK L;  1UZK A;  1CQE A;  2W2M E;  2BMG A;  3CEN L;  2YGP A;  1YGC L;  4OTY A;  1HZ8 A;  1GK5 A;  1APQ A;  5JBA E;  1RFN B;  1PTH A;  2W2O E;  6COX A;  4ISH L;  2BO2 A;  2K2T A;  2VWL L;  4A94 C;  2VVU L;  3U7U G;  3HS5 A;  2FLB L;  1IJQ A;  3FFG L;  5IKR A;  3PGH A;  3ZYI B;  2J94 B;  4Y76 B;  1NQL B;  3N8Y B;  4CUF A;  3SOV A;  5K0H B;  1YO8 A;  1WHE A;  2RNL A;  5EGM B;  1G2M B;  3HS7 A;  1IP0 A;  1YUK B;  4JZF L;  1EPH A;  1A3P A;  2BQ6 A;  1Q4G A;  4NGA L;  3BPS E;  3MDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...