4YOEA

Structure of up1 bound to rna 5'-agu-3'
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
181
structure length
181
Chain Sequence
b'KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heterogeneous nuclear ribonucleoprotein A1
publication title The First Crystal Structure of the UP1 Domain of hnRNP A1 Bound to RNA Reveals a New Look for an Old RNA Binding Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 49
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2015-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4yoeA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4yoeA02
5JVHQ 1WG4A 1YIJS 1IQTA 3G8TA 5DDOC 1YITS 2QFJA 1H2UX 4QQBA 2N7CA 2YTCA 3CCSS 2BOPA 4FXVA 4QU6A 2KHCA 5D78A 3MD3A 1QVFR 2DITA 3BS9A 5HL7Q 2UP1A 1X0FA 1M5PC 2LMIA 2HYIB 1WI8A 3V4MA 2D9OA 3CCQS 2JRSA 2M0GB 2YH0A 1PGZA 2DHSA 5GAHU 1FJEB 2KYXA 2MKIA 2CPFA 1P27B 1Q82T 1VC6A 3MD1A 1K8AT 1UAWA 1M1KT 3J7ZT 1WF1A 2KRRA 1YJNS 1FHTA 1WHYA 2HGLA 4IO9Q 5IQQA 2XS2A 2J0QD 5IM0A 1WHWA 4C7QA 1VQPS 2D3OR 4BS2A 1OWXA 2L41A 1SJ4P 2MY8A 2Q79A 1VQKS 3VAIA 2CQ0A 2DNRA 1VQ9S 2KG1A 1N8RT 3G4SS 1AUDA 4CH1A 2ERRA 1JJ4A 1U1PA 2B0GA 3VAKA 4ZKAA 2OTJS 1H2TZ 3G8SA 2J0SD 1YI2S 2OIHA 1WG5A 1WHXA 5CA5A 3BO3A 3VAHA 2MSTA 2M88A 2GHPA 3EGNA 4LIRA 3CD6S 4YOEA 5FJ4A 1X4AA 2LEAA 3LQVA 1QM9A 2MZJA 2CQ4A 2RT3A 2PE8A 1N54B 2VOOA 2E5HA 2KH9A 2CPXA 2MQMA 5LJ3Y 2PEHA 3TO8A 3VAJA 2U1AA 2RRAA 1U1LA 2MB0B 1YTYA 5GVQA 3UCZP 2MKHA 4OZ0A 1FNXH 2CQ1A 3VAMA 2LECA 2F9DA 2XSFA 3DLLQ 5LJ5Y 2J8AA 2RU3A 2MHNA 2F3JA 5GAEU 2XS5A 5GMKa 2MJUA 3CXCR 4QU7A 1X4FA 4Z2XA 2DNOA 3LPYA 2GO9A 2G0CA 2KM8B 2KG0A 1X5PA 4RU2A 1BY9A 2KT5A 1Q7YT 1FT8A 3G9CA 4WFBQ 2D9PA 1CVJA 4FXWA 2L9WA 3US5A 3CMAS 4PKDB 2FY1A 2DGSA 3BEGB 2CPIA 2OJ3A 2I2YA 2NZ4A 1DZ5A 2RVJA 3CCLS 2RS2A 1SJRA 4WIIA 2VOPA 3UE2A 3VALA 1X5SA 4YUDA 1VBZA 2X1AA 3S7RA 1WG1A 3U1MA 2A3JA 2O3DA 4IOCQ 2M8DB 1ZZNA 2J76E 2FPHX 1HA1A 3SDEA 3BO4A 2K3KA 5JVGQ 1M90T 5ITHA 1KQSR 4IOAQ 1OO0B 3CC4S 1KD1T 2G4BA 1VQMS 1R8PA 1NO8A 2M9KA 2DK2A 2LXUA 1DHMA 2LYVA 2X1GA 3FEXB 4TU7A 3UD3P 3Q2TC 2YKAA 2MQOA 4ED5A 3P5TL 2F9JA 3U1LA 1G2EA 1UW4A 4Y0FA 2JWNA 1H6KX 1ZZFA 2DNKA 3VF0B 3I56S 2KU7A 2YWKA 3Q2SC 2MGZA 3HHNB 3MXHP 2XS7A 5EN1A 1SJ3P 2DGWA 4PRFA 1OIAA 5LSLA 5IFMA 1KC8T 2X1FA 3G71S 1JMTA 1D9AA 5DETA 2NLWA 4V19X 3G6ES 2XNQA 3H2UB 4ERDA 4M5DB 1URNA 4TU9A 2MSSA 2DGUA 2DNQA 2FHOB 2CPDA 3S6EA 4EGLA 3TYTA 1FJ7A 2DNYA 3B4MA 2V94A 2AYEA 2CQDA 2MY7A 2JVOA 5LSOA 3NS5A 2E5IA 2BZ2A 3I55S 3G96A 3R27A 1M5KC 3UD4P 1U1RA 1HL6A 2HGMA 1Q86T 5MLCV 2M2BA 5DDPC 3NNHA 1VQ5S 1B7FA 2CPJA 4W92B 1A7GE 2QA4S 4WCEQ 2DNMA 1SXLA 3CCRS 4IUFA 4YB1P 2E5JA 1R8HA 2M52A 1JJHA 3N9UC 1F9FA 2KVIA 2KM8C 1L3KA 5H1SV 1ZH5A 3EX7B 2RRBA 1VQNS 1WWHA 2CQ2A 5DM7Q 2YH1A 4WKRA 3BO2A 2EK1A 3NNCA 2MZQA 4WF9Q 2DNGA 2I38A 4W90B 2LCWA 2MZSA 4Y00A 2DGQA 4C0OC 1VC5A 2CQGA 2MKCA 2DH9A 2DISA 5CYJA 1U6BA 2E44A 1M5OC 5CXTA 2KI2A 1DRZA 1VQ6S 1XN9A 2CQIA 1KOHA 2RNEA 1K9MT 1RK8A 2CPYA 3R1HA 2ADCA 2MZ1A 1A9NB 3IWNC 4F02A 2LQ5A 2KFYA 1N88A 1WELA 2AYGA 2DNPA 1UFWA 4UY8T 2LKZA 2LXIA 1WEXA 2CPHA 1WI6A 2OSRA 2KXNB 2N3OA 3MI7X 2LA4A 3CCMS 3CF5Q 1M5VC 2AYBA 1WEYA 4U67Q 3EGZA 2DNHA 2ZJQQ 2MPUA 1FO1A 4WFAQ 2KRBA 3SMZA 3IRWP 2OTLS 1HD1A 1X4GA 3PIPQ 4PR6A 2VONA 1X4HA 3ZZZA 3VAGA 1WTBA 2MGZB 3PIOQ 2DNZA 3CCJS 2CQ3A 1Q81T 2MQLA 4WFNQ 3P6YC 2CQCA 1O0PA 1YJWS 2E5GA 1SJFA 2MZTA 5GAGU 1VQ7S 1WF2A 1U1QA 1U1NA 2XNRA 5IM0B 2K8GA 2RQ4A 2ADBA 2DIVA 2RUGA 1W2BR 1KOOA 1X4DA 2CQPA 4LMZA 4P6QA 4TLQA 2MQQA 1NJIT 2U2FA 2KN4A 4A8XA 4QPTA 5LXRA 2QEXS 1JJ2R 3FEYB 2CJKA 2DNNA 3MUTP 2LA6A 1OPIA 2HVZA 3THTA 1DBDA 2MKKA 2CQHA 1X4EA 3CCES 2CPZA 2MYFA 3MUMP 3CUNA 4OZ1A 3J7YU 3CTRA 3CULA 4J5OA 1S72S 1X5OA 1UP1A 3SXLA 1VQ8S 3H2VE 3UWTA 2MXYA 2FC9A 1VBXA 2VODA 1S79A 4CQ1A 3D2WA 3B4DA 2ZJPQ 2DO0A 1X4CA 1YJ9S 1U2FA 1FJCA 2MJNA 2SXLA 5D77A 2DH8A 2KXFA 3NMRA 3RW6A 4C4WA 2KXHA 2M70A 1PO6A 3HI9A 3JB9k 4UQTA 5BJRA 1VQ4S 3CMES 3ZZYA 2EVZA 2DNLA 1YHQS 3MUVP 1N52B 2CPEA 3S8SA 1K73T 3MURP 5DDQC 2RQCA 3TP2A 2L08A 2DGOA 1NU4A 2M7SA 3DXBA 1U1OA 3K0JA 2HGNA 2MZRA 3UCGA 2MKJA 5LXYA 4CH0S 5HO4A 5GADU 3CCUS 4F25A 2DGVA 2LEBA 1RKJA 3CC2S 3P49B 1X4BA 1D8ZA 2OSQA 3UCUP 3R1LA 1VBYA 2MKSA 1QVGR 1FXLA 1P1TA 1VQOS 4LJMA 1X5TA 5DM6Q 2EK6A 2JVRA 3NNAA 2MMYA 4TU8A 3RW7A 2RS8A 3L3CA 3CC7S 2DO4A 1WHVA 2XB2D 2MQNA 3P3DA 2G1DA 1H2VZ 2N3LA 1U6FA 3SDEB 2N82B 1U1KA 2AD9A 2JX2A 3CCVS 1YWXA 3S01A 1SJQA 2M4MA 2DB1A 2DHGA 2HZCA 4CIOA 1HD0A 5DDRC 2ZJRQ 3MOJB 2DHAA 2WBRA 2DHXA 2FC8A 2DH7A 2CQBA 2MQPA 2X1BA 3VAFA 2DIUA 2AYMA 3MDFA 3ULHA 3OW2R 3CPWR 3THPA 1WEZA 2DGXA 2DGTA 1VC0A 1U1MA 3NS6A 2M8HA 1WF0A 4F26A 1VQLS
chains in the Genus database with same CATH superfamily
3L9ZA 2FZCB 5B0GA 1IQTA 1IKXA 1TTHB 3KJVB 3ENWA 3ZTSA 2Z2LA 4ECTA 2CVIA 2VUGA 4WTOB 4B3TF 3PYGA 1NK9A 5IT0A 1WI8A 3ZZPA 1D8YA 3Q8YA 3JQJA 2UUTA 4P75A 1WDDA 2W9BB 2FHJD 4C6AA 3A8JA 4NLRA 5A8KA 2IDEA 1RWNB 1UWBB 1BQMB 3AB2B 3D6HB 4N5SA 5J2MB 3TQ1A 2HURA 3HJFA 4USMA 2AT1B 4CH1A 2ILZA 5JMNA 2XMVA 3EWGA 4GC6A 2FYXA 2G9OA 3L7OA 4AL7A 1YI2S 2YNGB 4DJBA 3E3XA 3MMAB 2GHPA 3T41A 4ZVFA 1G4CA 1X4AA 2LEAA 4QW8A 1FX4A 2CPXA 5C25A 1V5IB 1TUVA 3H0PA 5GMKa 3AQOA 2ATCB 4WKYA 1XQIA 2GO9A 2JFKA 3OD2A 2KM8B 4DR2F 1Q7YT 1RCOB 1IKYA 2DEJA 3G9CA 3JYTB 2L9WA 2HIQA 4UUXA 1S6QB 2EI5A 3SZ2A 3AODA 3IS9B 1R7IA 1UJ5A 3FMWA 3A3NB 4NOHA 1Y5NB 2M8DB 2EC2A 4DR3J 1VQMS 5EWFA 2M9KA 2IM2A 3EVOA 3UD3P 5A6WA 3OXFA 4PPDA 2ZE2B 2EKYA 2F9JA 2FB0A 1JLCB 4K4ZA 4G1QB 1U8WA 1SJ3P 2DGWA 4X62J 3TAMB 2AU0A 1YSJA 2C2MB 1S97A 1JMTA 4EK2A 2W2NP 5HVGA 3W2WA 3C14A 3IBWA 3BR8A 2QA4G 3MM6B 2Q66A 4F4KA 4OJ3A 1CJKA 3TYTA 3R5GA 1QAIA 4ZP8A 1F5CA 5FDLB 2F8HA 4FF2A 2XCPA 4B3MJ 3EZUA 3R27A 5KT7A 1ZAVA 1X8DA 2BE9B 4IFYB 1HQUA 1F9EB 2GHWA 3O1LA 3QIPB 1NH7A 1N5YB 1DARA 3D66A 5E3RA 1X0PA 3QGPA 1R6YA 2PI5A 4U7UD 1EP4B 3POTB 3HCXA 2YNHB 2JFDA 3CDEA 1ZH5A 1ZA2B 3EX7B 1VDHA 2YNFA 4QWCA 4DR4F 2EC0A 3W60A 3HLUA 2LCWA 4U8YA 4LQ9A 4ECWA 1QAJA 5CYJA 5EX3A 3TA1A 3CIMA 3U1NA 4C8KA 2CQIA 2RNEA 3GSIA 1RK8A 5ETPA 1EETB 1FWPA 2GZOA 2CJAA 2LKZA 2LXIA 5GAHI 2VG7A 1R89A 1IKVB 3QT6A 3NKYA 4C8YA 2FJXA 3NBPB 1UVKA 3TI0A 2GO8A 2A2CA 2AYBA 4U67Q 1UL3A 3VGTA 1X4GA 1TAUA 2CWXA 1CC8A 1Y4ZB 1WC3A 4KHPJ 4A8MP 5CD4A 4WFNQ 1FI4A 1FX2A 1RT6A 2O1PA 1U1QA 3SCLE 5IM0B 2UXDF 4DR6F 9ATCB 2EWHA 2B5JB 2W9BA 3KLEA 3PW0A 3BKUA 4F3MA 3ISND 2V6AA 1UFKA 1F9HA 2UU9F 4AL5A 2YQ1A 4CLLA 3KK2A 3VZHA 3SSRA 3EDQB 4B9MA 4MFBA 1S79A 4CO0A 2GAGC 5C42B 1NK0A 1Q8BA 3WZ0A 2HBZB 3NOCA 4AD6A 2HNDB 2GC8A 4QBUA 3PW2A 3T6BA 5BJRA 2DD8S 2XMMA 1Z1ZA 3VR1A 2CPEA 4E0DA 2EEYA 4UZBA 1VGYA 3M8PB 3ZO7A 2NUHA 1DJ0A 1UJ6A 4DV4J 1RKJA 4CYUB 4R8UA 3RW7A 4BCAA 3CC7S 4L73A 3SQOP 3ILOA 3D6FB 3H20A 3KDNA 1HHQA 1WSRA 4CO5A 2PEBA 3MTJA 3W62A 1G6BA 2K2PA 1R0AA 3S01A 5CYMA 1FDDA 3NP5A 3IS9A 2CG8A 3T1YJ 3X1LB 2LEPA 1QE1B 1S4EA 1TL3A 2BOAA 3R97A 2P8IA 4ED2A 3MEEA 4KE5A 3R7BB 3C6UA 1AZSB 1M5PC 2E1CA 4KHRA 2IHR1 3FNNA 2MDAA 1ZAXA 1P27B 4PAAA 3G87A 2KRRA 3RB4A 3R2CJ 1WOOA 4N56A 4C7QA 5HJYA 2OP5A 3OJSA 1T03A 3OBIA 3JSMA 3FFIA 2OEJA 1VRTA 4F67A 4C97A 2XY7A 2OIHA 3N6LA 2N7YA 5LM7E 4O3SA 3CJRA 3HULA 3GG0A 1LW0B 1OY6A 4DQPA 4E8UA 1KLNA 2UUBJ 2B7BB 5E3PA 1GX6A 3HHLA 2MJUA 1N5VA 3V6JA 4S0MA 3TX0A 1H3DA 3KUGA 4PCQA 3SSQA 4I1TA 1BY9A 2DRDA 4ZPWR 1LWFB 1S6UA 2W25A 1S76D 2D74B 5ADZA 5KFEA 3ZFVA 5J1EA 1I94F 2VPWB 2IC3A 3S7RA 1WG1A 3NGRA 4QWDA 1RAJA 2EW9A 1FKAF 2KZMA 2HQ3A 5HQMA 2FLNA 2VG6A 3VCDA 4DU8A 2ZDOA 2Z2YB 4P2XA 4M63A 4X65J 1DHMA 2ZM6F 1NB2A 4J9QA 4RW4B 4TYBA 3MCMA 2WK4A 2BJDA 5A8WA 2KU7A 1MU2B 2JSXA 3D1HA 1SB6A 4DUTA 4PRFA 4ID5B 2VDIA 2Y0SD 2VZ9A 5I3UB 4LFAJ 3HSJA 5LOQA 3HF5A 3RAMA 1Q0NA 3LPEA 4HHHA 1HYSB 5A76A 4DCPB 2J9DA 2ZEJA 2Q6BA 1BGXT 2VQEF 1S1WA 3EICA 4LBIA 1RTJB 3LALA 3EXYA 4OI2A 2AYEA 1HPZB 3NY0A 4J9OA 3Q0AA 1Q86T 2HZVA 3NNHA 3IR5B 4DR5J 4DV3J 1S1UA 3MPYA 2A10A 2VFUA 1R8HA 4X4QA 4ZVGA 2HNDA 4UQGA 3OR2B 1F1BB 1Y5LB 2RUSA 2E66A 4CTAB 4JI4F 5IS2A 1NK8A 3MM8B 2I38A 3FZ2A 4R0EA 2MHEA 1KN6A 1HWUA 2C28A 3U02A 5JJBA 2E44A 3KYLA 1JB0C 1GXUA 1HQEA 2HNZB 2UUCF 5HANA 4LT6A 1HI0P 3MI7X 1M5VC 2DNHA 1FFSB 2ZJQQ 1HD1A 4JI2J 1WC6A 1LWCB 1RBOB 1YVFA 1NK5A 1C0TB 4DWIA 1KKHA 1RT7A 4K4WA 2BJ1A 3R5DA 1VK8A 3GPAA 1RT2B 3UDLA 4C0HA 1D09B 2KN4A 4QPTA 4YB5A 1FNOA 4WP3A 3AHPA 2RQKA 5F8HA 2ZH2A 3ADAC 1OJ4A 2CG4A 5THWA 4Y65A 3SYZA 4DV1J 3SEOA 2IMWP 3CJ0A 4LSNA 5K8PA 3H5YA 3D2WA 2OFGX 4WTYA 2SXLA 2JEIA 3V4IB 1N4LA 2RDJA 2P9GA 1U09A 3HX9A 3ZZYA 3M2VB 2VFSA 3CDUA 3S8SA 4LF4F 2OFHX 2D41A 4KV8A 4JI0J 1S12A 1ICEB 1JLBA 2EXUA 1UVIA 4PG4A 5LSRA 4LBPA 3CT9A 2HQCA 1HI1A 3OL7A 3V2UC 1GMWA 3M8QA 3EVWA 1JXLA 5KFRA 3SDEB 3C19A 1HNWF 1C4AA 4ECVA 3MPVA 3BSCA 3AA9A 2DGXA 3LWMA 3H59A 3ZXWA 2QJ3A 5KFSA 4B9NA 5KG1A 1RAEB 3QT5A 3PW7A 3TEHB 4HACB 4K2XA 5CAAA 1JLQB 4LRFA 4J9SA 5EWEA 3ICLA 4P2SA 3MR5A 5D6GA 1RWXB 4RW4A 4HVZA 4ZDNA 4O3QA 4DV7F 1NHVA 2R7SA 4OZNA 1ZETA 2QTWA 3MZIA 1K8AT 1JLFB 5DQGA 3FDSA 5DG7A 3C3LA 2Q79A 4OYXA 2DNRA 1HYSA 2XO6A 3DGPB 1HWJA 3KHGA 1TVRB 2VC0A 4QOTA 5KG3A 4CM0A 2C2DA 1LFWA 5AE1A 5HROA 3CD6S 4OX8A 1GMUA 1O6XA 3TO8A 1VISA 1S99A 3QT8A 2XSFA 2F1FA 1D9FA 2OPQA 5M2PA 4EYHB 3CCWA 2WRMA 2WOMA 4X4UA 3C16B 2HRTA 1NBEB 2GX8A 5GMDA 2QRRA 1FWKA 3CDBA 2VKRA 2CPIA 4C8LA 4YHHF 4F36A 1WD6A 3NRBA 3QO9A 2WTFA 3VALA 1IQZA 3T1HF 4K2JA 2HMIA 2OKQA 4OL8A 3SI8A 4O0NA 1SC3B 2VKZG 1Q79A 2LXUA 1VHIA 1N34J 3HP6A 2CJYB 2HNYA 4ELVA 3D4JA 1FXRA 3AOCA 3Q2SC 3QATA 1RDRA 2CA9A 3GG1A 2D7SA 2FJDB 5ETMA 4F4AA 2V2VA 2DGUA 2J6SA 1HNZJ 3PO4A 3DHXA 2UV8A 3GV7B 3IBFB 4A8FA 5J2PA 2HFZA 3TZYA 2CQDA 4RJVA 2B4OA 1Q78A 2JVOA 3AA8A 2QSFA 5KFVA 3BBBA 4Y3CA 2ALZA 3UD4P 4DF8A 1FEEA 5KT5A 1NM2A 4USWA 4YFUA 3LH2S 2M52A 2J5AA 3HDSA 2VBXA 2YWEA 2CQ2A 2C2KB 3V81A 4ILMA 1U8SA 2O5DA 4WF9Q 1B0PA 3LAKA 4Y00A 2Y1JA 1RP5A 3DRSA 2PI4A 4USUA 2DISA 3CD0A 3M1VB 1HFEL 1ZAWA 5ETQA 2MZ1A 2J9EA 2J9DE 4K4UA 1A9NB 3E01B 1E6YB 1FWLA 4CT8A 4NLOA 2OSRA 4QWEA 4WU3A 2N3OA 2FDNA 2E9RX 1WJ9A 4ZVUB 3HVTB 2OPSA 3A8EA 1NRKA 4PR6A 2PFFB 2DNZA 4MK8A 1JLQA 1EJ7L 2MZTA 1CQMA 4Q44A 4Y2IA 1R27B 2B9WA 5BYRA 3I9V9 3MEKA 1Y7PA 2XWXA 2HVZA 2YKMA 3TAPA 1PILA 3NMAA 3Q83A 3RAXA 2Q6CA 1S72S 4X66F 5SUHA 4OYMA 2ZH1A 1FKPA 4USJC 3D68A 2FC9A 1M5SA 4O3PA 4M5GA 4CQ1A 2OMLA 5K14B 4ED0A 3GLJA 5KFFA 2BW2A 1S1VA 2ZJPQ 1YJ9S 3CE8A 2MJNA 2PSZA 1VI7A 3JB9k 3A13A 3BBFA 3M32B 2HVHA 1N52B 2B9YA 2MQ8A 2BQ3A 2DGOA 4ZVSB 3PW5A 1RE1B 2FJWA 3K0JA 4EO8A 3KK3A 5HO4A 1QVGR 1HBUA 2JVRA 4OV6A 5F3ZA 3NAHA 2XG8A 4DR2J 2GCFA 4DF4A 1HIYA 2JX2A 3CCVS 1SJQA 4O4GB 2DHAA 2X1BA 1MMDA 3QWUA 3OUYB 2DGTA 2XLIA 2E1AA 3K58A 2NS1B 1WDTA 2QV6A 2JHEA 1RJJA 1P6TA 3NGTA 4AUKA 2YKOA 1EX8A 3TEGA 4JV5F 1XK8A 3BS9A 2BA9A 2HYIB 2R7XA 2R7WA 2V9WA 1RWPB 3O2IA 5HQ8A 4ED1A 4IO9Q 2HK2A 2RRNA 2V2QA 4OZJA 2BE7D 2ZOMA 4QZVB 1VQKS 4DX6A 1G7CB 2HHUA 3CD7A 3QSIA 3B78A 2FY8A 3KLHB 3VAKA 2A6MA 4ECQA 4NEZA 4F4XA 2XZTB 1RTDB 2W4PA 3QQCD 1XR5A 1MG7A 3ISZA 1HBOB 1UEUA 3HK2A 3R5JB 3MFHA 2DY1A 1SC1B 2KH9A 3HVRA 5GVQA 2FHMA 4YR0A 3J7AN 2XS5A 2HVDA 2ZBIA 1X4FA 3RJMB 2HHQA 3HD2A 2V8PA 2HQFA 2CJBA 3BH6B 1TKTB 5BXIA 2FY1A 4H4MB 1FRHA 1RTHB 3OFEA 1RHMB 2YVSA 1PIEA 5LL6d 1QY7A 2VOPA 2K1RB 4IKAA 5AJ3F 4RUCA 3DRYA 4XIUA 4DL4A 3E01A 5E3CA 3N28A 1HHTP 2QLWA 1NJYA 1OO0B 1G3OA 3QMQA 3IAS9 3HVTA 4YDXA 4TU7A 5EWGA 3FVYA 2OPRB 4F4ZA 3P5TL 1UW4A 2DNKA 8ATCB 1AYEA 3PX0A 4NMLA 4WJBA 2EFGA 2EBGA 3BKFA 1XC9A 4K50A 2I1RA 1S0OA 4IFVB 2NLWA 3OFGA 4V19X 4FPIA 3NCQA 3S6EA 1A6LA 4USIA 3T9ZA 1T05A 1JQGA 2BJ3A 1NXIA 3VWSA 4DV0F 3JTPA 3OTOF 1IKWB 1HNIA 4AFFA 1HL6A 4OHWA 2FZKB 2UU9J 3U27A 3MM9A 2GJFA 1A7GE 2R7VA 3PKMA 4YB1P 1RHQB 2QMUB 4M5JA 2CUYA 1CLFA 2CIMA 1C0UB 4URSA 1N32F 5CHCB 3HVAA 3LAMA 1HBMB 3UFCX 4LR8A 3CO9A 4C0OC 3HO1A 2ZH8A 3QGGA 1EKSA 1GTEA 5SZTA 3FBEA 2UXBF 1T94A 1HW9A 4ZVQB 1JIHA 2I6WA 3QJLA 2MLXA 4RX6A 3DI6B 1RWUA 3EGZA 4DG1A 2X7IA 4ZLLA 3H90A 4GVBB 2DTJA 3KKFA 5I3QA 3KFWX 1YJWS 4RBUA 2FTRA 4IQXA 4DDFA 2DKOB 1FDBA 1SH3A 2CNKB 4RNNA 1R8AA 1PYOB 1RT3B 2OMOA 5KG6A 5D4LA 2C2ZB 1OPIA 2UUAJ 2CPZA 3TJAA 3BQ0A 4AL6A 1JLGA 5HATA 3UVJA 2W01A 4ZK7M 2UXCF 2OLWA 1VQ8S 2IRXA 4KGZB 1VBXA 2K7KA 2BQUA 1U45A 3G6YA 2V5HG 3KLGA 4EWTA 2HRUA 5DDQC 4HH0A 1RADB 3L09A 4NA3A 4CLZA 2A1BA 1UVLA 2HIYA 2DGVA 4ZJQA 2OSQA 1FXLA 3UCUP 3ENVA 5HMWA 3BPSP 1JXVA 1SUQA 2KT3A 2J7WA 4J37A 1FKOB 1Q8LA 5B0EA 2P6TA 2CJXB 1MMNA 3QRQA 3QZ7A 4H4MA 4LUBA 1S57A 2BUNA 4CT9A 4M5IA 4OHVA 1MWZA 1NSPA 3G8TA 1NPRA 4QQBA 4QU6A 3MD3A 4HDGA 1OQ6A 1XWLA 2QL5B 3HM9A 4I2PA 1V5VA 2RU9A 5FLXY 4ECSA 2ZM6J 1TL7B 1SI9A 3ZTPA 5IWAF 1FJEB 2KYXA 2CDQA 3IBCB 1HW8A 4DSLA 2J0QD 4CLFA 1D3WA 4ANDA 4TLRA 1TU0B 2Q3PA 1G1XA 5HK4A 1PKUA 1P8GA 3OL6A 1X31C 2VQEJ 3EVMA 4JV1A 2EFQA 5KFDA 3IMQJ 4IG3A 3OFHA 1FRXA 4R5PB 1CBKA 5B08A 2DRAA 1YTYA 1T8EA 4FF3A 1XIQA 4DPTA 1FNXH 3OR1A 3DLLQ 4WP8A 3H40A 3GIMA 4ETXA 2PD1A 4L76A 2E7WA 3RAQA 1C0UA 4ZPBA 4LBHA 4RL1A 1PJ5A 2FVSA 2KG0A 3GFZA 2GS8A 2BYCA 1RU2A 2D9PA 4B9VA 2W9AA 2XYGB 3K17A 5I4MA 4PKDB 1U4BA 1FJGF 4ZLPA 3BEGB 3G6VA 4DSEA 4TY8B 1BE4A 2W7OA 3CCLS 1KS2A 1GTHA 1RUSA 1SBRA 1NNDA 4BDPA 2HHVA 4U7CA 2B56A 1DURA 5JVGQ 3CC4S 2IBOA 2UUCJ 2CZVC 1WTFA 5KFQA 2NQPA 3M2RB 1Y3KA 2X1GA 2MKYA 3TA2A 5C24A 3U1LA 4Z7YA 2AEFA 1JKHB 4DBQA 3HHNB 2NXCA 2CJ9A 4NWBA 3MR3A 3MR6A 3VTIA 3I32A 2QA2A 4DCJB 4W98A 4I2QA 4IR1A 1B70B 3LP1B 3EPIA 2VA2A 3ZTQA 4YB6A 1TELA 3C6TA 1YK9A 3DOKB 4LIWA 7FD1A 3GILA 3BF4A 4WE1A 3AJDA 2HPUA 2HS0A 3JXOA 5DDPC 3O44A 2F63A 4BC9A 1MMLA 3GIKA 2KTQA 1TKZB 2BEFA 2BE2B 3FK4A 3IM8A 4RUAA 1ZYQA 5IC6B 1TKXB 3QLHA 2YH1A 4XDDA 3R6LB 1PC5A 4DN9A 4J9VA 1S49A 2RQMA 4QPXA 4LF4J 1UJ4A 4FYXB 5DLGA 5F8GA 2LLZA 5F0UA 1U6BA 2QN6B 3LTOA 1V3RA 2HG4A 2QGFB 3CJ8A 3MMBA 1AROP 1WELA 3F56A 4DUYF 1WI6A 1HNWJ 3VVUA 1V3ZA 2IDLA 2HBQB 3OTEA 2OTLS 1X4HA 1UPMB 3ZZZA 2ZC4A 3SV4A 3FSXA 3IN5A 3PG9A 2QLBB 1RI7A 1SJFA 3M9NB 2K8GA 4M1KA 3M8RA 3GMGA 1WUUA 1SQFA 2ZHBA 2QZ8A 4DV7J 3HXMA 3LUYA 2CJKA 4AXJA 2ATLA 1J5EF 2CQHA 5HBMA 1JLAA 3GU0A 5HSPA 1YRTA 3W8GA 2FVCA 3IXQA 1CS4A 3CTRA 4J5OA 3CSKA 4OMFG 3BSNA 1UVNA 2AJFE 4ZP6A 1H7XA 2LQ8A 5DLFA 2F7VA 3KLFA 4DN0A 3MHYA 2I9SA 3M4XA 1NSQA 1NDCA 3D6MB 4GC7A 4DUZF 7AT1B 5D0HA 1IM6A 3EGVA 2BKPA 1XTZA 1N6QB 4H4OA 1MSWD 1C1BB 3T5HA 3AD8C 3HHKA 2LEBA 2YKQA 3DHWC 1LV5A 2AKWB 5DM6Q 4KB7A 3D0IE 1V9OA 1H2VZ 3MEGB 4NLVA 1S9EA 1XR7A 1S9GA 2Y9HA 4TY8A 2HRYA 3MOJB 1ELOA 3OW2R 3D28A 5IQ6A 4YHHJ 3CO0P 5LMUF 5JVHQ 2Z0GA 1OYEA 1B3TA 3T1HJ 2QYGA 4MK9A 1FERA 4UOHA 4KC5A 4NA1A 1YJTA 2IJFA 1FTCA 2DHSA 1M5HA 3R6GB 2RSQA 4EZ6A 1RAHB 5CQGA 2LQ9A 3MD1A 1T9WA 5KFLA 3EZOA 3I5BA 4AT1B 1YRUA 4YY3F 2RKIB 4HR2A 4F2RA 4KO0A 1N8RT 1T0TV 3LP1A 3RBDA 2VV5A 4IDKB 2IPOB 4WXOA 3VQTA 2P9EA 1SC4B 1CJVA 1TL5A 3C15A 2QLFB 4LIRA 4LSLB 1M0SA 1RT5A 4L3KA 2JL9A 2ZC3A 1N54B 4TXSA 4H4KC 5HVFA 4NCAA 2NCKL 2X3DA 1QJHA 2MKHA 4LSZB 2GIFA 1REVA 2J8AA 4B3OA 2ZZMA 2FZGB 5HN0A 2IIHA 2RF2B 4Z2XA 5U47A 3T3FA 2DY9A 2AQ4A 2JEJA 2WVDA 4RU2A 4RNFA 1HLWA 1DTQA 3US5A 4C98A 1ZTWA 1BQNA 4F50A 5KG0A 3HPOA 1FK9B 4OZLA 4P2FA 1NSAA 1S1XA 1W2IA 3G82B 2PT0A 2LFVA 1BMQB 1UWAA 4C9DA 2YNIA 1HA1A 2IAJB 2RD5C 4GO5X 5KFYA 1J5OA 4IOAQ 1B64A 2GA7A 2DK2A 3D6TB 3GP9A 3HFKA 2GJIA 3IRXA 3O3LA 3LW5C 5KFTA 3DRPA 1Q53A 3CJKA 4JI5F 4GKKJ 1HMVB 4RWWA 3PJWA 4RW8B 1RACB 4RW9A 2YWFA 5LSLA 4X4VA 2X1FA 1VFJA 3KK1B 1VQYA 4TU9A 5J2NB 1CJTB 5L9NA 1RCXB 1R8CA 1IVZA 3IG1B 3M8WA 4KIAA 3IC1A 2V0NA 2XHCA 3EJMA 1OQ3A 1BWVA 1RHJB 3I9ZA 4DR5F 4ZHRB 4DV3F 2R2TA 4IG0B 2GHVC 2GGPB 5HMZA 3M2UB 2QL9B 3GJQB 4I68A 4F2SA 3DLEB 3TZZA 1RXOB 4ZN3A 5KFJA 2A2DA 3T5KA 2KVIA 5G0RB 2CVEA 4FXDA 4Y2AA 1OMSA 4KSEB 3ET6B 1N6QA 4CLYA 4A47A 4EBDA 4PWDA 3IGNA 3GIJA 2CQGA 3W64A 5J2QB 1P1LA 5K5MA 1H72C 2AJ1A 4C8ZA 4DS4A 1IR2A 1K9MT 3W5YA 2ADCA 2VBYA 4FPRA 3ZNJ1 2K7JA 2B9EA 4O44A 2LQ5A 4OZ2A 3PTWA 4JI1F 1HNXF 3NCPA 2ALYB 3SIPB 1KLMB 1FO1A 4ZLNA 4MIAA 3SMZA 2QMWA 2FJVA 5F8MA 1EB0A 5CZVA 2VONA 1U0HB 1WTBA 3MFIA 1M1GA 2LQBA 3D9BA 4LFBF 4W4MA 1OYDA 4QR0A 2HKEA 2ZFHA 4JV5J 4WFZA 2DIVA 3AT1B 2ZOGA 5ETNA 1UEKA 1X4DA 3FMBA 3IWXA 4MYUA 2AGPA 3BQ2A 4MKBA 3LF0A 2LU2A 3K5PA 3RUBL 2MYFA 1IJFB 1AW0A 3ZZUA 1PYSB 2W2OP 1CULA 1S4FA 1NKBA 3NG8A 1B99A 1VIXA 2R3VA 3DNCA 2C2OB 2DO0A 1FJCA 1NKCA 1L3VA 2HFVA 3TOQA 4ZOSA 3W9JA 4CO3A 3MM5A 5A0YA 5IV4A 1VQ4S 3CMES 3M6WA 2N4CA 4OQJA 1S1TB 2L08A 3SQGB 1ZTTA 2AWZA 1NU4A 1U1OA 4NLPA 4LVNP 8RUCA 3GYXB 3R1LA 2IA0A 5A2QY 5C7PA 4A8SA 1F5AA 2RIJA 2V2ZA 5CCLA 1WC1A 5B0DA 1FE4A 5FD1A 5KFNA 4F3OA 2M4MA 2Z58B 1HD0A 1FK9A 1BD6A 2WBRA 2DIUA 3TA0A 3ULHA 3ZZRA 4DCOB 1VQLS 3GE9A 4KT0C 6AT1B 5AJ3J 1KFDA 4LRBA 2QFJA 5F8JA 3PCOB 4RW6B 2KHCA 2BACA 3A4TA 1WOPA 4CP5A 3QYYA 4IQMA 1VRUB 5AXKA 2IA6A 4PQUB 1UW9A 2F8MA 3Q8SB 1NK4A 3AD9C 2FHJA 5ETKA 1FNMA 2HS4A 2XS2A 3MM7A 4FF4A 2XMJA 5IC4B 2BW7A 2YPYA 4KGMA 1KHWA 4OX9F 1VQ9S 4ZLJA 1TAQA 3UI3A 1AUDA 2BJ7A 4U8VA 4EUVA 2BANB 2KKHA 4GRSA 1K1QA 3PFEA 2Z8QA 2B6AB 3GV8B 3EGWB 2ZBQA 2V4JB 4C3MA 1LNQA 4DV0J 2BQRA 3OTOJ 1RB0A 3H7HB 2XSJA 2MB0B 3VAJA 1U1LA 3MEDB 2RILA 3DXSX 3O6QA 3DM2A 3UCZP 3M7VA 2ZNZA 4KFBB 5G0RA 3H25A 3R5AA 2ZHOA 4N47A 3RB3A 4BLGA 4G6VB 4PUOA 1RT1A 2LDYA 2V2KA 3AB4B 3I96A 4NCGB 4HKQA 5MAOA 3PVXA 1VQSA 2J9CA 3OPKA 4GMKA 1VJWA 2W4DA 2AJQA 2ZNYA 3DGVA 1DTTA 4CI0B 3GB0A 2UXBJ 5D3GA 2FUG9 4QWBA 2LYVA 4NASA 4HTJA 1Q8IA 1TK8A 1RT4B 3KG1A 3MTKA 5EX0A 5CD4H 1RAIB 5IFMA 4KKOB 2ASJA 1VLOA 3PDNA 4MMOA 3H2UB 1MROB 4DMZA 4M5DB 4ZPTR 2H65B 3DLKB 2Q1LA 4RBVA 5B0AA 2KB2A 2DPIA 1FJ7A 2DNYA 4KPCA 2MY7A 1RBLA 1DLOA 4DFMA 1SKUB 2IMOA 2QA4S 3RR7A 2UXCJ 4RNHA 1QTNB 2PC6A 1T11A 2E5JA 1F0XA 2OAUA 1JLEB 3I0RA 1NEEA 4A4JA 3DOLB 1U7LA 3TVYA 1K0VA 1F60B 4A8KA 3R8YA 1RYRA 3JSYA 2OH2A 1S6OA 2H48B 4ZCMA 1TMMA 2EFNA 3A3PB 3AQPA 5CXTA 1VCTA 1XN9A 3WC0A 2XZWA 3H4DA 1H7WA 3GQCA 5KFZA 5D0GA 2WZ1A 3KHRA 4GKJF 1PAUB 3MOZA 1WSVA 2VICA 2MTLA 1LKZA 1CC7A 1KTQA 4O3OA 1UMJA 1UETA 3PV8A 3G6XA 4C3LA 4ALZA 3CCJS 1F3VA 1JXEA 3NWGA 4DL7A 1ROFA 3UDCA 4Q5VA 2WONB 2GVZB 2JC1A 1TFYA 1F6TA 4KY3A 5C2CA 4NLWA 4CLUA 3P4UB 1VLYA 3Q8VA 3SFUA 4ITSA 3H5SA 5IWAJ 4C11B 5LXRA 1LK7A 3FRYA 2DNNA 3THTA 3OSNA 4B9LA 1U25A 2OPPB 3G86A 5F9LA 2W8LA 3MUMP 4EBEA 4O4RA 4OYOA 3GJSB 1FE0A 2D3O1 2O01C 4U6PA 1YLXA 4P52A 4OJHA 2WVCA 3EXCX 5AXLA 3MAAB 2RH3A 2KZZA 2BJ9A 5HLFB 4PWWA 4K5RA 2CADA 3SCKE 2H4YB 4ES1A 3HI9A 4PG6A 3MUVP 2W9CB 5KT4A 4HTIA 1RTIB 1Q95G 2EKNA 2DT9A 1D8ZA 1HNVA 1VQOS 2MLYA 1GX5A 4YN3B 2DO4A 2MQNA 3EM1A 2G1DA 1KQFB 1EARA 1Q5YA 5F9NA 5F3TA 2AYMA 1RHRB 4NI2A 1FJGJ 2J7UA 1VC0A 5IZHA 4OZ5A 1S7IA 5DDOC 1VMBA 3V6DA 1H2UX 3DMJA 2R2RA 4M8LA 5D4OA 3VVTA 4G65A 2LMIA 3CDAA 3ZNUA 2JRSA 2POKA 2E9ZA 3PZPA 4K4SA 3W2VA 2W2PP 1RT4A 1RBAA 4FZVA 5I42B 3IWLA 5IQQA 1WHWA 4LF1A 1OWXA 1MROA 1T9VA 4Z37A 2XZDB 2KHDA 2V63A 3QRRA 1TL4A 1Q7LB 2OTJS 1JX4A 4U95A 5GADI 3I82A 1S7HA 3OVBA 3PM9A 2H3EB 3K5OA 4JP8A 3W9IA 4ZVOB 1YJUA 4RWXA 4F4YA 4DR1F 2MHNA 2F3JA 4WZMA 2KO1A 1UCNA 4USHA 4RKUC 1RWVB 2QO3A 2J0XA 1GAOA 4DXLA 3KJNB 2VBZA 1NUEA 2KT5A 5CABA 3GFXA 3M8SA 2DR5A 3C2PA 2Z57B 4LF9F 3CMAS 2NUUG 4PEOA 1L3SA 1DQAA 2BDPA 3I5AA 4N7TA 3QWPA 2HFSA 3GV5B 4RW7B 4OJ1A 3S1TA 4ER8A 1Z2LA 4X4RA 1KSPA 3DOMA 1FRKA 2DYAA 2ZD1B 1XEZA 3DFEA 2HSEB 1RAAB 2NZCA 2K3KA 1IBLF 1KD1T 2B4VA 1VK3A 3J80Y 4DUYJ 3M9MB 2YKAA 3EDRB 4CO1A 1J27A 1G2EA 4O3RA 4RBTA 3KJVA 3PRVA 1EQ0A 1AB8A 1TL1B 5E3QA 1HR0J 2W24A 2RDDA 4ICLB 1SH0A 3M30B 3UR0A 3ILLA 4F0KA 1URNA 4A8OA 4OYWA 1QDUB 1R6VA 2X3GA 4HHJA 1MLAA 3F44A 3LP2B 1SKRA 1UWBA 3B4MA 2QLJB 1BQMA 2OPPA 3MCOA 4FVMA 2IM1A 3BGRB 1GH8A 2E5IA 1J5EJ 1FA0A 1KVJA 3G96A 1FF2A 5J2MA 4DPUA 2GVDB 1F3FA 2DNMA 2RE1A 3OLBA 3UR3C 2YNGA 4X2BA 4Q2LA 4ATNA 3MMAA 1XMOF 2R7RA 5DZ7A 4DUZJ 3M05A 2PMWA 2MZQA 4NYPA 4TY9A 2MKCA 1CJUB 4NXNF 3QPIA 3R9LA 3V6HA 3HHEA 3P8BB 4F02A 3JYTA 2HW3A 2DNPA 2WSCC 3L7UA 2CPHA 3UQSA 3OL8A 4LF7F 1S6QA 4I7FB 2ZH3A 1F2GA 5ETLA 5LMUJ 1TFWA 4F8RA 4MAKA 5A2QU 4DV5F 2L48A 2W2QP 3LP0B 4HLBA 1Q81T 2GQ2A 5D0RA 2CQCA 1O0PA 4R0JA 3DU6A 3BV8A 1MW7A 2ZE2A 2RUGA 4HEA9 1JLCA 3TVKA 1NDPA 4G1QA 2Y1RI 2U2FA 3K8WA 2UUAF 1RQ0A 5KFAA 3MUTP 1QTMA 3TAMA 1YRXA 2MKKA 2ASLA 5HQLA 3CUNA 4YY3J 3J7YU 4JB8B 3MM6A 2V9KA 4KGVB 1TZ0A 5FDLA 1YBUA 5A8RB 4DFPA 4NLTA 4EEYA 4ENOA 4J9KA 4JV2A 3C8YA 2KXFA 4IFYA 2VJUA 2ZWOA 4WWSA 2EVZA 3PKYA 3QIPA 1E6VB 3I87A 1N5YA 1YBAA 1I3OB 1SJ1A 4N77A 4ELTA 2MZRA 2BR0A 1EP4A 3POTA 4NE9C 3HD1A 1VRQC 2YNHA 5K8NA 5E7OB 2MKSA 2G0JA 4LJMA 4NZ0A 2AV5A 2EK6A 3I31A 3NNAA 2DPJA 3FBFA 4P71A 2V50A 1LWEB 2HLUA 2RS8A 4CM2A 1WHVA 3DDNA 4MK7A 2C2EA 1SH2A 1XJWB 2RHQB 5DO2A 3TVZA 2V34A 1NCLA 2DB1A 2R7QA 2ZH9A 1UVMA 2W7AA 5GAGI 1C1CB 1RISA 3A8KA 3B8HA 1EETA 3BKTA 2RMLA 1QLNA 1IKVA 3CCSS 1NZ8A 4ZCIA 2B8PA 4B9UA 2DITA 3NBPA 2D69A 4PG7A 4ZJLA 1Y0HA 2XI2A 2OUGA 1PGZA 1SQEA 1XMBA 3JQKA 2J6UA 2EG1A 5KG2A 4USVA 3IFEA 4JI5J 4EFAC 2VG5B 4QIVA 3M6XA 3TX8A 3M30A 5IM0A 2YX7A 5T7LB 3W63A 2B5JA 3TANA 2VF3A 3LP2A 4OLOA 2HZAA 2B0GA 4Q43A 1S10A 1KVIA 3QNWB 1NJWA 4C8MA 2E29A 4QCLA 1WOSA 3DRXA 4ZVEA 4OZ3A 1QSYA 2R8IA 5C42A 2JNJA 4OZ0A 5HJXA 3D67A 4OYPA 1V6HA 2AP6A 1FRLA 3DLGB 2ZDPA 1X5PA 3M8PA 4RZRA 3Q8RB 1IUJA 4L3NA 4QIWD 4CYUA 2OELA 1DZ5A 2RVJA 4HH1A 3QGIA 4J9PA 1U48A 4DQQA 3U1MA 4PXEA 1HI8A 3W3SA 1TUWA 2GMJA 3RU0A 4BWJA 1M90T 1KQSR 2LXFA 1DQ9A 2VFTA 1NO8A 4JI1J 2WSFC 1HNXJ 1QE1A 2R8JA 2MQOA 4ED5A 3ETMA 4LR7A 4PXBA 1F2HA 5L1LA 1KR4A 2YWKA 3BN4A 2HWTA 2IBKA 4LFBJ 3KLIB 1AZSA 3FBCA 1L5UA 1NKEA 1T9YA 2B3TB 3EZ5A 4D3HA 5DGAA 1SV5B 3QGHA 5L9XA 3MCSA 2FD2A 3I6PA 2PO4A 2IFXA 3JSBA 5B09A 2YKNB 3FBBA 2WVFA 4WZQA 4EO6A 2NYIA 1X9MA 4LF6F 2DXFA 5IV3A 1B7FA 1CQNA 4W92B 3ILJA 4WXWA 4IUFA 4O23A 3KMSA 2WW4A 3MECB 2ASYA 3KJQB 2KM8C 2V8VA 1IR1A 1T02A 1LW0A 2E7VA 4HI2A 1DY3A 4WYWA 5KFBA 1NK6A 3JSRA 1LEOA 4WKRA 2BBEA 3I0SB 5H9EK 2HQGA 2DH9A 1Y11A 2VA3A 2ILYA 2ZVIA 1M5OC 1DRZA 1IBMJ 1LWFA 1VYAA 4OYBA 2KFYA 2ZBRA 4FNHA 5B0FA 2VU5A 3MR7A 3LWLA 2R2SA 1WEXA 5AE2A 3GJRB 1N33F 3FCHA 2Z56B 1UA0A 2H1YA 1U26A 4CLKA 2DCUB 3VAGA 5A8KB 2UVWA 4ZIVA 1TK5A 2XQCA 3J7A1 3D5MA 4JI6F 3PX6A 2CQPA 2MQQA 2HHHF 4IH6A 1MU2A 1NJIT 5L8RC 1NDLA 2L3MA 2QEXS 3FEYB 2LA6A 4ID5A 1X4EA 3BM7A 3AY0A 5ETVA 1JNRB 2QT7A 5I3UA 3OFFA 2BM0A 4Y2MA 1HQ2A 4J90A 3SXLA 5H9EJ 4OX9J 1RTJA 2WBMA 3NGSA 2DBBA 1N0VC 3HHLC 4DPWA 1HPZA 2HFNA 2QSWA 5C25B 1L3UA 4A48A 5DQHA 3ENAA 4XO0A 2DH8A 3NGDA 4OLPA 4NEYA 1IKYB 3DXBA 2C42A 4TQRA 3OR2A 3UW1A 1X4BA 1VBYA 1S9FA 4LF8F 4JI8F 3PNIA 4CTAA 2H4WB 3QFHA 3MM8A 4ED3A 1S0NA 2RJZA 2N82B 5B0CA 5DDRC 1RHKB 1RTZA 4ETZA 1R0CB 5DQIA 3OT9A 4MT1A 3AOAA 2HNZA 1UTAA 5KOXA 1NHUA 4RO0A 2FJEB 2YTCA 3J7Z5 3VGSA 3ONQA 3N0VA 1X0FA 2PMZD 2EFOA 3W2WB 3RG6A 3C14B 4TYAA 1RU1A 5DS7A 1LWCA 3EYZA 5D8HB 2MEWA 3HHDA 5KFWA 3WX8A 1C0TA 2E5LJ 1Q82T 1CJKB 1ACMB 1QSLA 4IO1A 2HBYB 3W1YC 1YJNS 4ANEA 1RT2A 8AT1B 4JI3J 1KDNA 1HQUB 1NPKA 3J80U 2R8GA 3RRGA 4J9UE 3KNGA 4IOBA 5KFXA 3OVSA 2YKNA 2E1MC 3CJSA 3HMJG 3VAHA 2MSTA 4DEZA 3U7JA 1YDLA 5DG8A 3EGNA 3A3OB 2MZJA 2YNFB 4NXMF 1T9XA 1H98A 2AF6A 3N01A 2PEHA 4N8OA 2VFVA 3BGOP 2HAIA 3V4IA 5GAEU 1QAXA 3M2VA 2QMXA 4Y34A 4JOUA 3IR6B 3N4WA 4I4BA 5CH7B 4RUHA 3F41A 3T1AA 4DL6A 4KJIA 3N6NA 1CVJA 3R5BA 2VG7B 3RRKA 2JLEA 1WC5A 1N36F 4ZP7A 4ECUA 3IA0A 2R42A 4WFXA 2YPZA 1MWQA 2ZBPA 4G1IA 3SDEA 2XEXA 1RT6B 2ZOFA 4GKJJ 2J6TA 3VGVA 3FEXB 2JZ5A 4GKKF 4X64J 4HACA 3KLEB 1U2RA 4YEAA 4Q8FA 2FJAB 3WC2A 1PSDA 2F5GA 3E51A 2PA8D 3HFZB 3TR5A 4WFYA 4IH7A 3CGIA 5L39A 2R7OA 3KK2B 2XM3A 3I4PA 3T5LA 4MFBB 1JLFA 4M5NA 3ZTRA 4B08A 1EHWA 2QIFA 1VQ5S 2CPJA 3DGPA 4Z7CA 1FRMA 1TVRA 4LVOP 4K8RA 1SC6A 3KWMA 3TNVA 2FHKA 1Z4UA 3R5CA 3D3BJ 1L3KA 2RHSB 2CAJA 4ZVHA 1VQNS 4R8UB 4FF1A 1VBKA 1BUXA 2FIUA 3CEDA 3NWRA 2H5EA 4L75A 2VQFF 5L1KA 3ITHB 2W8KA 4UY85 3MF5A 1R0AB 3BDEA 5CYMB 5AT1B 4IRDA 1ZOTA 4Q45A 3K5NA 2IRUA 4AXIA 2C2NA 4XPEA 3D1QA 3GR1A 3C16A 2H5IB 1TL3B 3FCVA 1PJ7A 1EIYB 1SIWB 2CRLA 1UFWA 2CWKA 3MEEB 2ABYA 1IWGA 4DSFA 3C6UB 1WEYA 1SPBP 3BSOA 2HAFA 4WFAQ 1AUSL 1F5BA 4DL0C 5KFGA 3HKZD 4B3RJ 4LRAA 2H51B 4D3GA 3GJTB 1VQ7S 2KFNA 3MAQA 1LWXA 1GQEA 2XNRA 1NSKL 4I6WA 3OTBA 1T03B 1KOOA 2CYYA 3JSMB 3FFIB 2V68A 1H0HB 3GFHA 3T19A 4UW2A 5KG4A 1VRTB 4NRUA 1Q1KA 1VOMA 1YZ7A 1LK5A 1K0TA 4DOZA 1X5OA 4PG5A 3H2VE 1WNEA 3EPGA 5KT6A 4V19J 3K59A 2QX0A 2NR0A 3IAM9 2JEGA 3HHLB 1OY8A 4C4WA 1FRIA 3GFYA 1WKLA 3MURP 4K5SA 2HGNA 5J1NA 2MKJA 4CH0S 5GADU 3PJ9A 1RWOB 1X5TA 4DR1J 2ZBCA 5J1EB 1B0VA 3DLHA 3NGUA 2IC3B 2HK3A 2N3LA 2QFIA 3CWJA 1U1KA 2VG6B 3N5FA 4O3NA 2VDHA 1YWXA 1AA1B 4LF9J 4AYBD 3GTYX 3M1VA 3VAFA 1R0BG 3A1YG 3AH6A 2KL8A 3ZZTA 3RRHA 1VS3A 4QR2A 1FFGB 2G1HA 1E6YA 3HSZA 2DCLA 5A8WB 4NRTA 2HWIA 2WAQD 3M8YA 5D78A 4N76A 4L6V3 1IBLJ 2YWHA 5G4DA 3H5UA 3BZQA 1REGX 2D9OA 2YH0A 5GAHU 2L9NA 5RUBA 2AIRB 2F40A 2ZZNA 1S1WB 2H9ZA 5L1IA 4LREA 1FRJA 2J8SA 1EQMA 1TV6B 4IRCA 2G0IA 2CQ0A 4NLXA 2B8QA 3M6VA 1T3NA 2DR7A 4K4VA 4DHVA 3OV7A 1S1UB 2J0SD 4FYYB 3WHIA 2HLTA 2XGQA 2JOQA 1WG5A 2EG2A 4YOEA 5KFCA 3UN5A 1SCJB 2CQ4A 1UZHA 5K14A 2B43A 2F9DA 5KAKA 1IWAA 3CJ4A 2O67A 3MPUB 3NOGA 3PYEA 3M32A 3QIDA 2HQDA 3LPYA 1XMOJ 1P9YA 1IJEB 1Q16B 2DR6A 2CDRB 1HQEB 3PRBA 2DHHA 3ITHA 3X3UA 9RUBA 4KBIA 2OJ3A 2COLA 4K4XA 1LQ9A 4BBYA 3A12A 4NXNJ 1YQHA 4YUDA 2PIIA 3NEKA 2ZWPA 2J76E 5T41A 3OSPA 4FVCA 4UTGA 3ETOA 4O4GA 3MMCB 1JK9B 2J0WA 1JWWA 4J7CA 3OUYA 1RT7B 4LF7J 2ZH5A 5KFHA 2PDAA 2XHWA 3L4BC 2Y3YA 3Q86A 1H6KX 2FQQB 1SL0A 4DV5J 3RGIA 4PWUA 4HDHA 1KC8T 4A8WA 2P2CB 4FS2A 2ZVSA 2ZHAA 3DKDA 5K9FA 6FD1A 3PHTA 2DVIA 2LQJA 1RYSA 2AEJA 4ECXA 4LSNB 4DV6J 5LSOA 2ZITA 3QJJA 1XMQF 4JBCA 2CNLB 3H4BA 4EMDA 2KDOA 3ZC4A 3KLHA 1UA1A 4KV8B 3BSAA 1JLBB 1RTDA 2QE5A 2Y8YA 1HBOA 4L74A 1WWHA 4ZPDA 1OY9A 3UDEA 3NNCA 4OI6A 3OXGA 3M8QB 3LO3A 3ZZOA 5KFIA 4PXDA 3RTVA 1PC4A 2AMCB 3GYNA 3RYLA 2AJ2A 4OIXA 1T95A 2VJVA 1MWYA 2KFZA 3KUEA 1N5SA 1TKTA 3TUZC 4I6AA 1RTHA 4PZVA 4FKYA 1R31A 2WVBA 3PY8A 2K1RA 2MPUA 2YY3A 3UNGC 4HL9A 3JAMY 5BYSA 5HI7A 1FDAA 3BGFA 4NYZA 4Y28C 4CLSA 2E5GA 2VL1A 1DAXA 5GAGU 3QBCA 4XK8C 2Y1IA 2C2RA 2OPRA 3OHAA 5A6PA 1CG2A 1S59A 1W2BR 4LMZA 4P6QA 3IR7B 4WIQA 4CRJA 4MKAA 1RAOA 4A8XA 4I6YA 1JJ2R 2I8EA 1RLCL 4AQYF 4IFVA 4TQSA 1TV6A 3W5XA 2NSCA 5B7WA 3ZTOA 2HHWA 1TUGB 4G1PA 5HROB 1S48A 2CZ9A 5F8LA 2E9TA 4ED7A 4FS1A 1IKWA 2OPQB 1U24A 2WVEA 5F8IA 2CNOB 1YJRA 2WOMB 2FGCA 4K59A 2HWHA 1Y3JA 2M7SA 2GNKA 1T3OA 4CNYA 3GONA 2F8EX 4F25A 2EFPA 2ROEA 3W5ZA 2D3UA 3QO9B 3H8YA 4YQWA 4DU7A 2XB2D 2HMIB 1HBMA 1GMVA 1BHNA 4ZCKA 4X4NA 2DHGA 5K8MA 4AE5A 2LP4A 3M6UA 3IM9A 3THPA 2IYIA 3IO1A 3PEHA 4CNZA 2MXYA 2R7UA 1FTRA 2HNYB 4KGXB 3C66A 1GK8A 3BREA 3MMCA 2N7CA 4FXVA 4DL3A 1QVFR 3DI6A 5IOLA 2BM1A 4DS5A 2ACYA 4OHZA 4DPOA 1SIZA 4GVBA 2GQCA 2BJ8A 2ZH4A 1VC6A 2XWYA 2DXEA 1M1HA 1IBKJ 2IRYA 3J7ZT 1FHTA 2FLPA 2FLLA 5J2PB 2YKPA 1SJ4P 1KP6A 1RT3A 3OXLA 2KG1A 3G4SS 4YDDB 1S0MA 4NL5A 4DR7F 1Y00A 4YB7A 3NGKA 2GV1A 2H54B 2JC0A 3D0HE 2JLGA 2D3ZA 3HZGA 4ED6A 2F4VF 1KONA 4P73A 2RDIA 4LF6J 3V81B 2VOOA 2WB4A 1TP7A 1ZPVA 2IM3A 3RB6A 3BDPA 2R2UA 3HHLD 3TARA 1S0VA 2LECA 3DRSB 3NS7B 4IRKA 1YG0A 4Y2CA 1X9SA 4ES3A 5EGYA 2G0CA 1TK0A 4CLPA 3KJFB 2HHSA 4FXWA 4OI1A 1KHVA 2ACMA 4RUBA 1CEZA 4NPOA 1FKOA 2NXJA 3UE2A 1KRPA 5M2RA 7FDRA 2O3DA 2R8KA 2OPSB 1H73A 1RWKB 1U02A 4OHYA 2XYHB 2VPXB 3CCTA 2NYHA 5HAOA 2G4BA 3W61A 4CLWA 4WK1A 4YR2A 1N33J 3BB5A 1Z2ZA 1BQXA 1TR0A 2FJBB 2QA1A 2QL7B 2XYPB 4Y0FA 1HR0F 2VFRA 2XS7A 3GCXP 2FVPA 1V3SA 4ED4A 4B3SF 5KFKA 3K89A 2YKMB 5DETA 1GXLA 1TL7A 4JI6J 2MSSA 1KTVA 2FLOA 2E1PA 2VHGA 2KVQE 3QRPA 1FKPB 2HHHJ 4U7UK 4OX7A 5KFPA 1NLKL 1S1VB 2BZ2A 4LF5J 1M5KC 3TRGA 4OYAA 3EMTA 3W7BA 3HJVA 4TNOA 1SL2A 3UO0A 3KK3B 3N9UC 4FDFA 2GW8A 1S6PB 2EPIA 1HBUB 5ETSA 3N79A 2OHDA 5IT9Y 3N6MA 4R5PA 3BO2A 4A8QA 3SCIE 1RHUB 4W90B 3PO5A 1KQGB 5E33A 2QLXA 3ENQA 1RGVA 3K2YA 4Q2MA 3GSDA 2BJEA 5AXMA 4DX5A 4MKYA 4DSKA 1KOHA 4GVLA 4NLYA 2PN6A 4LF8J 4JI8J 4Q8EA 3GYGA 3R3TA 1YKWA 2XY6A 5IT4A 4RPFA 2V8HA 4UY8T 5DZ6A 2B4UA 2JDJA 5C2GA 2XC9A 3CCMS 3FQKA 5C5JA 2KRBA 3Q22A 3PIPQ 3KNAA 1FCAA 3W9HA 5ETRA 4CWBA 1TQLA 1LOUA 3M2RA 3PYFA 1JKHA 4HI1A 4WBFA 2W4CA 1B0TA 2CFXA 1QUVA 3L7PA 3R7NB 4NX9A 4KR0B 4LQ3A 2KT2A 4OHXA 1N48A 4MJKA 3CULA 3K5MA 5HMXA 4KTQA 2BRKA 1OS5A 4USKA 3DOKA 4KQZA 5LMNF 4OV1A 4JYAF 4EU0A 2C3MA 1U2CA 4PQAA 1BC6A 4TVAB 4UQTA 1RWWB 2AX0A 3RBXA 1WKKA 1ZPWX 4NXMJ 1TKZA 3DDIA 1FEHA 3HSGA 1LXNA 2BE2A 1P1TA 1TKXA 1HARA 1GMWD 4DQRA 4FBUA 3L3CA 3FZBA 3TW0A 2BXJA 3VQSA 1AXQA 3H5XA 4ZN1A 1XNQF 2NPIA 2MQPA 2DH7A 1NH8A 2VC1A 3CPWR 5BR8F 1IBCB 3R2DJ 1S77D 4BHQA 1N36J 3WBZA 2GFFA 4DL5A 4C8OA 3QAEA 4P74A 5FIIA 2XMTA 3WDOA 4K0KF 2CZ4A 3T6JA 3VHQA 5F41A 3JS9A 2UV8G 4B3TJ 2C3UA 3EUNA 2XMAA 4P7TA 4JV0A 3QZ8A 2M0GB 4QIGA 3HVWA 1VIOA 4C8NA 4M5HA 1W26A 3AXKA 1ZM2A 4HT7A 1T05B 1MN7A 4C0BA 1WHYA 2HGLA 3OHBA 3DC2A 4UOFA 2WW8A 1VR6A 2D3OR 2VD3A 1U0SA 1TKDA 3SCJE 1TMJA 1HNIB 3FQLA 3K8VA 4E2FB 4CDIA 3MM9B 2NXEA 4ZPVR 3SBMA 1JJ4A 3IP0A 4ZKAA 2DXDA 3MMJA 4HT5A 5CA5A 1UVJA 4RNMA 5FJ4A 4ILRA 1QM9A 2E5HA 1FESA 1I6JA 4JI7F 2MQMA 3RB0A 5B0BA 5JXSA 3RBZA 3TJ9A 3CXCR 3KG0A 1S6PA 1X7VA 2CKWA 2O66A 5E0OA 5E41A 2C3OA 4C2MA 5D0EA 2OI2A 1C1BA 4HHUA 3GZ7A 2VQFJ 4F0MA 4LFCF 2I2YA 2NZ4A 1YJ7A 2RS2A 2XO7A 3FRZA 3TUIC 3CVKA 4DG1B 3NAIA 4ZPAA 3TAQA 3MEGA 2FGOA 1N5QA 4ZIWA 4NZ7A 1HWIA 1PG5B 1GFWB 2OGUA 3KDOA 1FD2A 1HWKA 1XNRF 2JWNA 4RR5A 3VF0B 2R4FA 4URQU 3TQEA 3QSYB 5EN1A 5KFMA 2XMUA 4F04B 3G71S 1RA7A 3E2EA 2XNQA 2ZH6A 1JLGB 2GMLA 3UVJB 1OPZA 2FHOB 2XULA 1RKIA 4K4TA 4NLQA 4MH8A 1U6ZA 3JAMU 3W66A 2RKIA 2V69A 3NS5A 4ZVTB 3M9OB 1L3TA 4OX6A 2VB6A 2VIHA 2PA3A 2AX1A 3KLGB 4B02A 4ELUA 1SVDA 4DV2F 4IDKA 3AFGA 4WCEQ 2PGCA 5E2QA 4P7VA 3D1OA 4UUWA 1PBAA 1UZDA 2JH3A 4DQSA 5H1SV 4M5KA 2WHOA 3MPWA 1AT1B 4KH1B 2HHTA 4LSLA 1SUQB 4CCHA 5HP1B 4FYDA 3PEJA 4DR4J 5T14A 2MZSA 2P5VA 1VC5A 4UZCA 2QC3A 4MYTA 3Q8UA 1IBMF 3L95X 4H54A 1ZM4A 2RF2A 1NHKL 4NZ6A 3SV3A 3O8WA 3G2XA 4Y2KA 1FXDA 1NZAA 2VASA 3W65A 2G13A 4YS2A 1K1SA 4A46A 3NCRA 3HZEA 1PBUA 4OI4A 3I5CA 3CF5Q 3H98A 3G82A 4F0HA 4I2PB 2UVUA 3AOBA 2IAJA 3PIOQ 4OI0A 4DX8H 4FN5A 1Y5IB 3DDKA 4UF4A 1U1NA 2A0FB 3FGVA 2PFDA 3LANA 2RQ4A 4C3KA 4RLEA 1X60A 2UXDJ 1EAYC 4DR6J 4QIEA 3O5TB 2GJ2A 1HMVA 4RW8A 1RLDA 1QUPA 1GNKA 1Q4RA 3KK1A 4B9SA 4ZP9A 3RR8A 5DJBA 2ZZTA 3KUHA 5J2NA 1CJTA 1RZMA 1ZA1B 4JUZA 3IG1A 3QAUA 4IG3B 2IVYA 2AZ1A 4ILLA 4XAKA 4KGKA 3OR1B 4KAIA 4ZHRA 3GCWP 4IG0A 1N56A 3Q23A 4DL2A 1K73T 2GGPA 2A18A 4M94A 3M2UA 4I56A 3DLEA 5LXYA 4EBCA 5M2UA 3CC2S 4I69A 2XGPA 3CD5A 2MMYA 3ET6A 2V4RA 1ITPA 3MPDA 4J9RA 4FYWB 3P3DA 1O51A 3TJ8A 4OI3A 5J2QA 1I51B 1R43A 1URRA 2HZCA 3FC9A 4CLTA 2DHXA 1SL1A 1N0UA 4HYKA 3MCNA 1K44A 3KHHA 3QFWA 3I4HX 2NSBA 3V6KA 1YIJS 5C24B 2G2YA 2XMKA 4BC7A 2AZ3A 2UVRA 3FSIA 3TUPA 2E7XA 2UP1A 1KLMA 2BMBA 4J91A 4ZMMA 2F65A 3PR4A 3V4MA 2XMWA 4DQIA 2WCXA 1I5OB 1Q5VA 2E5LF 3FKBA 1U0HA 1CPZA 4I2QB 4X4SA 4P9SA 2CPFA 3OTCA 1YBTA 3GIRA 2BV3A 3C6TB 2DRBA 4JI3F 2WSEC 4BS2A 2MY8A 3JTOA 1NAQA 4WE1B 4IYQA 2LDIA 4LRDA 4ECYA 2KJVA 4PXCA 2J7KA 5GMEA 4ZS6A 3H2LA 2A6OA 3HT0A 4YMEA 2HEKA 1XMQJ 5L38A 4FP9A 4M95A 3CJ3A 4R25A 1FFWB 2C3PA 2VH7A 3KHLA 4NA2A 2OO4A 3QLHB 2RT3A 4RU9A 4ZPCA 2MLZA 5EDWA 5LJ3Y 2RRAA 1IN0A 4P72A 3MAHA 2CQ1A 2OD4A 4IH5A 1JNZB 1YX2A 3LGHA 4G3IA 4FYVB 1N5TA 4LRCA 3F0NA 2Z30B 3KG4A 1S1TA 3MMBB 5HP1A 3SQGA 1BWEA 1NDKA 2DGSA 3AXMA 2LVWA 4NLUA 3LOUA 2YXLA 3PRDA 3OJUA 1X5SA 3NL0A 1I94J 4IOCQ 2FVRA 1D9DA 4KHMA 1NJXA 1BXNA 5ITHA 4GO7X 4DX7A 5IT9U 1QSSA 4J9MA 2Z2MA 4X64F 4XDCA 4B9TA 3BH7B 4NLDA 2XY5A 4UOCA 4X4TA 4RW6A 3CJTA 1OIAA 5HBMB 1D9AA 1VRUA 1JLAB 3G6ES 4PQUA 4PABA 4ERDA 1CS4B 1IXKA 4URGA 1RSCA 4EGLA 4PYAA 3KLFB 2JLFA 2V94A 3K5LA 3HSDA 2CXEA 4QYRA 3I55S 4EI2A 4Q7AA 3E8OA 4AQYJ 2KJWA 3CDWA 2EBEA 2BANA 2CNNB 2RAQA 1SXLA 4H4OB 2B6AA 1B7YB 3D7SB 1LW2B 4MTPA 3R7SB 1F9FA 2V4JA 2Z4PA 4OFZA 3DU5A 3OLAA 3AJ2A 4KRWA 1XR6A 2QYCA 2EK1A 4JI4J 3EE3A 3MEDA 3CMQA 2DGQA 3UD5A 1S9EB 4H4KA 2I5JB 4KFBA 1S9GB 3BR9A 3DN9A 4ECRA 3DCAA 4PYDA 4KYZA 1UPPA 3IWNC 4NCGA 4DR3F 4CZCA 1N88A 2AJ4A 2WB1D 1PCAA 2UZAA 2V67A 2YWGA 3AD7C 2AYGA 4UT4A 4QJVA 2DR9A 2H5JB 2KXNB 1Y10A 3Q8PB 1KVKA 1GT8A 4NYOA 4FBTA 1RWMB 3IRWP 4B3RF 1H74A 4DLGA 2B51A 4NMXA 4X62F 1SQGA 2MGZB 3VV2B 4M5MA 2PMHA 5K20B 3OVAA 3FSYA 5JUMA 4BWMA 4TLQA 1MN9A 4KO0B 5EUHA 2IJRA 4KKOA 4B3MF 1DBDA 1X9WA 2ZUAA 1SKWA 2ROPA 2DR8A 1IM4A 2B9XA 4EYIB 3QJPA 1CJVB 4M5DA 3C15B 3DLKA 1HHSA 1GXTA 4DFJA 3UPFA 4WYLA 4F4WA 2XLJA 1RABB 1RT5B 2AGOA 2VODA 4DR7J 1REVB 4B3OB 4X4PA 2M70A 1PO6A 3CJQA 2W2MP 2F4VJ 2DNLA 1FVQA 1YHQS 2AGQA 3TP2A 2UVVA 2AHOB 4CO4A 5F8NA 1JLEA 1PYTA 3DOLA 1DTQB 1ZBTA 3CCUS 3D54A 3RBEA 5E5NA 1BQNB 1HKAA 1PJ6A 4V1Ak 4UOGA 1S1XB 3VZIA 3GIIA 3A8IA 2YNIB 4OYZA 4PPZA 2AD9A 1D1UA 5HMYA 1J5OB 2IVMA 2FC8A 1HWLA 1J2VA 3MDFA 3TZWA 2BABA 1K47A 3NS6A 2M8HA 1WF0A 3IRXB 3PW4A 4XPCA 1WG4A 3N5BA 3DRPB 4KHPF 2HVEA 3CJKB 3F73A 2W1BA 2BOPA 4RW9B 3PHEA 1B4SA 3MWBA 1O8BA 4KPYA 5HL7Q 5D4NA 3IGVA 2HBRB 1T9TA 4NLGA 3BGUA 3J81Y 2MKIA 1UAWA 3CJ5A 2WONA 2GVZA 3P96A 2C22A 1WC4A 4P10A 5KFOA 4B3SJ 3UDVA 2YWWA 4DSIA 2KYZA 3VAIA 4C48A 4RNOA 3HFVA 4C11A 2HQIA 3CNQP 3LGNA 5F0WA 2ERRA 3MR2A 3TZXA 1WHXA 4ZJOA 4XTTA 4OYIA 5KG7A 4DFKA 3LQVA 2HHXA 2PE8A 3BJYA 4NCBA 4DZ6A 3MAAA 4N8NA 5HLFA 4Y6IA 4DV4F 4EZ9A 4KH0B 3Q24A 1LW2A 5ETTA 4PWDB 2BX6A 5LJ5Y 1P9QC 2ROGA 4MIBA 3WIVA 2W9CA 1RTIA 5DG9A 4O44B 3OL9A 2I5JA 2G2ZA 2QG9B 4J9LA 3T1YF 2L9DA 3TUJC 1VBZA 3JQMA 1ZZNA 2FPHX 4L72B 1R3NA 1ZM9A 5KT2A 4DZDA 2YQ0A 4WPAA 1S5ZA 4K4YA 3JTNA 4E98A 4ZCLA 3I56S 3J7YI 2MGZA 1KNZA 2XBPA 5I3PA 2BKOA 3W8PA 3ISNC 5DGBA 3B6BA 2ZH7A 1WACA 4YP3A 3J81j 3BBCA 3WX4A 2YX1A 1CULB 2CPDA 2D1CA 4U9RA 3Q89A 4DV6F 5I42A 1WORA 2F4FA 4DPXA 1UFLA 2OEMA 4ZITA 3MGJA 5KOWA 1HBNB 3MM5B 5MLCV 2M2BA 5A0YB 3P45B 1NB7A 2P6SA 5CYQB 2UUBF 2E1RA 1KEKA 1W25A 2Q43A 4NLSA 1JJHA 2ZKTA 4USTA 5LMNJ 4JYAJ 1YGYA 2UUWA 2RRBA 4DSJA 5KT3A 3WQPA 2YBVA 4QWAA 3UN3A 2XLKA 2DNGA 3GWCA 5E3AA 2OEKA 3PXGa 2VPZB 1NMEB 2IY5B 5IXUA 4WP9A 2OD6A 5AXNA 1R8BA 2CPYA 3R1HA 4FNIA 2G2OA 1OSCA 2IYGA 4LR9A 4X65F 1FVSA 2CJQA 1XNQJ 5DRKA 1KQKA 4M5LA 4RW7A 2P9CA 1DQ8A 5ETOA 1OSDA 2X51A 5BR8J 2ZD1A 3D3CJ 5AE3A 2GAHC 4ZVRB 1QD1A 2CQ3A 2MQLA 4ZVPB 3P6YC 4IR9A 1QAYA 4K0KJ 1WF2A 4LFAF 3MM7B 2ADBA 3P5BP 2AEMA 3THVA 1TL1A 2NXUA 1NPPA 2IJNA 2V8GA 2W7PA 1SKSA 4ICLA 3CCES 2EFVA 4OZ1A 1ZS6A 2VPYB 1UP1A 4X66J 2XSJB 1ULRA 3BGRA 4DLEA 1FDNA 3DM2B 1U2FA 1DFDA 5D77A 3NMRA 3RW6A 3CJ2A 2KXHA 3RZAA 2GVDA 3DLBA 4P2MA 1EZZB 5CCMA 4A8YA 3VGUA 4PUOB 1RT1B 3NLCA 4JI7J 1LXJA 4OJGA 2ZUGA 3P49B 4TU8A 4F3QA 4CH7A 1C4CA 1DTTB 4N41A 1U6FA 5KG5A 1CJUA 4CIOA 1KBRA 3FCWA 4ANCA 5D3GB 4I67A 4LFCJ 4ES2A 3FUYA 1WEZA 1U47A 4JI2F 1U1MA 2IM0A 3DRRB 3SSSA 2HHPA 1MNEA 4WK3A 1YITS 3PFOA 4QR1A 4I7FA 4F7VA 3CCQS 2ASDA 3LA0A 3B82A 1IBKF 4TN2A 3BQ1A 3C46A 3LP0A 1XNRJ 2BRLA 1AFJA 1XERA 1M1KT 1WF1A 2R7TA 3HKWA 1EKRA 2N4DA 1DLOB 1VQPS 2HVIA 4U96A 1A0OB 2L41A 4MIWA 4DV1F 3DLJA 1YJVA 1BLUA 3PACA 1CSJA 3FJ2A 1U1PA 4Q0BB 1T9UA 1H2TZ 5FLXU 3G8SA 2GIRA 1YZ6A 3DYAB 3I0RB 1WKJA 3T9NA 1LFPA 3BO3A 1UKUA 1HBNA 1UEVA 1Q8KA 2M88A 3PX4A 2NPFA 5CYQA 2GMHA 5L46A 4JI0F 5A8RA 2NXNA 4DV2J 2U1AA 2HFUA 3VAMA 4ID8A 2RU3A 3CW2C 2M5YA 4B17A 5HVHA 4QU7A 2ZKUA 3GR0A 3V5RA 3KOAA 2DNOA 1E6VA 1IR0A 2C3YA 5D4PA 4TKTA 4QIFA 2XCAA 1FT8A 3KXDA 4DI6A 4WFBQ 2K3IA 1FD8A 3AAWB 1H38A 5H9FK 2HFOA 1RAGB 2V4QA 5K8OA 2BVZA 1SJRA 4WIIA 1LWEA 2YQ3A 1PAEX 2X1AA 4QYZK 2A3JA 3KLVA 1IKXB 3BO4A 4QW9A 1Y9OA 2LU1A 5EHHA 2R8HA 1R8PA 5KFUA 2XTJP 3UNYA 2IVFB 4DPYA 4X84A 3Q2TC 1C1CA 3UN2A 2Y8WA 4YR3A 1ZZFA 3MXHP 2Y1LB 3H42A 2BKNA 1VJQA 1C2PA 1JJCB 2APOA 3OTDA 5D15A 2R9LA 3G8QA 2K06A 2V8DA 3SFGA 2DNQA 5J1PA 3QT7A 2VG5A 3CCZA 4LF5F 2YX4A 3BPDA 5T7LA 1NJZA 3Q8QB 1I1GA 1U1RA 2Y0BB 2HGMA 2RB7A 5LT5A 5H9FJ 3CCRS 3ELHA 4I0WA 5L1JA 1D0EA 4QYZJ 1ZM3A 5CZXA 4O0IA 3HT3A 1HNVB 4X4OA 1KWMA 5DM7Q 1NK7A 3KMQA 1N32J 1T7PA 3OQ2A 2KI2A 3BN7A 3AJ1A 4NI2B 1VQ6S 4I64A 4J9NA 3DLGA 3D0GE 2NREA 2VBWA 3PYDA 2HS3A 2DJWA 4CO2A 2JEFA 3V6DB 3DMJB 3M8ZA 1N34F 4ZA1A 2LA4A 3DRRA 3W2VB 2FVQA 1APSA 3K7RA 2M3DA 3PR5B 5BYQA 1HNZF 4PG8A 3BGLA 1WC0A 2AW0A 1O5JA 3TWZA 3FEZA 1U49A 3NXZA 1XBWA 4MKVA 3KTQA 2XI3A 3KLIA 2GIQA 2AJ0A 1RAFB 3B54A 3ZZ0A 1SV5A 5GAEI 3UWTA 4ECZA 4Q0BA 3DYAA 3B4DA 1X4CA 3BYRA 4FKXA 2DEIA 1GEHA 1RA6A 3J81U 5KTQA 3PJXA 1KFSA 3LGMA 2RQCA 3CIZA 4ED8A 3UCGA 3K57A 3MECA 2Z2ZA 1VHFA 2B7CB 4LF2A 2I0XA 1AFIA 3I0SA 2C1EB 2JJ4D 3DOMB 4K7QA 2GQQA 2ZJRQ 3WIUA 2CQBA 6FDRA 3ILIA 2B4PA 3CB4A 4WU2A 3T5JA 1W7WA 3BYPA 4F26A
chains in the Genus database with same CATH topology
1S77D 4BHQA 3WBZA 1C1CB 2GFFA 1RISA 4DL5A 5B0GA 3G8TA 1IQTA 1IKXA 4C8OA 3QAEA 3KJVB 3B8HA 1EETA 3ENWA 2RMLA 2Z2LA 4ECTA 1QLNA 2CVIA 2VUGA 4QQBA 5FIIA 2XMTA 3WDOA 4K0KF 2CZ4A 1IKVA 3CCSS 4QU6A 4ZCIA 3T6JA 4B3TF 3MD3A 1NK9A 4B9UA 2DITA 3NBPA 5IT0A 4PG7A 4HDGA 5F41A 1OQ6A 2UV8G 2C3UA 3EUNA 1XWLA 1Y0HA 1WI8A 2XI2A 4P7TA 3ZZPA 4JV0A 1D8YA 3HM9A 2UUTA 4I2PA 3QZ8A 2RU9A 5FLXY 4ECSA 2M0GB 4QIGA 3HVWA 1PGZA 1SI9A 1SQEA 1XMBA 1VIOA 2W9BB 4C8NA 2FHJD 5IWAF 1FJEB 2J6UA 2EG1A 2KYXA 2CDQA 4NLRA 5KG2A 5A8KA 1ZM2A 4HT7A 1T05B 3IFEA 4C0BA 1UWBB 4EFAC 1HW8A 1WHYA 2HGLA 2VG5B 4QIVA 4DSLA 3M6XA 3OHBA 1BQMB 3DC2A 3TX8A 3AB2B 3M30A 2J0QD 5IM0A 2WW8A 2YX7A 2D3OR 5T7LB 2VD3A 4N5SA 1D3WA 1TKDA 5J2MB 3SCJE 1HNIB 2B5JA 4TLRA 3FQLA 3TANA 3TQ1A 2Q3PA 3K8VA 1G1XA 3MM9B 3HJFA 3LP2A 4OLOA 4CH1A 1P8GA 2ILZA 3OL6A 2XMVA 4ZPVR 1JJ4A 2B0GA 4Q43A 4ZKAA 4GC6A 1S10A 2G9OA 3L7OA 1KVIA 1NJWA 4AL7A 1YI2S 2YNGB 3MMJA 4C8MA 2E29A 4HT5A 4JV1A 4QCLA 5CA5A 4DJBA 1UVJA 3E3XA 3DRXA 4RNMA 4ZVEA 2EFQA 3MMAB 2GHPA 4ZVFA 5KFDA 5FJ4A 1X4AA 2LEAA 4ILRA 4IG3A 1QSYA 4QW8A 1QM9A 3OFHA 2R8IA 2E5HA 1FRXA 4R5PB 1FESA 1I6JA 5C42A 4JI7F 2CPXA 2MQMA 3RB0A 2DRAA 5B08A 5B0BA 5C25A 1YTYA 1T8EA 4FF3A 1TUVA 4OZ0A 5JXSA 1FNXH 3OR1A 3DLLQ 3H40A 3GIMA 4ETXA 2PD1A 5GMKa 3CXCR 3AQOA 1S6PA 1X7VA 3KG0A 2E7WA 4WKYA 1V6HA 3RAQA 2CKWA 1C0UA 2AP6A 4ZPBA 2O66A 5E0OA 1FRLA 5E41A 2C3OA 4C2MA 2GO9A 2JFKA 2KM8B 2FVSA 3DLGB 3GFZA 2KG0A 4DR2F 2ZDPA 1X5PA 1Q7YT 3M8PA 1IKYA 2BYCA 4RZRA 3Q8RB 3G9CA 1C1BA 3JYTB 2D9PA 1IUJA 4B9VA 2W9AA 2L9WA 5I4MA 4L3NA 3GZ7A 4QIWD 2HIQA 4PKDB 1U4BA 1FJGF 4LFCF 4ZLPA 3BEGB 3G6VA 2I2YA 4DSEA 4TY8B 4UUXA 2NZ4A 2W7OA 1DZ5A 2RVJA 1S6QB 2EI5A 4HH1A 2XO7A 3FRZA 1KS2A 3CCLS 3SZ2A 3IS9B 1R7IA 1UJ5A 1GTHA 3QGIA 3FMWA 4J9PA 3TUIC 1U48A 4DQQA 3CVKA 1SBRA 1NNDA 4NOHA 3NAIA 3U1MA 4DG1B 4BDPA 4ZPAA 1Y5NB 4PXEA 3TAQA 2M8DB 1HI8A 3MEGA 3W3SA 2HHVA 4U7CA 2B56A 2FGOA 1DURA 1N5QA 2GMJA 3RU0A 4NZ7A 4BWJA 5JVGQ 1HWIA 1M90T 1KQSR 2LXFA 1DQ9A 3CC4S 2IBOA 2VFTA 1VQMS 5EWFA 1NO8A 2M9KA 2CZVC 1WTFA 2IM2A 5KFQA 2NQPA 3M2RB 1Y3KA 2WSFC 1QE1A 2X1GA 3UD3P 5A6WA 3OXFA 2R8JA 4PPDA 1FD2A 2MQOA 2ZE2B 2EKYA 3TA2A 4ED5A 5C24A 2F9JA 3U1LA 2FB0A 1HWKA 2RS2A 4PXBA 1XNRF 1JLCB 2JWNA 1JKHB 4K4ZA 5L1LA 1KR4A 2R4FA 4URQU 3VF0B 4DBQA 2YWKA 3HHNB 2CJ9A 3BN4A 4G1QB 2HWTA 5EN1A 4NWBA 1SJ3P 2DGWA 3MR3A 2IBKA 5KFMA 3MR6A 3VTIA 2XMUA 3TAMB 3G71S 2AU0A 1YSJA 1S97A 1RA7A 3I32A 3KLIB 1JMTA 1L5UA 1NKEA 2B3TB 2QA2A 3W2WA 3E2EA 2XNQA 3IBWA 4D3HA 3EZ5A 2ZH6A 5DGAA 3BR8A 1JLGB 2GMLA 1SV5B 2QA4G 3QGHA 3MM6B 1OPZA 4I2QA 2FHOB 4IR1A 5L9XA 2Q66A 2XULA 1RKIA 3MCSA 4OJ3A 4F4KA 4K4TA 3TYTA 2FD2A 4NLQA 3LP1B 3EPIA 1QAIA 2VA2A 4ZP8A 1F5CA 5FDLB 4MH8A 1U6ZA 3I6PA 4YB6A 2PO4A 2F8HA 2IFXA 4FF2A 3C6TA 2RKIA 3JSBA 3NS5A 2XCPA 3DOKB 5B09A 4LIWA 2YKNB 3M9OB 1L3TA 4OX6A 3EZUA 2VB6A 3R27A 3BF4A 4WE1A 7FD1A 5KT7A 2PA3A 3GILA 1ZAVA 2AX1A 4WZQA 4EO6A 1X8DA 3KLGB 2HPUA 2HS0A 4B02A 4IFYB 1HQUA 2NYIA 1X9MA 4LF6F 5DDPC 3O44A 1B7FA 2GHWA 1CQNA 3O1LA 4ELUA 4DV2F 4W92B 3QIPB 4IDKA 1NH7A 4WCEQ 2PGCA 4WXWA 1N5YB 4IUFA 1DARA 4O23A 1MMLA 4P7VA 5E2QA 4BC9A 3D1OA 4UUWA 3GIKA 5E3RA 3KMSA 2KTQA 1X0PA 3QGPA 1R6YA 2PI5A 1TKZB 1EP4B 3POTB 3MECB 2ASYA 2YNHB 2BE2B 2JH3A 2KM8C 2V8VA 2JFDA 3CDEA 5H1SV 4RUAA 4DQSA 2WHOA 1ZH5A 3MPWA 3EX7B 1T02A 1ZYQA 2HHTA 4LSLA 1TKXB 1SUQB 4CCHA 1LW0A 3QLHA 4HI2A 2YH1A 2YNFA 4QWCA 4XDDA 4WYWA 5KFBA 1NK6A 3JSRA 4DR4F 4WKRA 1PC5A 5HP1B 2BBEA 4FYDA 2EC0A 4DN9A 3HLUA 3PEJA 2LCWA 1S49A 2RQMA 3I0SB 4LQ9A 4QPXA 5T14A 2MZSA 1UJ4A 5DLGA 2P5VA 1VC5A 4ECWA 5F8GA 2DH9A 4MYTA 1QAJA 2LLZA 5F0UA 5EX3A 5CYJA 2VA3A 1IBMF 2ILYA 3L95X 3CIMA 4H54A 3TA1A 3U1NA 1U6BA 1M5OC 4C8KA 1V3RA 1ZM4A 2RF2A 2HG4A 1DRZA 4NZ6A 2CQIA 2RNEA 3SV3A 1RK8A 3MMBA 3O8WA 4Y2KA 1LWFA 1AROP 1FXDA 1NZAA 2VASA 2G13A 2KFYA 4FNHA 5B0FA 1EETB 1K1SA 4A46A 3NCRA 1WELA 3LWLA 3F56A 2CJAA 2LKZA 2LXIA 5GAHI 1WEXA 3HZEA 1WI6A 1R89A 2VG7A 1IKVB 5AE2A 4DUYF 3NKYA 4C8YA 4OI4A 1N33F 3FCHA 1V3ZA 2FJXA 3NBPB 1UVKA 3TI0A 3I5CA 2GO8A 3CF5Q 2A2CA 3H98A 2AYBA 4U67Q 1UL3A 3OTEA 4I2PB 2UVUA 1UA0A 2OTLS 1X4GA 1TAUA 1U26A 2IAJA 1CC8A 1X4HA 2DCUB 3ZZZA 3VAGA 2ZC4A 1Y4ZB 3PIOQ 4OI0A 4DX8H 4FN5A 5A8KB 4A8MP 1Y5IB 3DDKA 3SV4A 4WFNQ 2UVWA 3FSXA 1TK5A 3IN5A 3J7A1 3D5MA 1RT6A 1RI7A 1SJFA 2O1PA 1U1QA 1U1NA 3M9NB 3FGVA 4JI6F 3SCLE 5IM0B 2K8GA 3LANA 2RQ4A 3PX6A 2UXDF 4DR6F 4M1KA 2EWHA 3M8RA 3GMGA 4C3KA 4RLEA 2B5JB 2W9BA 2CQPA 2MQQA 2HHHF 4IH6A 1MU2A 3O5TB 4QIEA 3KLEA 1NJIT 2GJ2A 5L8RC 1HMVA 2QZ8A 4RW8A 2ZHBA 3PW0A 2L3MA 3HXMA 2QEXS 3LUYA 1QUPA 3FEYB 2CJKA 1GNKA 4F3MA 4AXJA 2LA6A 4ID5A 1Q4RA 2ATLA 1J5EF 2CQHA 5HBMA 3KK1A 4B9SA 1X4EA 3BM7A 3AY0A 1JNRB