4YBMA

Crystal structure of trim24 phd-bromodomain complexed with n-{6-[3-(benzyloxy)phenoxy]-1,3-dimethyl-2-oxo-2,3-dihydro-1h-1,3-benzodiazol-5-yl}-3,4-dimethoxybenzene-1-sulfonamide (7b)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
183
structure length
177
Chain Sequence
PNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Guided Design of IACS-9571, a Selective High-Affinity Dual TRIM24-BRPF1 Bromodomain Inhibitor.
pubmed doi rcsb
molecule keywords Transcription intermediary factor 1-alpha
molecule tags Transcription/transcription inhibitor
source organism Homo sapiens
total genus 52
structure length 177
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4ybmA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ybmA01
1WEPA 1X0JA 4WHUA 2PNXA 3M63A 4CFLA 4O77A 2LGLA 4BW4A 3P1EA 5EGUA 1JM7B 5ETBA 1F68A 4ZQLA 4O72A 5TRBA 5FH7A 3TLPA 1DVPA 5A83A 3U5MA 2IDAA 2KR4A 3DAIA 4IOQA 4QYDA 5CP5A 5AD2A 3LRQA 4O7CA 3MXFA 1X4JA 5CPEA 4LK9A 1BORA 4XI1A 4NXJA 5DLXA 1LDJB 3SVFA 2DVSA 2YEMA 4B86C 4QR4A 2YDWA 3HMFA 4QSTA 4A9LA 4UIXA 5D3RA 3ASLA 1FP0A 4HBXA 2MIQA 5CU8A 5F25A 2K1JA 4OGIA 4XY9A 4YABA 5I7YA 5TCMA 5HQ6A 2KIZA 4AKNA 5ENCA 4CUSA 5HFQA 2CKLB 2YQDA 2Y43A 4LKAA 5C13A 5E9IA 2LQ6A 2CT2A 4OUFA 4QEWA 5EPSA 5IGKA 5A82A 4L7XA 3P5OA 5FH6A 5G4RA 1HYJA 5D3PA 2M1RA 3U5NA 4QSVA 2YSMA 5CUAA 2KWOA 1CHCA 3ZYQA 4CUPA 5A5PA 2D8SA 2DVQA 4N4GA 1JM4B 4IR6A 4IORA 4BW1A 3SOUA 2C2VS 5LKUA 4J1PA 5CUDA 4NUCA 3EB5A 2H0DA 4O70A 5FE4A 2KWJA 5I3LA 5HENA 2ECNA 4QF3A 3QZVA 2LGVA 5IGNA 4NN2A 5A85A 1U6GB 5TB6A 3ZYUA 5JI8A 2KFTA 4UI9B 1V87A 5D3JA 2DVVA 4QC3A 5HRWA 5LJ1A 4B7YC 3JVKA 4MEOA 2L5UA 2G45A 2OSSA 5I89A 5L98A 4C67A 2L75A 2XEUA 5LJ0A 5B76A 5EP7A 1F62A 5ENEA 5DKHA 2YT5A 4ZDTA 2LN0A 4GB0A 4LR6A 3I3JA 5CQ7A 5CQ4A 5A81A 2HDPA 4F52B 5I86A 4YYKA 3U5OA 3T6RA 5ENGA 5FG5A 4IR3A 4E96A 4S3OC 4QR5A 4Z1SA 4YAXA 4BHWA 4MR5A 5HEMA 4KV4A 5BT3A 4QSWA 2KREA 1T1HA 2ECWA 4PTBA 3O37A 5EV9A 4Q0NA 5FG6A 4WIVA 4YBTA 4LC2A 4S3OB 4N4HA 4LRGA 5CS8A 5I1QA 1E6IA 4J0SA 4MR4A 3M99A 2LGGA 4ZUXU 3KV6A 4YY6A 1WFKA 5G05B 5TABA 5E3DA 5FH8A 3L11A 4RVRA 1JSPB 4IR5A 5KH7A 4O76A 5A5SA 2ECIA 4AYCB 1WGMA 5JWMA 5J3XA 5II2A 4O64A 4NR8A 3MB3A 5DFDA 4Z93A 2YELA 3ZVZB 4YYIA 4CFKA 5E9YA 4BW2A 2JMJA 2D82A 4QSRA 5CY9A 5E9VA 5BT5A 5AITA 4UIUA 4A9HA 4R2YA 4L58A 4QF2A 3ZNIA 2QJ0A 5KU3A 2CSYA 5J0DA 5D3NA 2WP1A 5TDWA 1WESA 2RO1A 3N9OA 5D7XA 5FE9A 3SVHA 5FEYA 4FLPA 4NR5A 4A9IA 4NR4A 5I88A 5F1LA 4CCGX 5AMEA 4NR6A 5E74A 3UW9A 2NAAA 2YYRA 2RSDA 4Q6FA 4W4UA 4LZ2A 4TT4A 4ALGA 4QSPA 4NYVA 3LXJA 2M85A 5CRMA 3RTRB 5DFBA 4N3WA 1Z6UA 2G4AA 1WILA 3I2DA 2M3HA 5E9MA 3NG2A 1VYXA 4MR3A 5D1KB 3N9MA 3JVLA 5EICA 2VPGA 4UIYA 4A9NA 3ZTGA 2VPEA 4O7EA 3KNVA 5LVRA 5A5RA 5E9KA 2MD7B 5F63A 3MHSA 5B78A 3MHHA 4UYEA 3UVWA 4NR9A 1WEQA 2EODA 5F2PA 4TU4A 1WUGA 5A5QA 3Q2FA 4X3GA 1JM7A 5EPBA 2KWNA 2YU4A 4LDFA 4TTEA 5F62A 2MNZA 4AVXA 1X4IA 4O7BA 4PCIA 4YADA 2OUOA 2D9EA 2R0SA 4QUUA 4XY8A 3DPLR 4Z6HA 3DQVR 2F6JA 4NUDA 4A9EA 4IR4A 5CQTA 2FUIA 5G04B 1G25A 2K17A 4QY4A 5I29A 4I7DA 1ZS5A 5FG4A 3PHDA 1N72A 4QBMA 5LVQA 3RCWA 4TT2A 5EQ1A 5FE0A 5DKAA 4HXMA 3LJWA 2R0YA 3AQAA 4NQNA 4HBWA 5FE5A 4NR7A 3ONIA 4DONA 2CKLA 5EWVA 4AUQB 5A5NA 2DVRA 4J0RA 5DYXA 4GNDA 2L84A 5IGLA 4ZW1A 2JRJA 5B8DA 4NYWA 4OGJA 4NRAA 1K2FA 4UYHA 4O75A 3HTKC 4MENA 1WEUA 5DYUA 5D26A 4A9KA 2KWKA 3N9LA 5CQ8A 4TU6A 2G6QA 3IHPA 4QSXA 2R0VA 5DX4A 2DATA 4BBQA 4WHWA 4YYDA 2K16A 3M62A 2BAYA 5D3LA 4IC2A 2MA6A 3NXBA 4FIPA 5DY7A 5KH3A 5KTUA 3U5PA 5C7NA 5HCLA 4A9FA 4XUBA 5CZGA 5C87A 2VJEB 3N9NA 2H60A 5DKDA 4O71A 1RMDA 4Z6IA 4TKPB 3LQHA 2YYNA 3L1ZB 1WEWA 1FBVA 5DYCA 5HQ7A 5D1LB 3JVJA 2LRIC 4YH3A 2VNFA 5CTLA 5CQ6A 3UVDA 4MR6A 4YBMA 3IU5A 2LXPC 4HXSA 5LUUA 5L96A 3RPGC 2AN6A 5F36A 5EISA 5ENFA 5FERA 5DW2A 5C85A 5EWCA 5ETDA 5G0FA 2YW5A 4CUUA 5EU1A 4NUEA 5FBXA 5KTWA 2JMDA 5CRZA 4BJXA 5FE2A 3GV4A 4QEVA 4LYSA 5FE6A 5HQ5A 1VFYA 2LXHC 4UIWA 4HXNA 5L97A 5FE1A 3KV5A 4A49A 3RPGB 3HMHA 3Q2EA 4QYLA 5FFWA 2RNYA 2E6RA 5EVAA 5EWDA 3C5KA 4P5OB 5EA1A 4V3KC 4YYMA 4YYNA 2MT5A 3GL6A 5F3AA 3SOXA 2C2LA 4TZ2A 2YSJA 4Y03A 2ECGA 4UYFB 2OO1A 5I80A 5AD3A 5E0RA 4V3LC 3AADA 5E7DA 3UVYA 2VJFB 4GPJA 5DINA 5D1MB 5EK9A 2MNYA 4NQMA 5HFRA 2JMIA 4AYCA 2RNXA 2N9GA 2E6SA 2XB1A 5LKTA 2E3KA 5B79A 3ZVYA 2KGIA 5II1A 1XWHA 5LKZA 4KV1A 2QIZA 5F60A 4YYJA 2ECTA 3MULA 5C89A 4IOOA 4YK0A 2QICA 4I7CA 4UP5A 2KTBB 4HXKA 1WEOA 3MQMA 3VK6A 4WA6A 4F3IA 4YBSA 4FO9A 4TS8A 3U5JA 2Y1MA 3C6WA 4PPEA 1LDKC 4J3IA 4PCEA 1WEMA 3MB4A 2YUCA 2FSAA 5E73A 2NXBA 2VP7A 5LCWB 2YEKA 5EI4A 3DWYA 4A9MA 5COIA 2VPBA 4WZ0A 4UITA 5HRXA 2MJVB 4O74A 2ECJA 3G0LA 2KGGA 2Y1NA 3P1DA 4HXLA 2FUUA 4A4BA 5B75A 5G4SA 5EYAF 3UV4A 2L0BA 5JG6A 2R10A 2L85A 5DFCA 5IBNA 3HMEA 5E9LA 3JVMA 4HBVA 5ENIA 1MM3A 4UIVA 4HBYA 4TZ8A 3ZPVE 5H1UA 2G43A 3P1FA 4YATA 4O78A 5CQ5A 4CL9A 4GNGA 2YW8A 2GRCA 5CGPA 5CFWA 5FFYA 4Q0OA 1IYMA 4LZRA 5L99A 4LYIA 4X2IA 5AIUA 3T7LA 3HCUA 4A0CD 4FK5A 2LSPB 1WEVA 5D3HA 4YY4A 3S92A 2H0DB 5EWWA 2PUYA 4LJNA 5TDRA 5FE3A 4ALHA 2LGKA 2M6MA 5DLZA 3S91A 5L8TA 5EWHA 5BT4A 2YURA 5KH9A 2L5EA 1N87A 2DKWA 5ACYA 2ECVA 4CA1A 1WEEA 4UYDA 3MUKA 5DYAA 3L1XA 5I83A 5KHMA 3N9PA 1WE9A 5D25A 4N4FA 4R8PK 4UP0A 3P1CA 5HELA 4PKLA 3O70A 5L8UA 5F1HA 2E7NA 5F61A 2EA6A 2UZGA 4GNFA 5ENHA 3FKMX 5IIDA 5IGMA 3HCSA 4FJCA 3N9QA 4PS5A 4A4CA 3SVGA 5HM0A 2E7OA 5CUGA 3O7AA 5CUEA 3GG3A 3K2JA 4QZSA 4QR3A 5FB0A 2RS9B 4HXRA 5CUCA 3O35A 2RNWA 2YREA 3PURA 4MEPA 4PY6A 2YQLA 5KTXA 5HJCA 4TT6A 2K4DA 4CUQA 3U5KA 5LKXA 2MA5A 4QSQA 5C11A 5I7XA 4C66A 2RI7A 4QNSA 5K29A 1Z60A 4LLBA 5FE8A 2KU3A 2YHNA 4I7BA 2OXQC 4QB3A 4YYHA 3UV5A 4QSUA 2VJEA 1ZBDB 1WIMA 4HXPA 5D3TA 5HRVA 2F6NA 3V43A 4IC3A 4Z1QA 4MEQA 5F5ZA 5C8GA 4NRBA 5FFVA 4CUTA 4MSXA 4NYXA 1VD4A 2DWWA 3LQIA 4NRCA 4XUAA 4YC9A 2MUMA 1X4UA 4CLBA 3G0JA 4QEUA 5TBNA 3KQIA 5DBMA 4WZ3B 5FB1A 3SHBA 4A9JA 3ZPV1 2KE1A 3SOWA 2LDRA 2ZETC 2I7KA 2HYED 3PUQA 5H85A 4CURA 5I40A 5D0CA 3O34A 2I50A 4GNEA 5AMFA 5H1TA 4WZ2A 5DKCA 4N4IA 5HLSA 1HYIA 4O7AA 4R7EA 1EQFA 2L80A 5EPRA 2MD8C 2WP2A 4A9OA 2RFJA 5H1VA 5KO4A 2EGPA 3UV2A 3LQJA 4ZC9A 4TYLA 3O33A 3QZTA 4NS5A 4UYGA 4BW3A 5A5OA 5LJ2A 2CSZA 5FDZA 5DW1A 2KYUA 3QZSA 4MVTA 5ENBA 4LADB 3U5LA 5CUBA 2YQMA 3UVXA 4C9ZA 4UYFA 3EB6A 4QC1A 4QSSA 5ENJA 5FE7A 2VJFA 5D24A 3D7CA 5A7CA 5E3GA 3HCTA 2YHOA 2VPDA 2F42A 2I8NA 4XYAA 5CQAA 4QUTA 4AP4A 4O7FA 3O36A 4LZSA 2LV9A 1WENA 1E4UA 5EM3A 2L43A 3IU6A 5D3SA 5CQ3A 4YYGA 4HXOA 4YH4A 5H9MA 5B77A 1JOCA 1MM2A 3FL2A 5C4QA 1Z2QA 1WUMA 5IG6A 4TQNA 4UIZA 4KCXA 4LYWA 2DX8A
chains in the Genus database with same CATH superfamily
1WEPA 1X0JA 4WHUA 2PNXA 3M63A 4CFLA 4O77A 2LGLA 4BW4A 3P1EA 5EGUA 1JM7B 4AKHA 5ETBA 1F68A 4ZQLA 4O72A 5TRBA 5FH7A 3TLPA 1DVPA 5A83A 3U5MA 2IDAA 2XP0A 2KR4A 3JUEA 3DAIA 4IOQA 4QYDA 5CP5A 5AD2A 3LRQA 4O7CA 3MXFA 1X4JA 5CPEA 4LK9A 1BORA 4XI1A 4NXJA 5DLXA 1LDJB 3SVFA 2DVSA 2YEMA 4B86C 4QR4A 2YDWA 3HMFA 4QSTA 4A9LA 4UIXA 5D3RA 3ASLA 1FP0A 4HBXA 2MIQA 5CU8A 5F25A 2K1JA 4OGIA 4XY9A 4YABA 5I7YA 3DWDA 5SVIB 5TCMA 5HQ6A 2KIZA 3LJUX 4AKNA 5ENCA 4CUSA 5HFQA 2CKLB 2YQDA 2Y43A 4LKAA 5C13A 5E9IA 2LQ6A 2CT2A 4OUFA 4QEWA 5EPSA 5IGKA 5A82A 4L7XA 3P5OA 5FH6A 5G4RA 1HYJA 5D3PA 2M1RA 3U5NA 4QSVA 2YSMA 5CUAA 2KWOA 1CHCA 3ZYQA 4CUPA 5A5PA 2D8SA 4AI6A 2DVQA 4N4GA 2FD4A 1JM4B 4IR6A 4IORA 4BW1A 3SOUA 2C2VS 5LKUA 4J1PA 5CUDA 2E61A 4NUCA 3EB5A 2H0DA 4O70A 5FE4A 2KWJA 5I3LA 3D1DA 5HENA 2ECNA 4QF3A 3QZVA 2LGVA 5IGNA 4NN2A 5A85A 1U6GB 2L7PA 5TB6A 3ZYUA 5JI8A 2KFTA 4UI9B 1V87A 5D3JA 2DVVA 4QC3A 5HRWA 5LJ1A 2RR4A 4B7YC 3JVKA 4MEOA 2L5UA 2G45A 2OSSA 5I89A 5L98A 4C67A 2L75A 2XEUA 5LJ0A 5B76A 5EP7A 1F62A 5ENEA 5DKHA 2YT5A 4ZDTA 2LN0A 4GB0A 4LR6A 3I3JA 5CQ7A 5CQ4A 5A81A 4AKGA 2HDPA 4F52B 5I86A 4YYKA 3U5OA 3T6RA 5ENGA 5FG5A 4IR3A 4E96A 2CRRA 4S3OC 4QR5A 4Z1SA 4OGEA 4YAXA 4BHWA 4MR5A 5HEMA 4KV4A 5BT3A 4QSWA 2CSVA 2KREA 1T1HA 2ECWA 4PTBA 3O37A 5EV9A 2KKXA 4Q0NA 5FG6A 4WIVA 4YBTA 4LC2A 4S3OB 4N4HA 4LRGA 3KDEC 1E4UA 5CS8A 5I1QA 1E6IA 4J0SA 4MR4A 3M99A 2LGGA 4ZUXU 3KV6A 4YY6A 1WFKA 5G05B 5TABA 5E3DA 5FH8A 3L11A 4RVRA 1JSPB 4IR5A 5KH7A 4O76A 5A5SA 2ECIA 4AYCB 1WGMA 5JWMA 5J3XA 5II2A 4O64A 3H7HA 4NR8A 3MB3A 5DFDA 4Z93A 2YELA 3ZVZB 4YYIA 4CFKA 5E9YA 4BW2A 2JMJA 2D82A 4QSRA 5CY9A 5E9VA 5BT5A 5AITA 4UIUA 4A9HA 4R2YA 3M7KA 4L58A 4QF2A 3ZNIA 2QJ0A 5KU3A 2CSYA 5J0DA 5D3NA 2WP1A 5TDWA 1WESA 2RO1A 3N9OA 5D7XA 5FE9A 3SVHA 5FEYA 4FLPA 4NR5A 4A9IA 4NR4A 5I88A 3FANA 5F1LA 2XOCA 4CCGX 5AMEA 4NR6A 5E74A 3UW9A 2NAAA 2YYRA 3VKGA 2RSDA 4Q6FA 4W4UA 4LZ2A 4TT4A 4ALGA 2XOZA 4QSPA 4NYVA 3LXJA 2M85A 5CRMA 3RTRB 5DFBA 4N3WA 1Z6UA 2G4AA 1WILA 3I2DA 2M3HA 5E9MA 3NG2A 3MDBC 1VYXA 1DCQA 4MR3A 2IQJA 5D1KB 3N9MA 3JVLA 5EICA 2VPGA 4UIYA 4A9NA 3ZTGA 2VPEA 4O7EA 2DSMA 3KNVA 5LVRA 5A5RA 5E9KA 2MD7B 5F63A 3MHSA 5B78A 3MHHA 4UYEA 3UVWA 4NR9A 1WEQA 2JUNA 4AKIA 3O47A 2EODA 5F2PA 4TU4A 1WUGA 5A5QA 3Q2FA 4X3GA 1JM7A 5EPBA 2KWNA 2JM3A 4LDFA 4TTEA 5F62A 2MNZA 2YU4A 1X4IA 4AVXA 5SVYA 4O7BA 4PCIA 4YADA 2OUOA 2D9EA 2R0SA 4QUUA 4XY8A 3DPLR 4Z6HA 3DQVR 2F6JA 4NUDA 4A9EA 4IR4A 5CQTA 2FUIA 5G04B 1G25A 2K17A 4QY4A 5I29A 2EXUA 1ZS5A 4I7DA 5FG4A 3PHDA 3LDYA 1N72A 4QBMA 5LVQA 3RCWA 1ZKRA 4TT2A 5EQ1A 5FE0A 5DKAA 4HXMA 3LJWA 2R0YA 3AQAA 2LAUA 5SVIA 4NQNA 4HBWA 5FE5A 4NR7A 3ONIA 4DONA 2CKLA 5EWVA 4AUQB 1PUOA 3ERRA 2DVRA 5A5NA 4J0RA 5DYXA 4GNDA 4OGCA 2L84A 5IGLA 4ZW1A 2JRJA 5B8DA 4NYWA 4OGJA 4NRAA 1K2FA 4UYHA 4O75A 2B0OE 3HTKC 4MENA 1WEUA 2MKEA 5DYUA 5D26A 4A9KA 2KWKA 3N9LA 5CQ8A 4TU6A 2G6QA 3IHPA 4QSXA 2R0VA 5DX4A 2DATA 4BBQA 4WHWA 4YYDA 2K16A 3M62A 2BAYA 5D3LA 4IC2A 2MA6A 3NXBA 4FIPA 5DY7A 5KH3A 2KKYA 5KTUA 3U5PA 5C7NA 5HCLA 4A9FA 4XUBA 5CZGA 5C87A 2VJEB 3N9NA 2H60A 5DKDA 3T9KA 4O71A 1RMDA 4Z6IA 4TKPB 3LQHA 2YYNA 2P57A 3L1ZB 1WEWA 1FBVA 5DYCA 5HQ7A 5D1LB 3JVJA 2LRIC 4YH3A 2VNFA 5CTLA 5CQ6A 3UVDA 4MR6A 4YBMA 3IU5A 2LXPC 4HXSA 5LUUA 2YVRA 5L96A 3RPGC 2AN6A 5F36A 5EISA 5ENFA 5FERA 5DW2A 5C85A 5EWCA 5ETDA 5G0FA 2YW5A 4CUUA 5EU1A 2D8UA 4NUEA 5FBXA 5KTWA 2JMDA 5CRZA 4BJXA 5FE2A 3GV4A 4QEVA 4LYSA 5FE6A 5HQ5A 1VFYA 2LXHC 4UIWA 4HXNA 5L97A 5FE1A 3KV5A 4A49A 3RPGB 3HMHA 3Q2EA 4QYLA 5FFWA 2RNYA 2E6RA 5EVAA 5EWDA 3C5KA 4P5OB 5EA1A 4V3KC 4YYMA 4YYNA 2MT5A 3GL6A 5F3AA 3SOXA 2C2LA 4TZ2A 2YSJA 4Y03A 2ECGA 4UYFB 2OO1A 5I80A 5AD3A 5E0RA 4V3LC 3AADA 5E7DA 3UVYA 2VJFB 3SUBA 4GPJA 5DINA 5D1MB 5EK9A 2MNYA 2CONA 4NQMA 5HFRA 2JMIA 4AYCA 2RNXA 2N9GA 2E6SA 2XB1A 5LKTA 2E3KA 5B79A 3ZVYA 2KGIA 5II1A 1XWHA 5LKZA 4KV1A 2QIZA 5F60A 4YYJA 2ECTA 3MULA 5C89A 4IOOA 4YK0A 2QICA 4I7CA 4UP5A 2KTBB 4HXKA 1WEOA 3MQMA 3VK6A 3FEHA 4WA6A 4F3IA 4YBSA 4FO9A 4TS8A 3U5JA 2Y1MA 3C6WA 4PPEA 1LDKC 4J3IA 4PCEA 1WEMA 3LVQE 3MB4A 2YUCA 2FSAA 5E73A 2NXBA 2VP7A 5LCWB 2YEKA 5EI4A 3DWYA 4A9MA 5COIA 2VPBA 3E2DA 3FM8C 4WZ0A 4UITA 5HRXA 2MJVB 4O74A 2ECJA 3G0LA 2KGGA 2Y1NA 3P1DA 4HXLA 2FUUA 4A4BA 5B75A 5G4SA 5EYAF 3UV4A 2L0BA 5JG6A 2R10A 2L85A 5DFCA 5IBNA 3HMEA 5E9LA 3JVMA 4HBVA 5ENIA 1MM3A 4UIVA 4HBYA 4TZ8A 3ZPVE 5H1UA 2G43A 3P1FA 4YATA 4O78A 5CQ5A 4CL9A 4GNGA 2YW8A 2GRCA 5CGPA 5CFWA 5FFYA 4Q0OA 4Z0RA 1IYMA 4LZRA 5L99A 4LYIA 4X2IA 5AIUA 3T7LA 3HCUA 4A0CD 4FK5A 2LSPB 1WEVA 5D3HA 4YY4A 3S92A 2EGMA 5EWWA 2H0DB 2PUYA 4LJNA 4Z0OA 5TDRA 5FE3A 4ALHA 2LGKA 3PLWA 2M6MA 5DLZA 3S91A 5L8TA 5EWHA 5BT4A 2YURA 5KH9A 2L5EA 1N87A 2DKWA 5ACYA 2ECVA 4CA1A 1WEEA 4UYDA 3MUKA 5DYAA 3L1XA 5I83A 5KHMA 3N9PA 1WE9A 5D25A 4N4FA 4R8PK 4UP0A 3P1CA 5HELA 4PKLA 3O70A 5L8UA 5F1HA 2E7NA 5F61A 3D1BA 2EA6A 2UZGA 4GNFA 5ENHA 3FKMX 5IIDA 5IGMA 3HCSA 4FJCA 3N9QA 4PS5A 4A4CA 3SVGA 5HM0A 2E7OA 5CUGA 3O7AA 5CUEA 3GG3A 3K2JA 4QZSA 4QR3A 5FB0A 2RS9B 4QQ4A 2EJNA 4HXRA 5CUCA 3O35A 2RNWA 2YREA 3PURA 4MEPA 4PY6A 2YQLA 5KTXA 5HJCA 4TT6A 2K4DA 3Q1DA 4CUQA 3U5KA 5LKXA 2MA5A 4QSQA 2DJAA 2OWAA 5I7XA 4C66A 5SVXA 5C11A 2RI7A 4QNSA 5K29A 1Z60A 4LLBA 5FE8A 2KU3A 2YHNA 4I7BA 2OXQC 3VKHA 4QB3A 4YYHA 3UV5A 4QSUA 4O62A 2VJEA 1ZBDB 1WIMA 4HXPA 2CRWA 5D3TA 5HRVA 2F6NA 3V43A 4IC3A 4Z1QA 4MEQA 5F5ZA 5C8GA 4NRBA 5FFVA 4CUTA 4MSXA 3FAOA 4NYXA 1VD4A 2DWWA 3LQIA 4NRCA 4XUAA 4YC9A 2MUMA 1X4UA 4CLBA 3G0JA 4QEUA 5TBNA 3KQIA 5DBMA 4WZ3B 5FB1A 3SHBA 4A9JA 3ZPV1 2KE1A 3SOWA 2LDRA 4F1PA 2ZETC 2I7KA 2HYED 3PUQA 5H85A 4CURA 5I40A 1MBMA 5D0CA 3O34A 4H9DA 2I50A 4GNEA 5AMFA 5H1TA 4WZ2A 5DKCA 4N4IA 5HLSA 1HYIA 4O7AA 2M13A 1EQFA 4R7EA 2L80A 5EPRA 2MD8C 2WP2A 4A9OA 2RFJA 5H1VA 5KO4A 2EGPA 3UV2A 3LQJA 4ZC9A 4TYLA 3O33A 3QZTA 4NS5A 4UYGA 4BW3A 5A5OA 5LJ2A 2CSZA 5FDZA 5DW1A 2KYUA 3QZSA 4MVTA 5ENBA 4LADB 3U5LA 5CUBA 2YQMA 3UVXA 2XOYA 4C9ZA 4UYFA 3EB6A 4QC1A 4QSSA 5ENJA 5FE7A 2VJFA 5D24A 3D7CA 5A7CA 5E3GA 3HCTA 2YHOA 2VPDA 2F42A 2I8NA 4XYAA 5CQAA 4QUTA 4AP4A 4O7FA 3O36A 4LZSA 2LV9A 1WENA 3DDTA 3FJUB 5EM3A 2L43A 3IU6A 5D3SA 5CQ3A 4YYGA 4HXOA 5K3QA 4YH4A 5H9MA 5B77A 1JOCA 1MM2A 3FL2A 5C4QA 1Z2QA 1WUMA 2FFWA 5IG6A 3LVRE 4TQNA 4UIZA 4KCXA 4LYWA 2DX8A
chains in the Genus database with same CATH topology
1WEPA 1X0JA 4WHUA 2PNXA 3M63A 4CFLA 4O77A 2LGLA 4BW4A 3P1EA 5EGUA 1JM7B 5ETBA 1F68A 4ZQLA 4O72A 5TRBA 5FH7A 3TLPA 1DVPA 5A83A 3U5MA 2IDAA 2KR4A 3DAIA 4IOQA 4QYDA 5CP5A 5AD2A 3LRQA 4O7CA 3MXFA 1X4JA 5CPEA 4LK9A 1BORA 4XI1A 4NXJA 5DLXA 1LDJB 3SVFA 2DVSA 2YEMA 4B86C 4QR4A 2YDWA 3HMFA 4QSTA 4A9LA 4UIXA 5D3RA 3ASLA 1FP0A 4HBXA 2MIQA 5CU8A 5F25A 2K1JA 4OGIA 4XY9A 4YABA 5I7YA 5TCMA 5HQ6A 2KIZA 4AKNA 5ENCA 4CUSA 5HFQA 2CKLB 2YQDA 2Y43A 4LKAA 5C13A 5E9IA 2LQ6A 2CT2A 4OUFA 4QEWA 5EPSA 5IGKA 5A82A 4L7XA 3P5OA 5FH6A 5G4RA 1HYJA 5D3PA 2M1RA 3U5NA 4QSVA 2YSMA 5CUAA 2KWOA 1CHCA 3ZYQA 4CUPA 5A5PA 2D8SA 2DVQA 4N4GA 1JM4B 4IR6A 4IORA 4BW1A 3SOUA 2C2VS 5LKUA 4J1PA 5CUDA 4NUCA 3EB5A 2H0DA 4O70A 5FE4A 2KWJA 5I3LA 5HENA 2ECNA 4QF3A 3QZVA 2LGVA 5IGNA 4NN2A 5A85A 1U6GB 5TB6A 3ZYUA 5JI8A 2KFTA 4UI9B 1V87A 5D3JA 2DVVA 4QC3A 5HRWA 5LJ1A 4B7YC 3JVKA 4MEOA 2L5UA 2G45A 2OSSA 5I89A 5L98A 4C67A 2L75A 2XEUA 5LJ0A 5B76A 5EP7A 1F62A 5ENEA 5DKHA 2YT5A 4ZDTA 2LN0A 4GB0A 4LR6A 3I3JA 5CQ7A 5CQ4A 5A81A 2HDPA 4F52B 5I86A 4YYKA 3U5OA 3T6RA 5ENGA 5FG5A 4IR3A 4E96A 4S3OC 4QR5A 4Z1SA 4YAXA 4BHWA 4MR5A 5HEMA 4KV4A 5BT3A 4QSWA 2KREA 1T1HA 2ECWA 4PTBA 3O37A 5EV9A 4Q0NA 5FG6A 4WIVA 4YBTA 4LC2A 4S3OB 4N4HA 4LRGA 5CS8A 5I1QA 1E6IA 4J0SA 4MR4A 3M99A 2LGGA 4ZUXU 3KV6A 4YY6A 1WFKA 5G05B 5TABA 5E3DA 5FH8A 3L11A 4RVRA 1JSPB 4IR5A 5KH7A 4O76A 5A5SA 2ECIA 4AYCB 1WGMA 5JWMA 5J3XA 5II2A 4O64A 4NR8A 3MB3A 5DFDA 4Z93A 2YELA 3ZVZB 4YYIA 4CFKA 5E9YA 4BW2A 2JMJA 2D82A 4QSRA 5CY9A 5E9VA 5BT5A 5AITA 4UIUA 4A9HA 4R2YA 4L58A 4QF2A 3ZNIA 2QJ0A 5KU3A 2CSYA 5J0DA 5D3NA 2WP1A 5TDWA 1WESA 2RO1A 3N9OA 5D7XA 5FE9A 3SVHA 5FEYA 4FLPA 4NR5A 4A9IA 4NR4A 5I88A 5F1LA 4CCGX 5AMEA 4NR6A 5E74A 3UW9A 2NAAA 2YYRA 2RSDA 4Q6FA 4W4UA 4LZ2A 4TT4A 4ALGA 4QSPA 4NYVA 3LXJA 2M85A 5CRMA 3RTRB 5DFBA 4N3WA 1Z6UA 2G4AA 1WILA 3I2DA 2M3HA 5E9MA 3NG2A 1VYXA 4MR3A 5D1KB 3N9MA 3JVLA 5EICA 2VPGA 4UIYA 4A9NA 3ZTGA 2VPEA 4O7EA 3KNVA 5LVRA 5A5RA 5E9KA 2MD7B 5F63A 3MHSA 5B78A 3MHHA 4UYEA 3UVWA 4NR9A 1WEQA 2EODA 5F2PA 4TU4A 1WUGA 5A5QA 3Q2FA 4X3GA 1JM7A 5EPBA 2KWNA 2YU4A 4LDFA 4TTEA 5F62A 2MNZA 4AVXA 1X4IA 4O7BA 4PCIA 4YADA 2OUOA 2D9EA 2R0SA 4QUUA 4XY8A 3DPLR 4Z6HA 3DQVR 2F6JA 4NUDA 4A9EA 4IR4A 5CQTA 2FUIA 5G04B 1G25A 2K17A 4QY4A 5I29A 4I7DA 1ZS5A 5FG4A 3PHDA 1N72A 4QBMA 5LVQA 3RCWA 4TT2A 5EQ1A 5FE0A 5DKAA 4HXMA 3LJWA 2R0YA 3AQAA 4NQNA 4HBWA 5FE5A 4NR7A 3ONIA 4DONA 2CKLA 5EWVA 4AUQB 5A5NA 2DVRA 4J0RA 5DYXA 4GNDA 2L84A 5IGLA 4ZW1A 2JRJA 5B8DA 4NYWA 4OGJA 4NRAA 1K2FA 4UYHA 4O75A 3HTKC 4MENA 1WEUA 5DYUA 5D26A 4A9KA 2KWKA 3N9LA 5CQ8A 4TU6A 2G6QA 3IHPA 4QSXA 2R0VA 5DX4A 2DATA 4BBQA 4WHWA 4YYDA 2K16A 3M62A 2BAYA 5D3LA 4IC2A 2MA6A 3NXBA 4FIPA 5DY7A 5KH3A 5KTUA 3U5PA 5C7NA 5HCLA 4A9FA 4XUBA 5CZGA 5C87A 2VJEB 3N9NA 2H60A 5DKDA 4O71A 1RMDA 4Z6IA 4TKPB 3LQHA 2YYNA 3L1ZB 1WEWA 1FBVA 5DYCA 5HQ7A 5D1LB 3JVJA 2LRIC 4YH3A 2VNFA 5CTLA 5CQ6A 3UVDA 4MR6A 4YBMA 3IU5A 2LXPC 4HXSA 5LUUA 5L96A 3RPGC 2AN6A 5F36A 5EISA 5ENFA 5FERA 5DW2A 5C85A 5EWCA 5ETDA 5G0FA 2YW5A 4CUUA 5EU1A 4NUEA 5FBXA 5KTWA 2JMDA 5CRZA 4BJXA 5FE2A 3GV4A 4QEVA 4LYSA 5FE6A 5HQ5A 1VFYA 2LXHC 4UIWA 4HXNA 5L97A 5FE1A 3KV5A 4A49A 3RPGB 3HMHA 3Q2EA 4QYLA 5FFWA 2RNYA 2E6RA 5EVAA 5EWDA 3C5KA 4P5OB 5EA1A 4V3KC 4YYMA 4YYNA 2MT5A 3GL6A 5F3AA 3SOXA 2C2LA 4TZ2A 2YSJA 4Y03A 2ECGA 4UYFB 2OO1A 5I80A 5AD3A 5E0RA 4V3LC 3AADA 5E7DA 3UVYA 2VJFB 4GPJA 5DINA 5D1MB 5EK9A 2MNYA 4NQMA 5HFRA 2JMIA 4AYCA 2RNXA 2N9GA 2E6SA 2XB1A 5LKTA 2E3KA 5B79A 3ZVYA 2KGIA 5II1A 1XWHA 5LKZA 4KV1A 2QIZA 5F60A 4YYJA 2ECTA 3MULA 5C89A 4IOOA 4YK0A 2QICA 4I7CA 4UP5A 2KTBB 4HXKA 1WEOA 3MQMA 3VK6A 4WA6A 4F3IA 4YBSA 4FO9A 4TS8A 3U5JA 2Y1MA 3C6WA 4PPEA 1LDKC 4J3IA 4PCEA 1WEMA 3MB4A 2YUCA 2FSAA 5E73A 2NXBA 2VP7A 5LCWB 2YEKA 5EI4A 3DWYA 4A9MA 5COIA 2VPBA 4WZ0A 4UITA 5HRXA 2MJVB 4O74A 2ECJA 3G0LA 2KGGA 2Y1NA 3P1DA 4HXLA 2FUUA 4A4BA 5B75A 5G4SA 5EYAF 3UV4A 2L0BA 5JG6A 2R10A 2L85A 5DFCA 5IBNA 3HMEA 5E9LA 3JVMA 4HBVA 5ENIA 1MM3A 4UIVA 4HBYA 4TZ8A 3ZPVE 5H1UA 2G43A 3P1FA 4YATA 4O78A 5CQ5A 4CL9A 4GNGA 2YW8A 2GRCA 5CGPA 5CFWA 5FFYA 4Q0OA 1IYMA 4LZRA 5L99A 4LYIA 4X2IA 5AIUA 3T7LA 3HCUA 4A0CD 4FK5A 2LSPB 1WEVA 5D3HA 4YY4A 3S92A 2H0DB 5EWWA 2PUYA 4LJNA 5TDRA 5FE3A 4ALHA 2LGKA 2M6MA 5DLZA 3S91A 5L8TA 5EWHA 5BT4A 2YURA 5KH9A 2L5EA 1N87A 2DKWA 5ACYA 2ECVA 4CA1A 1WEEA 4UYDA 3MUKA 5DYAA 3L1XA 5I83A 5KHMA 3N9PA 1WE9A 5D25A 4N4FA 4R8PK 4UP0A 3P1CA 5HELA 4PKLA 3O70A 5L8UA 5F1HA 2E7NA 5F61A 2EA6A 2UZGA 4GNFA 5ENHA 3FKMX 5IIDA 5IGMA 3HCSA 4FJCA 3N9QA 4PS5A 4A4CA 3SVGA 5HM0A 2E7OA 5CUGA 3O7AA 5CUEA 3GG3A 3K2JA 4QZSA 4QR3A 5FB0A 2RS9B 4HXRA 5CUCA 3O35A 2RNWA 2YREA 3PURA 4MEPA 4PY6A 2YQLA 5KTXA 5HJCA 4TT6A 2K4DA 4CUQA 3U5KA 5LKXA 2MA5A 4QSQA 5C11A 5I7XA 4C66A 2RI7A 4QNSA 5K29A 1Z60A 4LLBA 5FE8A 2KU3A 2YHNA 4I7BA 2OXQC 4QB3A 4YYHA 3UV5A 4QSUA 2VJEA 1ZBDB 1WIMA 4HXPA 5D3TA 5HRVA 2F6NA 3V43A 4IC3A 4Z1QA 4MEQA 5F5ZA 5C8GA 4NRBA 5FFVA 4CUTA 4MSXA 4NYXA 1VD4A 2DWWA 3LQIA 4NRCA 4XUAA 4YC9A 2MUMA 1X4UA 4CLBA 3G0JA 4QEUA 5TBNA 3KQIA 5DBMA 4WZ3B 5FB1A 3SHBA 4A9JA 3ZPV1 2KE1A 3SOWA 2LDRA 2ZETC 2I7KA 2HYED 3PUQA 5H85A 4CURA 5I40A 5D0CA 3O34A 2I50A 4GNEA 5AMFA 5H1TA 4WZ2A 5DKCA 4N4IA 5HLSA 1HYIA 4O7AA 4R7EA 1EQFA 2L80A 5EPRA 2MD8C 2WP2A 4A9OA 2RFJA 5H1VA 5KO4A 2EGPA 3UV2A 3LQJA 4ZC9A 4TYLA 3O33A 3QZTA 4NS5A 4UYGA 4BW3A 5A5OA 5LJ2A 2CSZA 5FDZA 5DW1A 2KYUA 3QZSA 4MVTA 5ENBA 4LADB 3U5LA 5CUBA 2YQMA 3UVXA 4C9ZA 4UYFA 3EB6A 4QC1A 4QSSA 5ENJA 5FE7A 2VJFA 5D24A 3D7CA 5A7CA 5E3GA 3HCTA 2YHOA 2VPDA 2F42A 2I8NA 4XYAA 5CQAA 4QUTA 4AP4A 4O7FA 3O36A 4LZSA 2LV9A 1WENA 1E4UA 5EM3A 2L43A 3IU6A 5D3SA 5CQ3A 4YYGA 4HXOA 4YH4A 5H9MA 5B77A 1JOCA 1MM2A 3FL2A 5C4QA 1Z2QA 1WUMA 5IG6A 4TQNA 4UIZA 4KCXA 4LYWA 2DX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEP A;  1X0J A;  4WHU A;  2PNX A;  3M63 A;  4CFL A;  4O77 A;  2LGL A;  4BW4 A;  3P1E A;  5EGU A;  1JM7 B;  5ETB A;  1F68 A;  4ZQL A;  4O72 A;  5TRB A;  5FH7 A;  3TLP A;  1DVP A;  5A83 A;  3U5M A;  2IDA A;  2KR4 A;  3DAI A;  4IOQ A;  4QYD A;  5CP5 A;  5AD2 A;  3LRQ A;  4O7C A;  3MXF A;  1X4J A;  5CPE A;  4LK9 A;  1BOR A;  4XI1 A;  4NXJ A;  5DLX A;  1LDJ B;  3SVF A;  2DVS A;  2YEM A;  4B86 C;  4QR4 A;  2YDW A;  3HMF A;  4QST A;  4A9L A;  4UIX A;  5D3R A;  3ASL A;  1FP0 A;  4HBX A;  2MIQ A;  5CU8 A;  5F25 A;  2K1J A;  4OGI A;  4XY9 A;  4YAB A;  5I7Y A;  5TCM A;  5HQ6 A;  2KIZ A;  4AKN A;  5ENC A;  4CUS A;  5HFQ A;  2CKL B;  2YQD A;  2Y43 A;  4LKA A;  5C13 A;  5E9I A;  2LQ6 A;  2CT2 A;  4OUF A;  4QEW A;  5EPS A;  5IGK A;  5A82 A;  4L7X A;  3P5O A;  5FH6 A;  5G4R A;  1HYJ A;  5D3P A;  2M1R A;  3U5N A;  4QSV A;  2YSM A;  5CUA A;  2KWO A;  1CHC A;  3ZYQ A;  4CUP A;  5A5P A;  2D8S A;  2DVQ A;  4N4G A;  1JM4 B;  4IR6 A;  4IOR A;  4BW1 A;  3SOU A;  2C2V S;  5LKU A;  4J1P A;  5CUD A;  4NUC A;  3EB5 A;  2H0D A;  4O70 A;  5FE4 A;  2KWJ A;  5I3L A;  5HEN A;  2ECN A;  4QF3 A;  3QZV A;  2LGV A;  5IGN A;  4NN2 A;  5A85 A;  1U6G B;  5TB6 A;  3ZYU A;  5JI8 A;  2KFT A;  4UI9 B;  1V87 A;  5D3J A;  2DVV A;  4QC3 A;  5HRW A;  5LJ1 A;  4B7Y C;  3JVK A;  4MEO A;  2L5U A;  2G45 A;  2OSS A;  5I89 A;  5L98 A;  4C67 A;  2L75 A;  2XEU A;  5LJ0 A;  5B76 A;  5EP7 A;  1F62 A;  5ENE A;  5DKH A;  2YT5 A;  4ZDT A;  2LN0 A;  4GB0 A;  4LR6 A;  3I3J A;  5CQ7 A;  5CQ4 A;  5A81 A;  2HDP A;  4F52 B;  5I86 A;  4YYK A;  3U5O A;  3T6R A;  5ENG A;  5FG5 A;  4IR3 A;  4E96 A;  4S3O C;  4QR5 A;  4Z1S A;  4YAX A;  4BHW A;  4MR5 A;  5HEM A;  4KV4 A;  5BT3 A;  4QSW A;  2KRE A;  1T1H A;  2ECW A;  4PTB A;  3O37 A;  5EV9 A;  4Q0N A;  5FG6 A;  4WIV A;  4YBT A;  4LC2 A;  4S3O B;  4N4H A;  4LRG A;  5CS8 A;  5I1Q A;  1E6I A;  4J0S A;  4MR4 A;  3M99 A;  2LGG A;  4ZUX U;  3KV6 A;  4YY6 A;  1WFK A;  5G05 B;  5TAB A;  5E3D A;  5FH8 A;  3L11 A;  4RVR A;  1JSP B;  4IR5 A;  5KH7 A;  4O76 A;  5A5S A;  2ECI A;  4AYC B;  1WGM A;  5JWM A;  5J3X A;  5II2 A;  4O64 A;  4NR8 A;  3MB3 A;  5DFD A;  4Z93 A;  2YEL A;  3ZVZ B;  4YYI A;  4CFK A;  5E9Y A;  4BW2 A;  2JMJ A;  2D82 A;  4QSR A;  5CY9 A;  5E9V A;  5BT5 A;  5AIT A;  4UIU A;  4A9H A;  4R2Y A;  4L58 A;  4QF2 A;  3ZNI A;  2QJ0 A;  5KU3 A;  2CSY A;  5J0D A;  5D3N A;  2WP1 A;  5TDW A;  1WES A;  2RO1 A;  3N9O A;  5D7X A;  5FE9 A;  3SVH A;  5FEY A;  4FLP A;  4NR5 A;  4A9I A;  4NR4 A;  5I88 A;  5F1L A;  4CCG X;  5AME A;  4NR6 A;  5E74 A;  3UW9 A;  2NAA A;  2YYR A;  2RSD A;  4Q6F A;  4W4U A;  4LZ2 A;  4TT4 A;  4ALG A;  4QSP A;  4NYV A;  3LXJ A;  2M85 A;  5CRM A;  3RTR B;  5DFB A;  4N3W A;  1Z6U A;  2G4A A;  1WIL A;  3I2D A;  2M3H A;  5E9M A;  3NG2 A;  1VYX A;  4MR3 A;  5D1K B;  3N9M A;  3JVL A;  5EIC A;  2VPG A;  4UIY A;  4A9N A;  3ZTG A;  2VPE A;  4O7E A;  3KNV A;  5LVR A;  5A5R A;  5E9K A;  2MD7 B;  5F63 A;  3MHS A;  5B78 A;  3MHH A;  4UYE A;  3UVW A;  4NR9 A;  1WEQ A;  2EOD A;  5F2P A;  4TU4 A;  1WUG A;  5A5Q A;  3Q2F A;  4X3G A;  1JM7 A;  5EPB A;  2KWN A;  2YU4 A;  4LDF A;  4TTE A;  5F62 A;  2MNZ A;  4AVX A;  1X4I A;  4O7B A;  4PCI A;  4YAD A;  2OUO A;  2D9E A;  2R0S A;  4QUU A;  4XY8 A;  3DPL R;  4Z6H A;  3DQV R;  2F6J A;  4NUD A;  4A9E A;  4IR4 A;  5CQT A;  2FUI A;  5G04 B;  1G25 A;  2K17 A;  4QY4 A;  5I29 A;  4I7D A;  1ZS5 A;  5FG4 A;  3PHD A;  1N72 A;  4QBM A;  5LVQ A;  3RCW A;  4TT2 A;  5EQ1 A;  5FE0 A;  5DKA A;  4HXM A;  3LJW A;  2R0Y A;  3AQA A;  4NQN A;  4HBW A;  5FE5 A;  4NR7 A;  3ONI A;  4DON A;  2CKL A;  5EWV A;  4AUQ B;  5A5N A;  2DVR A;  4J0R A;  5DYX A;  4GND A;  2L84 A;  5IGL A;  4ZW1 A;  2JRJ A;  5B8D A;  4NYW A;  4OGJ A;  4NRA A;  1K2F A;  4UYH A;  4O75 A;  3HTK C;  4MEN A;  1WEU A;  5DYU A;  5D26 A;  4A9K A;  2KWK A;  3N9L A;  5CQ8 A;  4TU6 A;  2G6Q A;  3IHP A;  4QSX A;  2R0V A;  5DX4 A;  2DAT A;  4BBQ A;  4WHW A;  4YYD A;  2K16 A;  3M62 A;  2BAY A;  5D3L A;  4IC2 A;  2MA6 A;  3NXB A;  4FIP A;  5DY7 A;  5KH3 A;  5KTU A;  3U5P A;  5C7N A;  5HCL A;  4A9F A;  4XUB A;  5CZG A;  5C87 A;  2VJE B;  3N9N A;  2H60 A;  5DKD A;  4O71 A;  1RMD A;  4Z6I A;  4TKP B;  3LQH A;  2YYN A;  3L1Z B;  1WEW A;  1FBV A;  5DYC A;  5HQ7 A;  5D1L B;  3JVJ A;  2LRI C;  4YH3 A;  2VNF A;  5CTL A;  5CQ6 A;  3UVD A;  4MR6 A;  4YBM A;  3IU5 A;  2LXP C;  4HXS A;  5LUU A;  5L96 A;  3RPG C;  2AN6 A;  5F36 A;  5EIS A;  5ENF A;  5FER A;  5DW2 A;  5C85 A;  5EWC A;  5ETD A;  5G0F A;  2YW5 A;  4CUU A;  5EU1 A;  4NUE A;  5FBX A;  5KTW A;  2JMD A;  5CRZ A;  4BJX A;  5FE2 A;  3GV4 A;  4QEV A;  4LYS A;  5FE6 A;  5HQ5 A;  1VFY A;  2LXH C;  4UIW A;  4HXN A;  5L97 A;  5FE1 A;  3KV5 A;  4A49 A;  3RPG B;  3HMH A;  3Q2E A;  4QYL A;  5FFW A;  2RNY A;  2E6R A;  5EVA A;  5EWD A;  3C5K A;  4P5O B;  5EA1 A;  4V3K C;  4YYM A;  4YYN A;  2MT5 A;  3GL6 A;  5F3A A;  3SOX A;  2C2L A;  4TZ2 A;  2YSJ A;  4Y03 A;  2ECG A;  4UYF B;  2OO1 A;  5I80 A;  5AD3 A;  5E0R A;  4V3L C;  3AAD A;  5E7D A;  3UVY A;  2VJF B;  4GPJ A;  5DIN A;  5D1M B;  5EK9 A;  2MNY A;  4NQM A;  5HFR A;  2JMI A;  4AYC A;  2RNX A;  2N9G A;  2E6S A;  2XB1 A;  5LKT A;  2E3K A;  5B79 A;  3ZVY A;  2KGI A;  5II1 A;  1XWH A;  5LKZ A;  4KV1 A;  2QIZ A;  5F60 A;  4YYJ A;  2ECT A;  3MUL A;  5C89 A;  4IOO A;  4YK0 A;  2QIC A;  4I7C A;  4UP5 A;  2KTB B;  4HXK A;  1WEO A;  3MQM A;  3VK6 A;  4WA6 A;  4F3I A;  4YBS A;  4FO9 A;  4TS8 A;  3U5J A;  2Y1M A;  3C6W A;  4PPE A;  1LDK C;  4J3I A;  4PCE A;  1WEM A;  3MB4 A;  2YUC A;  2FSA A;  5E73 A;  2NXB A;  2VP7 A;  5LCW B;  2YEK A;  5EI4 A;  3DWY A;  4A9M A;  5COI A;  2VPB A;  4WZ0 A;  4UIT A;  5HRX A;  2MJV B;  4O74 A;  2ECJ A;  3G0L A;  2KGG A;  2Y1N A;  3P1D A;  4HXL A;  2FUU A;  4A4B A;  5B75 A;  5G4S A;  5EYA F;  3UV4 A;  2L0B A;  5JG6 A;  2R10 A;  2L85 A;  5DFC A;  5IBN A;  3HME A;  5E9L A;  3JVM A;  4HBV A;  5ENI A;  1MM3 A;  4UIV A;  4HBY A;  4TZ8 A;  3ZPV E;  5H1U A;  2G43 A;  3P1F A;  4YAT A;  4O78 A;  5CQ5 A;  4CL9 A;  4GNG A;  2YW8 A;  2GRC A;  5CGP A;  5CFW A;  5FFY A;  4Q0O A;  1IYM A;  4LZR A;  5L99 A;  4LYI A;  4X2I A;  5AIU A;  3T7L A;  3HCU A;  4A0C D;  4FK5 A;  2LSP B;  1WEV A;  5D3H A;  4YY4 A;  3S92 A;  2H0D B;  5EWW A;  2PUY A;  4LJN A;  5TDR A;  5FE3 A;  4ALH A;  2LGK A;  2M6M A;  5DLZ A;  3S91 A;  5L8T A;  5EWH A;  5BT4 A;  2YUR A;  5KH9 A;  2L5E A;  1N87 A;  2DKW A;  5ACY A;  2ECV A;  4CA1 A;  1WEE A;  4UYD A;  3MUK A;  5DYA A;  3L1X A;  5I83 A;  5KHM A;  3N9P A;  1WE9 A;  5D25 A;  4N4F A;  4R8P K;  4UP0 A;  3P1C A;  5HEL A;  4PKL A;  3O70 A;  5L8U A;  5F1H A;  2E7N A;  5F61 A;  2EA6 A;  2UZG A;  4GNF A;  5ENH A;  3FKM X;  5IID A;  5IGM A;  3HCS A;  4FJC A;  3N9Q A;  4PS5 A;  4A4C A;  3SVG A;  5HM0 A;  2E7O A;  5CUG A;  3O7A A;  5CUE A;  3GG3 A;  3K2J A;  4QZS A;  4QR3 A;  5FB0 A;  2RS9 B;  4HXR A;  5CUC A;  3O35 A;  2RNW A;  2YRE A;  3PUR A;  4MEP A;  4PY6 A;  2YQL A;  5KTX A;  5HJC A;  4TT6 A;  2K4D A;  4CUQ A;  3U5K A;  5LKX A;  2MA5 A;  4QSQ A;  5C11 A;  5I7X A;  4C66 A;  2RI7 A;  4QNS A;  5K29 A;  1Z60 A;  4LLB A;  5FE8 A;  2KU3 A;  2YHN A;  4I7B A;  2OXQ C;  4QB3 A;  4YYH A;  3UV5 A;  4QSU A;  2VJE A;  1ZBD B;  1WIM A;  4HXP A;  5D3T A;  5HRV A;  2F6N A;  3V43 A;  4IC3 A;  4Z1Q A;  4MEQ A;  5F5Z A;  5C8G A;  4NRB A;  5FFV A;  4CUT A;  4MSX A;  4NYX A;  1VD4 A;  2DWW A;  3LQI A;  4NRC A;  4XUA A;  4YC9 A;  2MUM A;  1X4U A;  4CLB A;  3G0J A;  4QEU A;  5TBN A;  3KQI A;  5DBM A;  4WZ3 B;  5FB1 A;  3SHB A;  4A9J A;  3ZPV 1;  2KE1 A;  3SOW A;  2LDR A;  2ZET C;  2I7K A;  2HYE D;  3PUQ A;  5H85 A;  4CUR A;  5I40 A;  5D0C A;  3O34 A;  2I50 A;  4GNE A;  5AMF A;  5H1T A;  4WZ2 A;  5DKC A;  4N4I A;  5HLS A;  1HYI A;  4O7A A;  4R7E A;  1EQF A;  2L80 A;  5EPR A;  2MD8 C;  2WP2 A;  4A9O A;  2RFJ A;  5H1V A;  5KO4 A;  2EGP A;  3UV2 A;  3LQJ A;  4ZC9 A;  4TYL A;  3O33 A;  3QZT A;  4NS5 A;  4UYG A;  4BW3 A;  5A5O A;  5LJ2 A;  2CSZ A;  5FDZ A;  5DW1 A;  2KYU A;  3QZS A;  4MVT A;  5ENB A;  4LAD B;  3U5L A;  5CUB A;  2YQM A;  3UVX A;  4C9Z A;  4UYF A;  3EB6 A;  4QC1 A;  4QSS A;  5ENJ A;  5FE7 A;  2VJF A;  5D24 A;  3D7C A;  5A7C A;  5E3G A;  3HCT A;  2YHO A;  2VPD A;  2F42 A;  2I8N A;  4XYA A;  5CQA A;  4QUT A;  4AP4 A;  4O7F A;  3O36 A;  4LZS A;  2LV9 A;  1WEN A;  1E4U A;  5EM3 A;  2L43 A;  3IU6 A;  5D3S A;  5CQ3 A;  4YYG A;  4HXO A;  4YH4 A;  5H9M A;  5B77 A;  1JOC A;  1MM2 A;  3FL2 A;  5C4Q A;  1Z2Q A;  1WUM A;  5IG6 A;  4TQN A;  4UIZ A;  4KCX A;  4LYW A;  2DX8 A; 
#chains in the Genus database with same CATH topology
 1WEP A;  1X0J A;  4WHU A;  2PNX A;  3M63 A;  4CFL A;  4O77 A;  2LGL A;  4BW4 A;  3P1E A;  5EGU A;  1JM7 B;  4AKH A;  5ETB A;  1F68 A;  4ZQL A;  4O72 A;  5TRB A;  5FH7 A;  3TLP A;  1DVP A;  5A83 A;  3U5M A;  2IDA A;  2XP0 A;  2KR4 A;  3JUE A;  3DAI A;  4IOQ A;  4QYD A;  5CP5 A;  5AD2 A;  3LRQ A;  4O7C A;  3MXF A;  1X4J A;  5CPE A;  4LK9 A;  1BOR A;  4XI1 A;  4NXJ A;  5DLX A;  1LDJ B;  3SVF A;  2DVS A;  2YEM A;  4B86 C;  4QR4 A;  2YDW A;  3HMF A;  4QST A;  4A9L A;  4UIX A;  5D3R A;  3ASL A;  1FP0 A;  4HBX A;  2MIQ A;  5CU8 A;  5F25 A;  2K1J A;  4OGI A;  4XY9 A;  4YAB A;  5I7Y A;  3DWD A;  5SVI B;  5TCM A;  5HQ6 A;  2KIZ A;  3LJU X;  4AKN A;  5ENC A;  4CUS A;  5HFQ A;  2CKL B;  2YQD A;  2Y43 A;  4LKA A;  5C13 A;  5E9I A;  2LQ6 A;  2CT2 A;  4OUF A;  4QEW A;  5EPS A;  5IGK A;  5A82 A;  4L7X A;  3P5O A;  5FH6 A;  5G4R A;  1HYJ A;  5D3P A;  2M1R A;  3U5N A;  4QSV A;  2YSM A;  5CUA A;  2KWO A;  1CHC A;  3ZYQ A;  4CUP A;  5A5P A;  2D8S A;  4AI6 A;  2DVQ A;  4N4G A;  2FD4 A;  1JM4 B;  4IR6 A;  4IOR A;  4BW1 A;  3SOU A;  2C2V S;  5LKU A;  4J1P A;  5CUD A;  2E61 A;  4NUC A;  3EB5 A;  2H0D A;  4O70 A;  5FE4 A;  2KWJ A;  5I3L A;  3D1D A;  5HEN A;  2ECN A;  4QF3 A;  3QZV A;  2LGV A;  5IGN A;  4NN2 A;  5A85 A;  1U6G B;  2L7P A;  5TB6 A;  3ZYU A;  5JI8 A;  2KFT A;  4UI9 B;  1V87 A;  5D3J A;  2DVV A;  4QC3 A;  5HRW A;  5LJ1 A;  2RR4 A;  4B7Y C;  3JVK A;  4MEO A;  2L5U A;  2G45 A;  2OSS A;  5I89 A;  5L98 A;  4C67 A;  2L75 A;  2XEU A;  5LJ0 A;  5B76 A;  5EP7 A;  1F62 A;  5ENE A;  5DKH A;  2YT5 A;  4ZDT A;  2LN0 A;  4GB0 A;  4LR6 A;  3I3J A;  5CQ7 A;  5CQ4 A;  5A81 A;  4AKG A;  2HDP A;  4F52 B;  5I86 A;  4YYK A;  3U5O A;  3T6R A;  5ENG A;  5FG5 A;  4IR3 A;  4E96 A;  2CRR A;  4S3O C;  4QR5 A;  4Z1S A;  4OGE A;  4YAX A;  4BHW A;  4MR5 A;  5HEM A;  4KV4 A;  5BT3 A;  4QSW A;  2CSV A;  2KRE A;  1T1H A;  2ECW A;  4PTB A;  3O37 A;  5EV9 A;  2KKX A;  4Q0N A;  5FG6 A;  4WIV A;  4YBT A;  4LC2 A;  4S3O B;  4N4H A;  4LRG A;  3KDE C;  1E4U A;  5CS8 A;  5I1Q A;  1E6I A;  4J0S A;  4MR4 A;  3M99 A;  2LGG A;  4ZUX U;  3KV6 A;  4YY6 A;  1WFK A;  5G05 B;  5TAB A;  5E3D A;  5FH8 A;  3L11 A;  4RVR A;  1JSP B;  4IR5 A;  5KH7 A;  4O76 A;  5A5S A;  2ECI A;  4AYC B;  1WGM A;  5JWM A;  5J3X A;  5II2 A;  4O64 A;  3H7H A;  4NR8 A;  3MB3 A;  5DFD A;  4Z93 A;  2YEL A;  3ZVZ B;  4YYI A;  4CFK A;  5E9Y A;  4BW2 A;  2JMJ A;  2D82 A;  4QSR A;  5CY9 A;  5E9V A;  5BT5 A;  5AIT A;  4UIU A;  4A9H A;  4R2Y A;  3M7K A;  4L58 A;  4QF2 A;  3ZNI A;  2QJ0 A;  5KU3 A;  2CSY A;  5J0D A;  5D3N A;  2WP1 A;  5TDW A;  1WES A;  2RO1 A;  3N9O A;  5D7X A;  5FE9 A;  3SVH A;  5FEY A;  4FLP A;  4NR5 A;  4A9I A;  4NR4 A;  5I88 A;  3FAN A;  5F1L A;  2XOC A;  4CCG X;  5AME A;  4NR6 A;  5E74 A;  3UW9 A;  2NAA A;  2YYR A;  3VKG A;  2RSD A;  4Q6F A;  4W4U A;  4LZ2 A;  4TT4 A;  4ALG A;  2XOZ A;  4QSP A;  4NYV A;  3LXJ A;  2M85 A;  5CRM A;  3RTR B;  5DFB A;  4N3W A;  1Z6U A;  2G4A A;  1WIL A;  3I2D A;  2M3H A;  5E9M A;  3NG2 A;  3MDB C;  1VYX A;  1DCQ A;  4MR3 A;  2IQJ A;  5D1K B;  3N9M A;  3JVL A;  5EIC A;  2VPG A;  4UIY A;  4A9N A;  3ZTG A;  2VPE A;  4O7E A;  2DSM A;  3KNV A;  5LVR A;  5A5R A;  5E9K A;  2MD7 B;  5F63 A;  3MHS A;  5B78 A;  3MHH A;  4UYE A;  3UVW A;  4NR9 A;  1WEQ A;  2JUN A;  4AKI A;  3O47 A;  2EOD A;  5F2P A;  4TU4 A;  1WUG A;  5A5Q A;  3Q2F A;  4X3G A;  1JM7 A;  5EPB A;  2KWN A;  2JM3 A;  4LDF A;  4TTE A;  5F62 A;  2MNZ A;  2YU4 A;  1X4I A;  4AVX A;  5SVY A;  4O7B A;  4PCI A;  4YAD A;  2OUO A;  2D9E A;  2R0S A;  4QUU A;  4XY8 A;  3DPL R;  4Z6H A;  3DQV R;  2F6J A;  4NUD A;  4A9E A;  4IR4 A;  5CQT A;  2FUI A;  5G04 B;  1G25 A;  2K17 A;  4QY4 A;  5I29 A;  2EXU A;  1ZS5 A;  4I7D A;  5FG4 A;  3PHD A;  3LDY A;  1N72 A;  4QBM A;  5LVQ A;  3RCW A;  1ZKR A;  4TT2 A;  5EQ1 A;  5FE0 A;  5DKA A;  4HXM A;  3LJW A;  2R0Y A;  3AQA A;  2LAU A;  5SVI A;  4NQN A;  4HBW A;  5FE5 A;  4NR7 A;  3ONI A;  4DON A;  2CKL A;  5EWV A;  4AUQ B;  1PUO A;  3ERR A;  2DVR A;  5A5N A;  4J0R A;  5DYX A;  4GND A;  4OGC A;  2L84 A;  5IGL A;  4ZW1 A;  2JRJ A;  5B8D A;  4NYW A;  4OGJ A;  4NRA A;  1K2F A;  4UYH A;  4O75 A;  2B0O E;  3HTK C;  4MEN A;  1WEU A;  2MKE A;  5DYU A;  5D26 A;  4A9K A;  2KWK A;  3N9L A;  5CQ8 A;  4TU6 A;  2G6Q A;  3IHP A;  4QSX A;  2R0V A;  5DX4 A;  2DAT A;  4BBQ A;  4WHW A;  4YYD A;  2K16 A;  3M62 A;  2BAY A;  5D3L A;  4IC2 A;  2MA6 A;  3NXB A;  4FIP A;  5DY7 A;  5KH3 A;  2KKY A;  5KTU A;  3U5P A;  5C7N A;  5HCL A;  4A9F A;  4XUB A;  5CZG A;  5C87 A;  2VJE B;  3N9N A;  2H60 A;  5DKD A;  3T9K A;  4O71 A;  1RMD A;  4Z6I A;  4TKP B;  3LQH A;  2YYN A;  2P57 A;  3L1Z B;  1WEW A;  1FBV A;  5DYC A;  5HQ7 A;  5D1L B;  3JVJ A;  2LRI C;  4YH3 A;  2VNF A;  5CTL A;  5CQ6 A;  3UVD A;  4MR6 A;  4YBM A;  3IU5 A;  2LXP C;  4HXS A;  5LUU A;  2YVR A;  5L96 A;  3RPG C;  2AN6 A;  5F36 A;  5EIS A;  5ENF A;  5FER A;  5DW2 A;  5C85 A;  5EWC A;  5ETD A;  5G0F A;  2YW5 A;  4CUU A;  5EU1 A;  2D8U A;  4NUE A;  5FBX A;  5KTW A;  2JMD A;  5CRZ A;  4BJX A;  5FE2 A;  3GV4 A;  4QEV A;  4LYS A;  5FE6 A;  5HQ5 A;  1VFY A;  2LXH C;  4UIW A;  4HXN A;  5L97 A;  5FE1 A;  3KV5 A;  4A49 A;  3RPG B;  3HMH A;  3Q2E A;  4QYL A;  5FFW A;  2RNY A;  2E6R A;  5EVA A;  5EWD A;  3C5K A;  4P5O B;  5EA1 A;  4V3K C;  4YYM A;  4YYN A;  2MT5 A;  3GL6 A;  5F3A A;  3SOX A;  2C2L A;  4TZ2 A;  2YSJ A;  4Y03 A;  2ECG A;  4UYF B;  2OO1 A;  5I80 A;  5AD3 A;  5E0R A;  4V3L C;  3AAD A;  5E7D A;  3UVY A;  2VJF B;  3SUB A;  4GPJ A;  5DIN A;  5D1M B;  5EK9 A;  2MNY A;  2CON A;  4NQM A;  5HFR A;  2JMI A;  4AYC A;  2RNX A;  2N9G A;  2E6S A;  2XB1 A;  5LKT A;  2E3K A;  5B79 A;  3ZVY A;  2KGI A;  5II1 A;  1XWH A;  5LKZ A;  4KV1 A;  2QIZ A;  5F60 A;  4YYJ A;  2ECT A;  3MUL A;  5C89 A;  4IOO A;  4YK0 A;  2QIC A;  4I7C A;  4UP5 A;  2KTB B;  4HXK A;  1WEO A;  3MQM A;  3VK6 A;  3FEH A;  4WA6 A;  4F3I A;  4YBS A;  4FO9 A;  4TS8 A;  3U5J A;  2Y1M A;  3C6W A;  4PPE A;  1LDK C;  4J3I A;  4PCE A;  1WEM A;  3LVQ E;  3MB4 A;  2YUC A;  2FSA A;  5E73 A;  2NXB A;  2VP7 A;  5LCW B;  2YEK A;  5EI4 A;  3DWY A;  4A9M A;  5COI A;  2VPB A;  3E2D A;  3FM8 C;  4WZ0 A;  4UIT A;  5HRX A;  2MJV B;  4O74 A;  2ECJ A;  3G0L A;  2KGG A;  2Y1N A;  3P1D A;  4HXL A;  2FUU A;  4A4B A;  5B75 A;  5G4S A;  5EYA F;  3UV4 A;  2L0B A;  5JG6 A;  2R10 A;  2L85 A;  5DFC A;  5IBN A;  3HME A;  5E9L A;  3JVM A;  4HBV A;  5ENI A;  1MM3 A;  4UIV A;  4HBY A;  4TZ8 A;  3ZPV E;  5H1U A;  2G43 A;  3P1F A;  4YAT A;  4O78 A;  5CQ5 A;  4CL9 A;  4GNG A;  2YW8 A;  2GRC A;  5CGP A;  5CFW A;  5FFY A;  4Q0O A;  4Z0R A;  1IYM A;  4LZR A;  5L99 A;  4LYI A;  4X2I A;  5AIU A;  3T7L A;  3HCU A;  4A0C D;  4FK5 A;  2LSP B;  1WEV A;  5D3H A;  4YY4 A;  3S92 A;  2EGM A;  5EWW A;  2H0D B;  2PUY A;  4LJN A;  4Z0O A;  5TDR A;  5FE3 A;  4ALH A;  2LGK A;  3PLW A;  2M6M A;  5DLZ A;  3S91 A;  5L8T A;  5EWH A;  5BT4 A;  2YUR A;  5KH9 A;  2L5E A;  1N87 A;  2DKW A;  5ACY A;  2ECV A;  4CA1 A;  1WEE A;  4UYD A;  3MUK A;  5DYA A;  3L1X A;  5I83 A;  5KHM A;  3N9P A;  1WE9 A;  5D25 A;  4N4F A;  4R8P K;  4UP0 A;  3P1C A;  5HEL A;  4PKL A;  3O70 A;  5L8U A;  5F1H A;  2E7N A;  5F61 A;  3D1B A;  2EA6 A;  2UZG A;  4GNF A;  5ENH A;  3FKM X;  5IID A;  5IGM A;  3HCS A;  4FJC A;  3N9Q A;  4PS5 A;  4A4C A;  3SVG A;  5HM0 A;  2E7O A;  5CUG A;  3O7A A;  5CUE A;  3GG3 A;  3K2J A;  4QZS A;  4QR3 A;  5FB0 A;  2RS9 B;  4QQ4 A;  2EJN A;  4HXR A;  5CUC A;  3O35 A;  2RNW A;  2YRE A;  3PUR A;  4MEP A;  4PY6 A;  2YQL A;  5KTX A;  5HJC A;  4TT6 A;  2K4D A;  3Q1D A;  4CUQ A;  3U5K A;  5LKX A;  2MA5 A;  4QSQ A;  2DJA A;  2OWA A;  5I7X A;  4C66 A;  5SVX A;  5C11 A;  2RI7 A;  4QNS A;  5K29 A;  1Z60 A;  4LLB A;  5FE8 A;  2KU3 A;  2YHN A;  4I7B A;  2OXQ C;  3VKH A;  4QB3 A;  4YYH A;  3UV5 A;  4QSU A;  4O62 A;  2VJE A;  1ZBD B;  1WIM A;  4HXP A;  2CRW A;  5D3T A;  5HRV A;  2F6N A;  3V43 A;  4IC3 A;  4Z1Q A;  4MEQ A;  5F5Z A;  5C8G A;  4NRB A;  5FFV A;  4CUT A;  4MSX A;  3FAO A;  4NYX A;  1VD4 A;  2DWW A;  3LQI A;  4NRC A;  4XUA A;  4YC9 A;  2MUM A;  1X4U A;  4CLB A;  3G0J A;  4QEU A;  5TBN A;  3KQI A;  5DBM A;  4WZ3 B;  5FB1 A;  3SHB A;  4A9J A;  3ZPV 1;  2KE1 A;  3SOW A;  2LDR A;  4F1P A;  2ZET C;  2I7K A;  2HYE D;  3PUQ A;  5H85 A;  4CUR A;  5I40 A;  1MBM A;  5D0C A;  3O34 A;  4H9D A;  2I50 A;  4GNE A;  5AMF A;  5H1T A;  4WZ2 A;  5DKC A;  4N4I A;  5HLS A;  1HYI A;  4O7A A;  2M13 A;  1EQF A;  4R7E A;  2L80 A;  5EPR A;  2MD8 C;  2WP2 A;  4A9O A;  2RFJ A;  5H1V A;  5KO4 A;  2EGP A;  3UV2 A;  3LQJ A;  4ZC9 A;  4TYL A;  3O33 A;  3QZT A;  4NS5 A;  4UYG A;  4BW3 A;  5A5O A;  5LJ2 A;  2CSZ A;  5FDZ A;  5DW1 A;  2KYU A;  3QZS A;  4MVT A;  5ENB A;  4LAD B;  3U5L A;  5CUB A;  2YQM A;  3UVX A;  2XOY A;  4C9Z A;  4UYF A;  3EB6 A;  4QC1 A;  4QSS A;  5ENJ A;  5FE7 A;  2VJF A;  5D24 A;  3D7C A;  5A7C A;  5E3G A;  3HCT A;  2YHO A;  2VPD A;  2F42 A;  2I8N A;  4XYA A;  5CQA A;  4QUT A;  4AP4 A;  4O7F A;  3O36 A;  4LZS A;  2LV9 A;  1WEN A;  3DDT A;  3FJU B;  5EM3 A;  2L43 A;  3IU6 A;  5D3S A;  5CQ3 A;  4YYG A;  4HXO A;  5K3Q A;  4YH4 A;  5H9M A;  5B77 A;  1JOC A;  1MM2 A;  3FL2 A;  5C4Q A;  1Z2Q A;  1WUM A;  2FFW A;  5IG6 A;  3LVR E;  4TQN A;  4UIZ A;  4KCX A;  4LYW A;  2DX8 A; 
#chains in the Genus database with same CATH homology
 1WEP A;  1X0J A;  4WHU A;  2PNX A;  3M63 A;  4CFL A;  4O77 A;  2LGL A;  4BW4 A;  3P1E A;  5EGU A;  1JM7 B;  5ETB A;  1F68 A;  4ZQL A;  4O72 A;  5TRB A;  5FH7 A;  3TLP A;  1DVP A;  5A83 A;  3U5M A;  2IDA A;  2KR4 A;  3DAI A;  4IOQ A;  4QYD A;  5CP5 A;  5AD2 A;  3LRQ A;  4O7C A;  3MXF A;  1X4J A;  5CPE A;  4LK9 A;  1BOR A;  4XI1 A;  4NXJ A;  5DLX A;  1LDJ B;  3SVF A;  2DVS A;  2YEM A;  4B86 C;  4QR4 A;  2YDW A;  3HMF A;  4QST A;  4A9L A;  4UIX A;  5D3R A;  3ASL A;  1FP0 A;  4HBX A;  2MIQ A;  5CU8 A;  5F25 A;  2K1J A;  4OGI A;  4XY9 A;  4YAB A;  5I7Y A;  5TCM A;  5HQ6 A;  2KIZ A;  4AKN A;  5ENC A;  4CUS A;  5HFQ A;  2CKL B;  2YQD A;  2Y43 A;  4LKA A;  5C13 A;  5E9I A;  2LQ6 A;  2CT2 A;  4OUF A;  4QEW A;  5EPS A;  5IGK A;  5A82 A;  4L7X A;  3P5O A;  5FH6 A;  5G4R A;  1HYJ A;  5D3P A;  2M1R A;  3U5N A;  4QSV A;  2YSM A;  5CUA A;  2KWO A;  1CHC A;  3ZYQ A;  4CUP A;  5A5P A;  2D8S A;  2DVQ A;  4N4G A;  1JM4 B;  4IR6 A;  4IOR A;  4BW1 A;  3SOU A;  2C2V S;  5LKU A;  4J1P A;  5CUD A;  4NUC A;  3EB5 A;  2H0D A;  4O70 A;  5FE4 A;  2KWJ A;  5I3L A;  5HEN A;  2ECN A;  4QF3 A;  3QZV A;  2LGV A;  5IGN A;  4NN2 A;  5A85 A;  1U6G B;  5TB6 A;  3ZYU A;  5JI8 A;  2KFT A;  4UI9 B;  1V87 A;  5D3J A;  2DVV A;  4QC3 A;  5HRW A;  5LJ1 A;  4B7Y C;  3JVK A;  4MEO A;  2L5U A;  2G45 A;  2OSS A;  5I89 A;  5L98 A;  4C67 A;  2L75 A;  2XEU A;  5LJ0 A;  5B76 A;  5EP7 A;  1F62 A;  5ENE A;  5DKH A;  2YT5 A;  4ZDT A;  2LN0 A;  4GB0 A;  4LR6 A;  3I3J A;  5CQ7 A;  5CQ4 A;  5A81 A;  2HDP A;  4F52 B;  5I86 A;  4YYK A;  3U5O A;  3T6R A;  5ENG A;  5FG5 A;  4IR3 A;  4E96 A;  4S3O C;  4QR5 A;  4Z1S A;  4YAX A;  4BHW A;  4MR5 A;  5HEM A;  4KV4 A;  5BT3 A;  4QSW A;  2KRE A;  1T1H A;  2ECW A;  4PTB A;  3O37 A;  5EV9 A;  4Q0N A;  5FG6 A;  4WIV A;  4YBT A;  4LC2 A;  4S3O B;  4N4H A;  4LRG A;  5CS8 A;  5I1Q A;  1E6I A;  4J0S A;  4MR4 A;  3M99 A;  2LGG A;  4ZUX U;  3KV6 A;  4YY6 A;  1WFK A;  5G05 B;  5TAB A;  5E3D A;  5FH8 A;  3L11 A;  4RVR A;  1JSP B;  4IR5 A;  5KH7 A;  4O76 A;  5A5S A;  2ECI A;  4AYC B;  1WGM A;  5JWM A;  5J3X A;  5II2 A;  4O64 A;  4NR8 A;  3MB3 A;  5DFD A;  4Z93 A;  2YEL A;  3ZVZ B;  4YYI A;  4CFK A;  5E9Y A;  4BW2 A;  2JMJ A;  2D82 A;  4QSR A;  5CY9 A;  5E9V A;  5BT5 A;  5AIT A;  4UIU A;  4A9H A;  4R2Y A;  4L58 A;  4QF2 A;  3ZNI A;  2QJ0 A;  5KU3 A;  2CSY A;  5J0D A;  5D3N A;  2WP1 A;  5TDW A;  1WES A;  2RO1 A;  3N9O A;  5D7X A;  5FE9 A;  3SVH A;  5FEY A;  4FLP A;  4NR5 A;  4A9I A;  4NR4 A;  5I88 A;  5F1L A;  4CCG X;  5AME A;  4NR6 A;  5E74 A;  3UW9 A;  2NAA A;  2YYR A;  2RSD A;  4Q6F A;  4W4U A;  4LZ2 A;  4TT4 A;  4ALG A;  4QSP A;  4NYV A;  3LXJ A;  2M85 A;  5CRM A;  3RTR B;  5DFB A;  4N3W A;  1Z6U A;  2G4A A;  1WIL A;  3I2D A;  2M3H A;  5E9M A;  3NG2 A;  1VYX A;  4MR3 A;  5D1K B;  3N9M A;  3JVL A;  5EIC A;  2VPG A;  4UIY A;  4A9N A;  3ZTG A;  2VPE A;  4O7E A;  3KNV A;  5LVR A;  5A5R A;  5E9K A;  2MD7 B;  5F63 A;  3MHS A;  5B78 A;  3MHH A;  4UYE A;  3UVW A;  4NR9 A;  1WEQ A;  2EOD A;  5F2P A;  4TU4 A;  1WUG A;  5A5Q A;  3Q2F A;  4X3G A;  1JM7 A;  5EPB A;  2KWN A;  2YU4 A;  4LDF A;  4TTE A;  5F62 A;  2MNZ A;  4AVX A;  1X4I A;  4O7B A;  4PCI A;  4YAD A;  2OUO A;  2D9E A;  2R0S A;  4QUU A;  4XY8 A;  3DPL R;  4Z6H A;  3DQV R;  2F6J A;  4NUD A;  4A9E A;  4IR4 A;  5CQT A;  2FUI A;  5G04 B;  1G25 A;  2K17 A;  4QY4 A;  5I29 A;  4I7D A;  1ZS5 A;  5FG4 A;  3PHD A;  1N72 A;  4QBM A;  5LVQ A;  3RCW A;  4TT2 A;  5EQ1 A;  5FE0 A;  5DKA A;  4HXM A;  3LJW A;  2R0Y A;  3AQA A;  4NQN A;  4HBW A;  5FE5 A;  4NR7 A;  3ONI A;  4DON A;  2CKL A;  5EWV A;  4AUQ B;  5A5N A;  2DVR A;  4J0R A;  5DYX A;  4GND A;  2L84 A;  5IGL A;  4ZW1 A;  2JRJ A;  5B8D A;  4NYW A;  4OGJ A;  4NRA A;  1K2F A;  4UYH A;  4O75 A;  3HTK C;  4MEN A;  1WEU A;  5DYU A;  5D26 A;  4A9K A;  2KWK A;  3N9L A;  5CQ8 A;  4TU6 A;  2G6Q A;  3IHP A;  4QSX A;  2R0V A;  5DX4 A;  2DAT A;  4BBQ A;  4WHW A;  4YYD A;  2K16 A;  3M62 A;  2BAY A;  5D3L A;  4IC2 A;  2MA6 A;  3NXB A;  4FIP A;  5DY7 A;  5KH3 A;  5KTU A;  3U5P A;  5C7N A;  5HCL A;  4A9F A;  4XUB A;  5CZG A;  5C87 A;  2VJE B;  3N9N A;  2H60 A;  5DKD A;  4O71 A;  1RMD A;  4Z6I A;  4TKP B;  3LQH A;  2YYN A;  3L1Z B;  1WEW A;  1FBV A;  5DYC A;  5HQ7 A;  5D1L B;  3JVJ A;  2LRI C;  4YH3 A;  2VNF A;  5CTL A;  5CQ6 A;  3UVD A;  4MR6 A;  4YBM A;  3IU5 A;  2LXP C;  4HXS A;  5LUU A;  5L96 A;  3RPG C;  2AN6 A;  5F36 A;  5EIS A;  5ENF A;  5FER A;  5DW2 A;  5C85 A;  5EWC A;  5ETD A;  5G0F A;  2YW5 A;  4CUU A;  5EU1 A;  4NUE A;  5FBX A;  5KTW A;  2JMD A;  5CRZ A;  4BJX A;  5FE2 A;  3GV4 A;  4QEV A;  4LYS A;  5FE6 A;  5HQ5 A;  1VFY A;  2LXH C;  4UIW A;  4HXN A;  5L97 A;  5FE1 A;  3KV5 A;  4A49 A;  3RPG B;  3HMH A;  3Q2E A;  4QYL A;  5FFW A;  2RNY A;  2E6R A;  5EVA A;  5EWD A;  3C5K A;  4P5O B;  5EA1 A;  4V3K C;  4YYM A;  4YYN A;  2MT5 A;  3GL6 A;  5F3A A;  3SOX A;  2C2L A;  4TZ2 A;  2YSJ A;  4Y03 A;  2ECG A;  4UYF B;  2OO1 A;  5I80 A;  5AD3 A;  5E0R A;  4V3L C;  3AAD A;  5E7D A;  3UVY A;  2VJF B;  4GPJ A;  5DIN A;  5D1M B;  5EK9 A;  2MNY A;  4NQM A;  5HFR A;  2JMI A;  4AYC A;  2RNX A;  2N9G A;  2E6S A;  2XB1 A;  5LKT A;  2E3K A;  5B79 A;  3ZVY A;  2KGI A;  5II1 A;  1XWH A;  5LKZ A;  4KV1 A;  2QIZ A;  5F60 A;  4YYJ A;  2ECT A;  3MUL A;  5C89 A;  4IOO A;  4YK0 A;  2QIC A;  4I7C A;  4UP5 A;  2KTB B;  4HXK A;  1WEO A;  3MQM A;  3VK6 A;  4WA6 A;  4F3I A;  4YBS A;  4FO9 A;  4TS8 A;  3U5J A;  2Y1M A;  3C6W A;  4PPE A;  1LDK C;  4J3I A;  4PCE A;  1WEM A;  3MB4 A;  2YUC A;  2FSA A;  5E73 A;  2NXB A;  2VP7 A;  5LCW B;  2YEK A;  5EI4 A;  3DWY A;  4A9M A;  5COI A;  2VPB A;  4WZ0 A;  4UIT A;  5HRX A;  2MJV B;  4O74 A;  2ECJ A;  3G0L A;  2KGG A;  2Y1N A;  3P1D A;  4HXL A;  2FUU A;  4A4B A;  5B75 A;  5G4S A;  5EYA F;  3UV4 A;  2L0B A;  5JG6 A;  2R10 A;  2L85 A;  5DFC A;  5IBN A;  3HME A;  5E9L A;  3JVM A;  4HBV A;  5ENI A;  1MM3 A;  4UIV A;  4HBY A;  4TZ8 A;  3ZPV E;  5H1U A;  2G43 A;  3P1F A;  4YAT A;  4O78 A;  5CQ5 A;  4CL9 A;  4GNG A;  2YW8 A;  2GRC A;  5CGP A;  5CFW A;  5FFY A;  4Q0O A;  1IYM A;  4LZR A;  5L99 A;  4LYI A;  4X2I A;  5AIU A;  3T7L A;  3HCU A;  4A0C D;  4FK5 A;  2LSP B;  1WEV A;  5D3H A;  4YY4 A;  3S92 A;  2H0D B;  5EWW A;  2PUY A;  4LJN A;  5TDR A;  5FE3 A;  4ALH A;  2LGK A;  2M6M A;  5DLZ A;  3S91 A;  5L8T A;  5EWH A;  5BT4 A;  2YUR A;  5KH9 A;  2L5E A;  1N87 A;  2DKW A;  5ACY A;  2ECV A;  4CA1 A;  1WEE A;  4UYD A;  3MUK A;  5DYA A;  3L1X A;  5I83 A;  5KHM A;  3N9P A;  1WE9 A;  5D25 A;  4N4F A;  4R8P K;  4UP0 A;  3P1C A;  5HEL A;  4PKL A;  3O70 A;  5L8U A;  5F1H A;  2E7N A;  5F61 A;  2EA6 A;  2UZG A;  4GNF A;  5ENH A;  3FKM X;  5IID A;  5IGM A;  3HCS A;  4FJC A;  3N9Q A;  4PS5 A;  4A4C A;  3SVG A;  5HM0 A;  2E7O A;  5CUG A;  3O7A A;  5CUE A;  3GG3 A;  3K2J A;  4QZS A;  4QR3 A;  5FB0 A;  2RS9 B;  4HXR A;  5CUC A;  3O35 A;  2RNW A;  2YRE A;  3PUR A;  4MEP A;  4PY6 A;  2YQL A;  5KTX A;  5HJC A;  4TT6 A;  2K4D A;  4CUQ A;  3U5K A;  5LKX A;  2MA5 A;  4QSQ A;  5C11 A;  5I7X A;  4C66 A;  2RI7 A;  4QNS A;  5K29 A;  1Z60 A;  4LLB A;  5FE8 A;  2KU3 A;  2YHN A;  4I7B A;  2OXQ C;  4QB3 A;  4YYH A;  3UV5 A;  4QSU A;  2VJE A;  1ZBD B;  1WIM A;  4HXP A;  5D3T A;  5HRV A;  2F6N A;  3V43 A;  4IC3 A;  4Z1Q A;  4MEQ A;  5F5Z A;  5C8G A;  4NRB A;  5FFV A;  4CUT A;  4MSX A;  4NYX A;  1VD4 A;  2DWW A;  3LQI A;  4NRC A;  4XUA A;  4YC9 A;  2MUM A;  1X4U A;  4CLB A;  3G0J A;  4QEU A;  5TBN A;  3KQI A;  5DBM A;  4WZ3 B;  5FB1 A;  3SHB A;  4A9J A;  3ZPV 1;  2KE1 A;  3SOW A;  2LDR A;  2ZET C;  2I7K A;  2HYE D;  3PUQ A;  5H85 A;  4CUR A;  5I40 A;  5D0C A;  3O34 A;  2I50 A;  4GNE A;  5AMF A;  5H1T A;  4WZ2 A;  5DKC A;  4N4I A;  5HLS A;  1HYI A;  4O7A A;  4R7E A;  1EQF A;  2L80 A;  5EPR A;  2MD8 C;  2WP2 A;  4A9O A;  2RFJ A;  5H1V A;  5KO4 A;  2EGP A;  3UV2 A;  3LQJ A;  4ZC9 A;  4TYL A;  3O33 A;  3QZT A;  4NS5 A;  4UYG A;  4BW3 A;  5A5O A;  5LJ2 A;  2CSZ A;  5FDZ A;  5DW1 A;  2KYU A;  3QZS A;  4MVT A;  5ENB A;  4LAD B;  3U5L A;  5CUB A;  2YQM A;  3UVX A;  4C9Z A;  4UYF A;  3EB6 A;  4QC1 A;  4QSS A;  5ENJ A;  5FE7 A;  2VJF A;  5D24 A;  3D7C A;  5A7C A;  5E3G A;  3HCT A;  2YHO A;  2VPD A;  2F42 A;  2I8N A;  4XYA A;  5CQA A;  4QUT A;  4AP4 A;  4O7F A;  3O36 A;  4LZS A;  2LV9 A;  1WEN A;  1E4U A;  5EM3 A;  2L43 A;  3IU6 A;  5D3S A;  5CQ3 A;  4YYG A;  4HXO A;  4YH4 A;  5H9M A;  5B77 A;  1JOC A;  1MM2 A;  3FL2 A;  5C4Q A;  1Z2Q A;  1WUM A;  5IG6 A;  4TQN A;  4UIZ A;  4KCX A;  4LYW A;  2DX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...