4YYHA

Crystal structure of brd9 bromodomain bound to a crotonyllysine peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
102
structure length
102
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.
pubmed doi rcsb
molecule keywords Bromodomain-containing protein 9
molecule tags Protein binding
source organism Homo sapiens
total genus 36
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yyhA00
5I86A 5LKZA 4YC9A 2OUOA 5A5OA 3O36A 5C7NA 4IR3A 4XY9A 5KHMA 4QC3A 5FFYA 5I29A 5CPEA 3G0JA 4QEVA 1X0JA 4OGJA 4TT6A 5CUEA 3D7CA 5FBXA 2FSAA 5HJCA 2RO1A 4PCEA 4HBXA 4O7CA 5HRVA 4A9FA 4CUTA 5LJ1A 5IGKA 4AKNA 5FDZA 5E9IA 3ONIA 3UVDA 3HMHA 2YEKA 4OUFA 2YQDA 5L97A 2RNYA 4HBYA 5BT3A 5D3SA 4HBWA 5EWWA 4CFLA 4PY6A 5EV9A 4O76A 5ENJA 4CUSA 2DKWA 5CQ5A 5HFQA 4QR5A 2R0YA 5ENFA 4ZW1A 5F5ZA 5CU8A 3MB4A 3UV4A 5CZGA 4TS8A 5H1VA 4QR3A 5E9LA 5LUUA 4HXMA 2RFJA 3O33A 4HBVA 4N3WA 5EI4A 4C67A 5J0DA 4O7BA 2YW5A 5CUCA 4N4IA 4KCXA 3MULA 5F3AA 5D0CA 4YY4A 5FH7A 5HQ7A 4HXSA 5DKCA 4A9KA 4KV1A 5CUBA 3U5OA 2DVVA 3UW9A 2OSSA 3JVLA 5FE8A 3MUKA 4YYMA 2DWWA 5I89A 5CY9A 4PS5A 4HXOA 5D25A 2NXBA 5FH8A 3RCWA 5CQ8A 4XY8A 4TTEA 4BW3A 3QZSA 2DATA 5II1A 4A9NA 5DFCA 5ENGA 5DYCA 4O74A 3SVGA 5TB6A 5FE9A 5EWVA 5C89A 4PCIA 4NR4A 3O37A 5LVRA 5EWHA 4Z6HA 4MEOA 3JVKA 2L84A 4N4FA 5K29A 3MB3A 4CFKA 4BW4A 5I7XA 4NYWA 3LQJA 5H85A 5JI8A 5CTLA 3Q2EA 5TCMA 4RVRA 3I3JA 2RNWA 5EPBA 2R0VA 4NR7A 5EISA 3MQMA 4TZ2A 4TT2A 4NQNA 4UIYA 5D3NA 5FFVA 4NR6A 4NRCA 4QY4A 3IU6A 5HLSA 5F36A 5DX4A 5A5NA 2WP2A 4O78A 4A9EA 5IG6A 4QYDA 1EQFA 5L8UA 3LXJA 5D7XA 4PKLA 5HM0A 4CUPA 2R0SA 3AQAA 4BJXA 4O75A 2WP1A 4UYFA 4A9OA 4QSPA 5FE2A 5DLZA 5A5PA 2D82A 3JVMA 4QSXA 5D3HA 5E9MA 2YDWA 2L5EA 5FE6A 4YATA 3LQIA 5D3RA 4NQMA 4KV4A 4NUCA 4NUDA 4Q0OA 5H1UA 5CQ6A 5A7CA 5FE7A 4QEWA 5A5SA 4YYKA 4HXLA 3DWYA 5I40A 4HXNA 5FE0A 5D3JA 5G4RA 3K2JA 5C4QA 5FE3A 3O34A 2DVRA 5I1QA 2MJVB 4O7FA 4LZRA 4XUBA 5I80A 5KTXA 5BT5A 4IR6A 4QSVA 4QSTA 4YABA 5DYUA 5FB1A 5F1LA 2R10A 5ENEA 4J1PA 3AADA 5D3PA 4LDFA 5E74A 5CP5A 4WIVA 5EU1A 3MXFA 5HFRA 4A9HA 5HQ6A 4YYNA 3P1CA 4YYGA 5CRMA 4PTBA 4DONA 4UYGA 1N72A 4QSSA 3G0LA 2GRCA 5C8GA 5FG5A 5CQ3A 4LZ2A 5E73A 5A5RA 2I8NA 3IU5A 4X2IA 3FKMX 5LKUA 4QBMA 5AMFA 4NRBA 2RI7A 3SVHA 5FE5A 4LRGA 4BHWA 3Q2FA 4N4GA 4BW2A 3O35A 4O72A 2YEMA 5DFBA 5IGMA 4NUEA 3LJWA 3GG3A 3UV2A 4NYXA 2G4AA 4QSUA 5A81A 5KTWA 4O7AA 4BW1A 3P1EA 4YAXA 4LYIA 5IGNA 4YBMA 2YELA 5EGUA 5FE4A 3HMFA 1WUMA 4QNSA 5FG4A 3HMEA 5CQ7A 3P5OA 2RS9B 5E9VA 5DKDA 4YH4A 4YYHA 5E9KA 5F2PA 3NXBA 4CUUA 2I7KA 4YBTA 4GPJA 4NR8A 5I88A 4QYLA 5CUGA 5FE1A 5JWMA 4QB3A 5L96A 4LR6A 4ALGA 4QR4A 5E3GA 5EICA 3DAIA 4LYWA 5DW1A 4TZ8A 2RNXA 5DYAA 4TU6A 5EWDA 2N9GA 5AD3A 5CGPA 4LZSA 5EP7A 4UIWA 5A85A 1ZS5A 4QSQA 5EPSA 2F6JA 4YK0A 2YYNA 5E9YA 4Z1QA 4FLPA 5L98A 4QUTA 4CL9A 5LKXA 4HXKA 5CUDA 5II2A 4ALHA 2DVQA 3U5PA 4J0SA 4HXRA 4TYLA 5HRXA 4QZSA 5DFDA 5G4SA 5KU3A 2F6NA 3LQHA 3QZVA 4UYHA 4IOOA 5F63A 3ZYUA 4MENA 5EVAA 5CQTA 4QUUA 5ENIA 2H60A 4O7EA 4UYDA 3U5KA 3S91A 4QSWA 5EPRA 5IIDA 4OGIA 4YADA 3QZTA 4UYEA 4NR5A 5F1HA 4YYDA 4MR5A 4NR9A 4TU4A 4XYAA 5DY7A 5F61A 2E7OA 4YYIA 5ACYA 2KTBB 4IORA 2DVSA 5CUAA 4TQNA 4CURA 4MEQA 4J0RA 1JM4B 4YH3A 4QC1A 4UYFB 4F3IA 5COIA 5F25A 4O70A 4IOQA 4TT4A 5L8TA 5DKHA 4MR4A 4XUAA 5E7DA 4A9IA 4O77A 5CQ4A 5IBNA 5E0RA 5BT4A 4Y03A 5ETDA 3UVYA 5HCLA 4A9LA 5KO4A 5EK9A 1E6IA 4UIZA 3UVXA 4Z1SA 3SVFA 4NRAA 5HELA 4UIXA 4Z93A 5AD2A 5D3TA 5EM3A 5DYXA 4Q0NA 5CS8A 1JSPB 5DW2A 4N4HA 5EA1A 5ENHA 4HXPA 5KTUA 4Z6IA 3U5JA 3U5MA 4WHWA 5D24A 1F68A 4YBSA 4YYJA 5IGLA 3UV5A 4UITA 4CLBA 5C87A 3S92A 5FG6A 5L99A 2LSPB 3UVWA 3P1FA 3JVJA 4UIVA 5ENCA 5FFWA 4QEUA 5CQAA 5D3LA 4YY6A 5HQ5A 2E3KA 4A9JA 5AMEA 4LC2A 3U5LA 4O71A 3TLPA 2OO1A 5DBMA 4IR5A 5FB0A 4MR6A 5EWCA 5C85A 4NS5A 5F62A 4NYVA 2L85A 5F60A 2E7NA 4NXJA 5EQ1A 5HRWA 2D9EA 4CUQA 4J3IA 5A83A 5LKTA 5HEMA 5ETBA 5LVQA 5FH6A 5I7YA 4MEPA 1WUGA 3P1DA 5D26A 4WHUA 4ZQLA 5DLXA 4LYSA 5CRZA 5H1TA 4A9MA 5HENA 4MR3A 5ENBA 5I83A 5LJ2A 5E3DA 4ZC9A 5CFWA 3U5NA 5A82A 4QSRA 4UIUA 4E96A 4C66A 4IR4A 5A5QA 5LJ0A
chains in the Genus database with same CATH superfamily
5I86A 5LKZA 4YC9A 2OUOA 5A5OA 3O36A 5C7NA 4IR3A 4XY9A 5KHMA 4QC3A 5FFYA 5I29A 5CPEA 3G0JA 4QEVA 1X0JA 4OGJA 4TT6A 5CUEA 3D7CA 5FBXA 2FSAA 5HJCA 2RO1A 4PCEA 4HBXA 4O7CA 5HRVA 4A9FA 4AI6A 4CUTA 5LJ1A 5IGKA 4AKNA 5FDZA 5E9IA 3ONIA 3UVDA 3HMHA 2YEKA 4OUFA 3VKGA 2YQDA 5L97A 2RNYA 4HBYA 5BT3A 5D3SA 4HBWA 5EWWA 4CFLA 4PY6A 5EV9A 3ERRA 4O76A 5ENJA 4CUSA 2DKWA 5CQ5A 5HFQA 4QR5A 2R0YA 5ENFA 4ZW1A 5F5ZA 5CU8A 3MB4A 3UV4A 5CZGA 4TS8A 5H1VA 4QR3A 5E9LA 5LUUA 4HXMA 2RFJA 3O33A 4HBVA 4N3WA 5EI4A 4C67A 5J0DA 4O7BA 2YW5A 5CUCA 4N4IA 4KCXA 3MULA 5F3AA 5D0CA 4YY4A 5FH7A 5HQ7A 4HXSA 5DKCA 4A9KA 4KV1A 5CUBA 3U5OA 2DVVA 3UW9A 2OSSA 3JVLA 5FE8A 3MUKA 4YYMA 2DWWA 5I89A 5CY9A 4PS5A 4HXOA 5D25A 2NXBA 5FH8A 3RCWA 5CQ8A 4XY8A 4TTEA 4BW3A 3QZSA 2DATA 5II1A 4A9NA 5DFCA 5ENGA 5DYCA 4O74A 3SVGA 5TB6A 5FE9A 5EWVA 5C89A 4PCIA 4NR4A 3O37A 5LVRA 5EWHA 4Z6HA 4MEOA 3JVKA 2L84A 3VKHA 4N4FA 5K29A 3MB3A 4CFKA 4BW4A 5I7XA 4NYWA 3LQJA 5H85A 5JI8A 5CTLA 3Q2EA 5TCMA 4RVRA 3I3JA 2RNWA 5EPBA 2R0VA 4NR7A 5EISA 3MQMA 4AKHA 4TZ2A 4TT2A 4NQNA 4UIYA 5D3NA 5FFVA 4NR6A 4NRCA 4QY4A 3IU6A 5HLSA 5F36A 5DX4A 5A5NA 2WP2A 4O78A 4A9EA 5IG6A 4QYDA 1EQFA 5L8UA 3LXJA 5D7XA 4PKLA 5HM0A 4CUPA 2R0SA 3AQAA 4BJXA 4O75A 2WP1A 4UYFA 4A9OA 4QSPA 5FE2A 5DLZA 5A5PA 2D82A 3JVMA 4QSXA 5D3HA 5E9MA 2YDWA 2L5EA 5FE6A 4YATA 3LQIA 5D3RA 4NQMA 4KV4A 4NUCA 4NUDA 4Q0OA 5H1UA 5CQ6A 5A7CA 5FE7A 4QEWA 5A5SA 4YYKA 4HXLA 3DWYA 5I40A 4HXNA 5FE0A 5D3JA 5G4RA 3K2JA 5C4QA 5FE3A 3O34A 2DVRA 5I1QA 2MJVB 4O7FA 4LZRA 4XUBA 5I80A 5KTXA 5BT5A 2EJNA 4AKIA 4IR6A 3D1DA 4QSVA 4AKGA 4QSTA 4YABA 5DYUA 5FB1A 5F1LA 2R10A 5ENEA 4J1PA 3AADA 5D3PA 4LDFA 5E74A 5CP5A 4WIVA 5EU1A 3MXFA 5HFRA 4A9HA 5HQ6A 4YYNA 3P1CA 4YYGA 5CRMA 4PTBA 4DONA 4UYGA 1N72A 4QSSA 3G0LA 2GRCA 5C8GA 5FG5A 5CQ3A 4LZ2A 5E73A 5A5RA 2I8NA 3IU5A 4X2IA 3FKMX 5LKUA 4QBMA 5AMFA 4NRBA 2RI7A 3SVHA 5FE5A 4LRGA 4BHWA 3Q2FA 4N4GA 4BW2A 3O35A 4O72A 2YEMA 5DFBA 5IGMA 4NUEA 3LJWA 3GG3A 3UV2A 4NYXA 2G4AA 4QSUA 5A81A 5KTWA 4O7AA 4BW1A 3P1EA 4YAXA 4LYIA 5IGNA 4YBMA 2YELA 5EGUA 5FE4A 3HMFA 1WUMA 4QNSA 5FG4A 3HMEA 5CQ7A 3P5OA 2RS9B 5E9VA 5DKDA 4YH4A 4YYHA 5E9KA 5F2PA 3NXBA 4CUUA 2I7KA 4YBTA 4GPJA 4NR8A 5I88A 4QYLA 5CUGA 5FE1A 5JWMA 4QB3A 5L96A 4LR6A 4ALGA 4QR4A 5E3GA 5EICA 3DAIA 3D1BA 4LYWA 5DW1A 4TZ8A 2RNXA 5DYAA 4TU6A 5EWDA 2N9GA 5AD3A 5CGPA 4LZSA 5EP7A 4UIWA 5A85A 1ZS5A 4QSQA 5EPSA 2F6JA 4YK0A 2YYNA 5E9YA 4Z1QA 4FLPA 5L98A 4QUTA 4CL9A 5LKXA 4HXKA 5CUDA 5II2A 4ALHA 2DVQA 3U5PA 4J0SA 4HXRA 4TYLA 5HRXA 4QZSA 5DFDA 5G4SA 5KU3A 2F6NA 3LQHA 3QZVA 4UYHA 4IOOA 5F63A 3ZYUA 4MENA 5EVAA 5CQTA 1ZKRA 4QUUA 5ENIA 2H60A 4O7EA 4UYDA 3U5KA 3S91A 4QSWA 5EPRA 5IIDA 4OGIA 4YADA 3QZTA 4UYEA 4NR5A 5F1HA 4YYDA 4MR5A 4NR9A 4TU4A 4XYAA 5DY7A 5F61A 2E7OA 4YYIA 5ACYA 2KTBB 4IORA 2DVSA 5CUAA 4TQNA 4CURA 4MEQA 4J0RA 1JM4B 4YH3A 4QC1A 4UYFB 4F3IA 5COIA 5F25A 4O70A 4IOQA 4TT4A 5L8TA 5DKHA 4MR4A 4XUAA 5E7DA 4A9IA 4O77A 5CQ4A 5IBNA 5E0RA 5BT4A 4Y03A 5ETDA 3UVYA 5HCLA 4A9LA 5KO4A 5EK9A 1E6IA 4UIZA 3UVXA 4Z1SA 3SVFA 4NRAA 5HELA 4UIXA 4Z93A 5AD2A 5D3TA 5EM3A 5DYXA 4Q0NA 5CS8A 1JSPB 5DW2A 4N4HA 5EA1A 5ENHA 4HXPA 5KTUA 4Z6IA 3U5JA 3U5MA 4WHWA 5D24A 1F68A 4YBSA 4YYJA 5IGLA 3UV5A 4UITA 4CLBA 5C87A 3S92A 5FG6A 5L99A 2LSPB 3UVWA 3P1FA 3JVJA 4UIVA 5ENCA 5FFWA 4QEUA 5CQAA 5D3LA 4YY6A 5HQ5A 2E3KA 4A9JA 5AMEA 4LC2A 3U5LA 4O71A 3TLPA 2OO1A 5DBMA 4IR5A 5FB0A 4MR6A 5EWCA 5C85A 4NS5A 5F62A 4NYVA 2L85A 5F60A 2E7NA 4NXJA 5EQ1A 5HRWA 2D9EA 4CUQA 4J3IA 5A83A 5LKTA 5HEMA 5ETBA 5LVQA 5FH6A 5I7YA 4MEPA 1WUGA 3P1DA 5D26A 4WHUA 4ZQLA 5DLXA 4LYSA 5CRZA 5H1TA 4A9MA 5HENA 4MR3A 1PUOA 5ENBA 5I83A 5LJ2A 5E3DA 4ZC9A 5CFWA 3U5NA 5A82A 4QSRA 4UIUA 4E96A 4C66A 4IR4A 5A5QA 5LJ0A
chains in the Genus database with same CATH topology
5I86A 5LKZA 4YC9A 2OUOA 5A5OA 3O36A 5C7NA 4IR3A 4XY9A 5KHMA 4QC3A 5FFYA 5I29A 5CPEA 3G0JA 4QEVA 1X0JA 4OGJA 4TT6A 5CUEA 3D7CA 5FBXA 2FSAA 5HJCA 2RO1A 4PCEA 4HBXA 4O7CA 5HRVA 4A9FA 4CUTA 5LJ1A 5IGKA 4AKNA 5FDZA 5E9IA 3ONIA 3UVDA 3HMHA 2YEKA 4OUFA 2YQDA 5L97A 2RNYA 4HBYA 5BT3A 5D3SA 4HBWA 5EWWA 4CFLA 4PY6A 5EV9A 4O76A 5ENJA 4CUSA 2DKWA 5CQ5A 5HFQA 4QR5A 2R0YA 5ENFA 4ZW1A 5F5ZA 5CU8A 3MB4A 3UV4A 5CZGA 4TS8A 5H1VA 4QR3A 5E9LA 5LUUA 4HXMA 2RFJA 3O33A 4HBVA 4N3WA 5EI4A 4C67A 5J0DA 4O7BA 2YW5A 5CUCA 4N4IA 4KCXA 3MULA 5F3AA 5D0CA 4YY4A 5FH7A 5HQ7A 4HXSA 5DKCA 4A9KA 4KV1A 5CUBA 3U5OA 2DVVA 3UW9A 2OSSA 3JVLA 5FE8A 3MUKA 4YYMA 2DWWA 5I89A 5CY9A 4PS5A 4HXOA 5D25A 2NXBA 5FH8A 3RCWA 5CQ8A 4XY8A 4TTEA 4BW3A 3QZSA 2DATA 5II1A 4A9NA 5DFCA 5ENGA 5DYCA 4O74A 3SVGA 5TB6A 5FE9A 5EWVA 5C89A 4PCIA 4NR4A 3O37A 5LVRA 5EWHA 4Z6HA 4MEOA 3JVKA 2L84A 4N4FA 5K29A 3MB3A 4CFKA 4BW4A 5I7XA 4NYWA 3LQJA 5H85A 5JI8A 5CTLA 3Q2EA 5TCMA 4RVRA 3I3JA 2RNWA 5EPBA 2R0VA 4NR7A 5EISA 3MQMA 4TZ2A 4TT2A 4NQNA 4UIYA 5D3NA 5FFVA 4NR6A 4NRCA 4QY4A 3IU6A 5HLSA 5F36A 5DX4A 5A5NA 2WP2A 4O78A 4A9EA 5IG6A 4QYDA 1EQFA 5L8UA 3LXJA 5D7XA 4PKLA 5HM0A 4CUPA 2R0SA 3AQAA 4BJXA 4O75A 2WP1A 4UYFA 4A9OA 4QSPA 5FE2A 5DLZA 5A5PA 2D82A 3JVMA 4QSXA 5D3HA 5E9MA 2YDWA 2L5EA 5FE6A 4YATA 3LQIA 5D3RA 4NQMA 4KV4A 4NUCA 4NUDA 4Q0OA 5H1UA 5CQ6A 5A7CA 5FE7A 4QEWA 5A5SA 4YYKA 4HXLA 3DWYA 5I40A 4HXNA 5FE0A 5D3JA 5G4RA 3K2JA 5C4QA 5FE3A 3O34A 2DVRA 5I1QA 2MJVB 4O7FA 4LZRA 4XUBA 5I80A 5KTXA 5BT5A 4IR6A 4QSVA 4QSTA 4YABA 5DYUA 5FB1A 5F1LA 2R10A 5ENEA 4J1PA 3AADA 5D3PA 4LDFA 5E74A 5CP5A 4WIVA 5EU1A 3MXFA 5HFRA 4A9HA 5HQ6A 4YYNA 3P1CA 4YYGA 5CRMA 4PTBA 4DONA 4UYGA 1N72A 4QSSA 3G0LA 2GRCA 5C8GA 5FG5A 5CQ3A 4LZ2A 5E73A 5A5RA 2I8NA 3IU5A 4X2IA 3FKMX 5LKUA 4QBMA 5AMFA 4NRBA 2RI7A 3SVHA 5FE5A 4LRGA 4BHWA 3Q2FA 4N4GA 4BW2A 3O35A 4O72A 2YEMA 5DFBA 5IGMA 4NUEA 3LJWA 3GG3A 3UV2A 4NYXA 2G4AA 4QSUA 5A81A 5KTWA 4O7AA 4BW1A 3P1EA 4YAXA 4LYIA 5IGNA 4YBMA 2YELA 5EGUA 5FE4A 3HMFA 1WUMA 4QNSA 5FG4A 3HMEA 5CQ7A 3P5OA 2RS9B 5E9VA 5DKDA 4YH4A 4YYHA 5E9KA 5F2PA 3NXBA 4CUUA 2I7KA 4YBTA 4GPJA 4NR8A 5I88A 4QYLA 5CUGA 5FE1A 5JWMA 4QB3A 5L96A 4LR6A 4ALGA 4QR4A 5E3GA 5EICA 3DAIA 4LYWA 5DW1A 4TZ8A 2RNXA 5DYAA 4TU6A 5EWDA 2N9GA 5AD3A 5CGPA 4LZSA 5EP7A 4UIWA 5A85A 1ZS5A 4QSQA 5EPSA 2F6JA 4YK0A 2YYNA 5E9YA 4Z1QA 4FLPA 5L98A 4QUTA 4CL9A 5LKXA 4HXKA 5CUDA 5II2A 4ALHA 2DVQA 3U5PA 4J0SA 4HXRA 4TYLA 5HRXA 4QZSA 5DFDA 5G4SA 5KU3A 2F6NA 3LQHA 3QZVA 4UYHA 4IOOA 5F63A 3ZYUA 4MENA 5EVAA 5CQTA 4QUUA 5ENIA 2H60A 4O7EA 4UYDA 3U5KA 3S91A 4QSWA 5EPRA 5IIDA 4OGIA 4YADA 3QZTA 4UYEA 4NR5A 5F1HA 4YYDA 4MR5A 4NR9A 4TU4A 4XYAA 5DY7A 5F61A 2E7OA 4YYIA 5ACYA 2KTBB 4IORA 2DVSA 5CUAA 4TQNA 4CURA 4MEQA 4J0RA 1JM4B 4YH3A 4QC1A 4UYFB 4F3IA 5COIA 5F25A 4O70A 4IOQA 4TT4A 5L8TA 5DKHA 4MR4A 4XUAA 5E7DA 4A9IA 4O77A 5CQ4A 5IBNA 5E0RA 5BT4A 4Y03A 5ETDA 3UVYA 5HCLA 4A9LA 5KO4A 5EK9A 1E6IA 4UIZA 3UVXA 4Z1SA 3SVFA 4NRAA 5HELA 4UIXA 4Z93A 5AD2A 5D3TA 5EM3A 5DYXA 4Q0NA 5CS8A 1JSPB 5DW2A 4N4HA 5EA1A 5ENHA 4HXPA 5KTUA 4Z6IA 3U5JA 3U5MA 4WHWA 5D24A 1F68A 4YBSA 4YYJA 5IGLA 3UV5A 4UITA 4CLBA 5C87A 3S92A 5FG6A 5L99A 2LSPB 3UVWA 3P1FA 3JVJA 4UIVA 5ENCA 5FFWA 4QEUA 5CQAA 5D3LA 4YY6A 5HQ5A 2E3KA 4A9JA 5AMEA 4LC2A 3U5LA 4O71A 3TLPA 2OO1A 5DBMA 4IR5A 5FB0A 4MR6A 5EWCA 5C85A 4NS5A 5F62A 4NYVA 2L85A 5F60A 2E7NA 4NXJA 5EQ1A 5HRWA 2D9EA 4CUQA 4J3IA 5A83A 5LKTA 5HEMA 5ETBA 5LVQA 5FH6A 5I7YA 4MEPA 1WUGA 3P1DA 5D26A 4WHUA 4ZQLA 5DLXA 4LYSA 5CRZA 5H1TA 4A9MA 5HENA 4MR3A 5ENBA 5I83A 5LJ2A 5E3DA 4ZC9A 5CFWA 3U5NA 5A82A 4QSRA 4UIUA 4E96A 4C66A 4IR4A 5A5QA 5LJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I86 A;  5LKZ A;  4YC9 A;  2OUO A;  5A5O A;  3O36 A;  5C7N A;  4IR3 A;  4XY9 A;  5KHM A;  4QC3 A;  5FFY A;  5I29 A;  5CPE A;  3G0J A;  4QEV A;  1X0J A;  4OGJ A;  4TT6 A;  5CUE A;  3D7C A;  5FBX A;  2FSA A;  5HJC A;  2RO1 A;  4PCE A;  4HBX A;  4O7C A;  5HRV A;  4A9F A;  4CUT A;  5LJ1 A;  5IGK A;  4AKN A;  5FDZ A;  5E9I A;  3ONI A;  3UVD A;  3HMH A;  2YEK A;  4OUF A;  2YQD A;  5L97 A;  2RNY A;  4HBY A;  5BT3 A;  5D3S A;  4HBW A;  5EWW A;  4CFL A;  4PY6 A;  5EV9 A;  4O76 A;  5ENJ A;  4CUS A;  2DKW A;  5CQ5 A;  5HFQ A;  4QR5 A;  2R0Y A;  5ENF A;  4ZW1 A;  5F5Z A;  5CU8 A;  3MB4 A;  3UV4 A;  5CZG A;  4TS8 A;  5H1V A;  4QR3 A;  5E9L A;  5LUU A;  4HXM A;  2RFJ A;  3O33 A;  4HBV A;  4N3W A;  5EI4 A;  4C67 A;  5J0D A;  4O7B A;  2YW5 A;  5CUC A;  4N4I A;  4KCX A;  3MUL A;  5F3A A;  5D0C A;  4YY4 A;  5FH7 A;  5HQ7 A;  4HXS A;  5DKC A;  4A9K A;  4KV1 A;  5CUB A;  3U5O A;  2DVV A;  3UW9 A;  2OSS A;  3JVL A;  5FE8 A;  3MUK A;  4YYM A;  2DWW A;  5I89 A;  5CY9 A;  4PS5 A;  4HXO A;  5D25 A;  2NXB A;  5FH8 A;  3RCW A;  5CQ8 A;  4XY8 A;  4TTE A;  4BW3 A;  3QZS A;  2DAT A;  5II1 A;  4A9N A;  5DFC A;  5ENG A;  5DYC A;  4O74 A;  3SVG A;  5TB6 A;  5FE9 A;  5EWV A;  5C89 A;  4PCI A;  4NR4 A;  3O37 A;  5LVR A;  5EWH A;  4Z6H A;  4MEO A;  3JVK A;  2L84 A;  4N4F A;  5K29 A;  3MB3 A;  4CFK A;  4BW4 A;  5I7X A;  4NYW A;  3LQJ A;  5H85 A;  5JI8 A;  5CTL A;  3Q2E A;  5TCM A;  4RVR A;  3I3J A;  2RNW A;  5EPB A;  2R0V A;  4NR7 A;  5EIS A;  3MQM A;  4TZ2 A;  4TT2 A;  4NQN A;  4UIY A;  5D3N A;  5FFV A;  4NR6 A;  4NRC A;  4QY4 A;  3IU6 A;  5HLS A;  5F36 A;  5DX4 A;  5A5N A;  2WP2 A;  4O78 A;  4A9E A;  5IG6 A;  4QYD A;  1EQF A;  5L8U A;  3LXJ A;  5D7X A;  4PKL A;  5HM0 A;  4CUP A;  2R0S A;  3AQA A;  4BJX A;  4O75 A;  2WP1 A;  4UYF A;  4A9O A;  4QSP A;  5FE2 A;  5DLZ A;  5A5P A;  2D82 A;  3JVM A;  4QSX A;  5D3H A;  5E9M A;  2YDW A;  2L5E A;  5FE6 A;  4YAT A;  3LQI A;  5D3R A;  4NQM A;  4KV4 A;  4NUC A;  4NUD A;  4Q0O A;  5H1U A;  5CQ6 A;  5A7C A;  5FE7 A;  4QEW A;  5A5S A;  4YYK A;  4HXL A;  3DWY A;  5I40 A;  4HXN A;  5FE0 A;  5D3J A;  5G4R A;  3K2J A;  5C4Q A;  5FE3 A;  3O34 A;  2DVR A;  5I1Q A;  2MJV B;  4O7F A;  4LZR A;  4XUB A;  5I80 A;  5KTX A;  5BT5 A;  4IR6 A;  4QSV A;  4QST A;  4YAB A;  5DYU A;  5FB1 A;  5F1L A;  2R10 A;  5ENE A;  4J1P A;  3AAD A;  5D3P A;  4LDF A;  5E74 A;  5CP5 A;  4WIV A;  5EU1 A;  3MXF A;  5HFR A;  4A9H A;  5HQ6 A;  4YYN A;  3P1C A;  4YYG A;  5CRM A;  4PTB A;  4DON A;  4UYG A;  1N72 A;  4QSS A;  3G0L A;  2GRC A;  5C8G A;  5FG5 A;  5CQ3 A;  4LZ2 A;  5E73 A;  5A5R A;  2I8N A;  3IU5 A;  4X2I A;  3FKM X;  5LKU A;  4QBM A;  5AMF A;  4NRB A;  2RI7 A;  3SVH A;  5FE5 A;  4LRG A;  4BHW A;  3Q2F A;  4N4G A;  4BW2 A;  3O35 A;  4O72 A;  2YEM A;  5DFB A;  5IGM A;  4NUE A;  3LJW A;  3GG3 A;  3UV2 A;  4NYX A;  2G4A A;  4QSU A;  5A81 A;  5KTW A;  4O7A A;  4BW1 A;  3P1E A;  4YAX A;  4LYI A;  5IGN A;  4YBM A;  2YEL A;  5EGU A;  5FE4 A;  3HMF A;  1WUM A;  4QNS A;  5FG4 A;  3HME A;  5CQ7 A;  3P5O A;  2RS9 B;  5E9V A;  5DKD A;  4YH4 A;  4YYH A;  5E9K A;  5F2P A;  3NXB A;  4CUU A;  2I7K A;  4YBT A;  4GPJ A;  4NR8 A;  5I88 A;  4QYL A;  5CUG A;  5FE1 A;  5JWM A;  4QB3 A;  5L96 A;  4LR6 A;  4ALG A;  4QR4 A;  5E3G A;  5EIC A;  3DAI A;  4LYW A;  5DW1 A;  4TZ8 A;  2RNX A;  5DYA A;  4TU6 A;  5EWD A;  2N9G A;  5AD3 A;  5CGP A;  4LZS A;  5EP7 A;  4UIW A;  5A85 A;  1ZS5 A;  4QSQ A;  5EPS A;  2F6J A;  4YK0 A;  2YYN A;  5E9Y A;  4Z1Q A;  4FLP A;  5L98 A;  4QUT A;  4CL9 A;  5LKX A;  4HXK A;  5CUD A;  5II2 A;  4ALH A;  2DVQ A;  3U5P A;  4J0S A;  4HXR A;  4TYL A;  5HRX A;  4QZS A;  5DFD A;  5G4S A;  5KU3 A;  2F6N A;  3LQH A;  3QZV A;  4UYH A;  4IOO A;  5F63 A;  3ZYU A;  4MEN A;  5EVA A;  5CQT A;  4QUU A;  5ENI A;  2H60 A;  4O7E A;  4UYD A;  3U5K A;  3S91 A;  4QSW A;  5EPR A;  5IID A;  4OGI A;  4YAD A;  3QZT A;  4UYE A;  4NR5 A;  5F1H A;  4YYD A;  4MR5 A;  4NR9 A;  4TU4 A;  4XYA A;  5DY7 A;  5F61 A;  2E7O A;  4YYI A;  5ACY A;  2KTB B;  4IOR A;  2DVS A;  5CUA A;  4TQN A;  4CUR A;  4MEQ A;  4J0R A;  1JM4 B;  4YH3 A;  4QC1 A;  4UYF B;  4F3I A;  5COI A;  5F25 A;  4O70 A;  4IOQ A;  4TT4 A;  5L8T A;  5DKH A;  4MR4 A;  4XUA A;  5E7D A;  4A9I A;  4O77 A;  5CQ4 A;  5IBN A;  5E0R A;  5BT4 A;  4Y03 A;  5ETD A;  3UVY A;  5HCL A;  4A9L A;  5KO4 A;  5EK9 A;  1E6I A;  4UIZ A;  3UVX A;  4Z1S A;  3SVF A;  4NRA A;  5HEL A;  4UIX A;  4Z93 A;  5AD2 A;  5D3T A;  5EM3 A;  5DYX A;  4Q0N A;  5CS8 A;  1JSP B;  5DW2 A;  4N4H A;  5EA1 A;  5ENH A;  4HXP A;  5KTU A;  4Z6I A;  3U5J A;  3U5M A;  4WHW A;  5D24 A;  1F68 A;  4YBS A;  4YYJ A;  5IGL A;  3UV5 A;  4UIT A;  4CLB A;  5C87 A;  3S92 A;  5FG6 A;  5L99 A;  2LSP B;  3UVW A;  3P1F A;  3JVJ A;  4UIV A;  5ENC A;  5FFW A;  4QEU A;  5CQA A;  5D3L A;  4YY6 A;  5HQ5 A;  2E3K A;  4A9J A;  5AME A;  4LC2 A;  3U5L A;  4O71 A;  3TLP A;  2OO1 A;  5DBM A;  4IR5 A;  5FB0 A;  4MR6 A;  5EWC A;  5C85 A;  4NS5 A;  5F62 A;  4NYV A;  2L85 A;  5F60 A;  2E7N A;  4NXJ A;  5EQ1 A;  5HRW A;  2D9E A;  4CUQ A;  4J3I A;  5A83 A;  5LKT A;  5HEM A;  5ETB A;  5LVQ A;  5FH6 A;  5I7Y A;  4MEP A;  1WUG A;  3P1D A;  5D26 A;  4WHU A;  4ZQL A;  5DLX A;  4LYS A;  5CRZ A;  5H1T A;  4A9M A;  5HEN A;  4MR3 A;  5ENB A;  5I83 A;  5LJ2 A;  5E3D A;  4ZC9 A;  5CFW A;  3U5N A;  5A82 A;  4QSR A;  4UIU A;  4E96 A;  4C66 A;  4IR4 A;  5A5Q A;  5LJ0 A; 
#chains in the Genus database with same CATH topology
 5I86 A;  5LKZ A;  4YC9 A;  2OUO A;  5A5O A;  3O36 A;  5C7N A;  4IR3 A;  4XY9 A;  5KHM A;  4QC3 A;  5FFY A;  5I29 A;  5CPE A;  3G0J A;  4QEV A;  1X0J A;  4OGJ A;  4TT6 A;  5CUE A;  3D7C A;  5FBX A;  2FSA A;  5HJC A;  2RO1 A;  4PCE A;  4HBX A;  4O7C A;  5HRV A;  4A9F A;  4AI6 A;  4CUT A;  5LJ1 A;  5IGK A;  4AKN A;  5FDZ A;  5E9I A;  3ONI A;  3UVD A;  3HMH A;  2YEK A;  4OUF A;  3VKG A;  2YQD A;  5L97 A;  2RNY A;  4HBY A;  5BT3 A;  5D3S A;  4HBW A;  5EWW A;  4CFL A;  4PY6 A;  5EV9 A;  3ERR A;  4O76 A;  5ENJ A;  4CUS A;  2DKW A;  5CQ5 A;  5HFQ A;  4QR5 A;  2R0Y A;  5ENF A;  4ZW1 A;  5F5Z A;  5CU8 A;  3MB4 A;  3UV4 A;  5CZG A;  4TS8 A;  5H1V A;  4QR3 A;  5E9L A;  5LUU A;  4HXM A;  2RFJ A;  3O33 A;  4HBV A;  4N3W A;  5EI4 A;  4C67 A;  5J0D A;  4O7B A;  2YW5 A;  5CUC A;  4N4I A;  4KCX A;  3MUL A;  5F3A A;  5D0C A;  4YY4 A;  5FH7 A;  5HQ7 A;  4HXS A;  5DKC A;  4A9K A;  4KV1 A;  5CUB A;  3U5O A;  2DVV A;  3UW9 A;  2OSS A;  3JVL A;  5FE8 A;  3MUK A;  4YYM A;  2DWW A;  5I89 A;  5CY9 A;  4PS5 A;  4HXO A;  5D25 A;  2NXB A;  5FH8 A;  3RCW A;  5CQ8 A;  4XY8 A;  4TTE A;  4BW3 A;  3QZS A;  2DAT A;  5II1 A;  4A9N A;  5DFC A;  5ENG A;  5DYC A;  4O74 A;  3SVG A;  5TB6 A;  5FE9 A;  5EWV A;  5C89 A;  4PCI A;  4NR4 A;  3O37 A;  5LVR A;  5EWH A;  4Z6H A;  4MEO A;  3JVK A;  2L84 A;  3VKH A;  4N4F A;  5K29 A;  3MB3 A;  4CFK A;  4BW4 A;  5I7X A;  4NYW A;  3LQJ A;  5H85 A;  5JI8 A;  5CTL A;  3Q2E A;  5TCM A;  4RVR A;  3I3J A;  2RNW A;  5EPB A;  2R0V A;  4NR7 A;  5EIS A;  3MQM A;  4AKH A;  4TZ2 A;  4TT2 A;  4NQN A;  4UIY A;  5D3N A;  5FFV A;  4NR6 A;  4NRC A;  4QY4 A;  3IU6 A;  5HLS A;  5F36 A;  5DX4 A;  5A5N A;  2WP2 A;  4O78 A;  4A9E A;  5IG6 A;  4QYD A;  1EQF A;  5L8U A;  3LXJ A;  5D7X A;  4PKL A;  5HM0 A;  4CUP A;  2R0S A;  3AQA A;  4BJX A;  4O75 A;  2WP1 A;  4UYF A;  4A9O A;  4QSP A;  5FE2 A;  5DLZ A;  5A5P A;  2D82 A;  3JVM A;  4QSX A;  5D3H A;  5E9M A;  2YDW A;  2L5E A;  5FE6 A;  4YAT A;  3LQI A;  5D3R A;  4NQM A;  4KV4 A;  4NUC A;  4NUD A;  4Q0O A;  5H1U A;  5CQ6 A;  5A7C A;  5FE7 A;  4QEW A;  5A5S A;  4YYK A;  4HXL A;  3DWY A;  5I40 A;  4HXN A;  5FE0 A;  5D3J A;  5G4R A;  3K2J A;  5C4Q A;  5FE3 A;  3O34 A;  2DVR A;  5I1Q A;  2MJV B;  4O7F A;  4LZR A;  4XUB A;  5I80 A;  5KTX A;  5BT5 A;  2EJN A;  4AKI A;  4IR6 A;  3D1D A;  4QSV A;  4AKG A;  4QST A;  4YAB A;  5DYU A;  5FB1 A;  5F1L A;  2R10 A;  5ENE A;  4J1P A;  3AAD A;  5D3P A;  4LDF A;  5E74 A;  5CP5 A;  4WIV A;  5EU1 A;  3MXF A;  5HFR A;  4A9H A;  5HQ6 A;  4YYN A;  3P1C A;  4YYG A;  5CRM A;  4PTB A;  4DON A;  4UYG A;  1N72 A;  4QSS A;  3G0L A;  2GRC A;  5C8G A;  5FG5 A;  5CQ3 A;  4LZ2 A;  5E73 A;  5A5R A;  2I8N A;  3IU5 A;  4X2I A;  3FKM X;  5LKU A;  4QBM A;  5AMF A;  4NRB A;  2RI7 A;  3SVH A;  5FE5 A;  4LRG A;  4BHW A;  3Q2F A;  4N4G A;  4BW2 A;  3O35 A;  4O72 A;  2YEM A;  5DFB A;  5IGM A;  4NUE A;  3LJW A;  3GG3 A;  3UV2 A;  4NYX A;  2G4A A;  4QSU A;  5A81 A;  5KTW A;  4O7A A;  4BW1 A;  3P1E A;  4YAX A;  4LYI A;  5IGN A;  4YBM A;  2YEL A;  5EGU A;  5FE4 A;  3HMF A;  1WUM A;  4QNS A;  5FG4 A;  3HME A;  5CQ7 A;  3P5O A;  2RS9 B;  5E9V A;  5DKD A;  4YH4 A;  4YYH A;  5E9K A;  5F2P A;  3NXB A;  4CUU A;  2I7K A;  4YBT A;  4GPJ A;  4NR8 A;  5I88 A;  4QYL A;  5CUG A;  5FE1 A;  5JWM A;  4QB3 A;  5L96 A;  4LR6 A;  4ALG A;  4QR4 A;  5E3G A;  5EIC A;  3DAI A;  3D1B A;  4LYW A;  5DW1 A;  4TZ8 A;  2RNX A;  5DYA A;  4TU6 A;  5EWD A;  2N9G A;  5AD3 A;  5CGP A;  4LZS A;  5EP7 A;  4UIW A;  5A85 A;  1ZS5 A;  4QSQ A;  5EPS A;  2F6J A;  4YK0 A;  2YYN A;  5E9Y A;  4Z1Q A;  4FLP A;  5L98 A;  4QUT A;  4CL9 A;  5LKX A;  4HXK A;  5CUD A;  5II2 A;  4ALH A;  2DVQ A;  3U5P A;  4J0S A;  4HXR A;  4TYL A;  5HRX A;  4QZS A;  5DFD A;  5G4S A;  5KU3 A;  2F6N A;  3LQH A;  3QZV A;  4UYH A;  4IOO A;  5F63 A;  3ZYU A;  4MEN A;  5EVA A;  5CQT A;  1ZKR A;  4QUU A;  5ENI A;  2H60 A;  4O7E A;  4UYD A;  3U5K A;  3S91 A;  4QSW A;  5EPR A;  5IID A;  4OGI A;  4YAD A;  3QZT A;  4UYE A;  4NR5 A;  5F1H A;  4YYD A;  4MR5 A;  4NR9 A;  4TU4 A;  4XYA A;  5DY7 A;  5F61 A;  2E7O A;  4YYI A;  5ACY A;  2KTB B;  4IOR A;  2DVS A;  5CUA A;  4TQN A;  4CUR A;  4MEQ A;  4J0R A;  1JM4 B;  4YH3 A;  4QC1 A;  4UYF B;  4F3I A;  5COI A;  5F25 A;  4O70 A;  4IOQ A;  4TT4 A;  5L8T A;  5DKH A;  4MR4 A;  4XUA A;  5E7D A;  4A9I A;  4O77 A;  5CQ4 A;  5IBN A;  5E0R A;  5BT4 A;  4Y03 A;  5ETD A;  3UVY A;  5HCL A;  4A9L A;  5KO4 A;  5EK9 A;  1E6I A;  4UIZ A;  3UVX A;  4Z1S A;  3SVF A;  4NRA A;  5HEL A;  4UIX A;  4Z93 A;  5AD2 A;  5D3T A;  5EM3 A;  5DYX A;  4Q0N A;  5CS8 A;  1JSP B;  5DW2 A;  4N4H A;  5EA1 A;  5ENH A;  4HXP A;  5KTU A;  4Z6I A;  3U5J A;  3U5M A;  4WHW A;  5D24 A;  1F68 A;  4YBS A;  4YYJ A;  5IGL A;  3UV5 A;  4UIT A;  4CLB A;  5C87 A;  3S92 A;  5FG6 A;  5L99 A;  2LSP B;  3UVW A;  3P1F A;  3JVJ A;  4UIV A;  5ENC A;  5FFW A;  4QEU A;  5CQA A;  5D3L A;  4YY6 A;  5HQ5 A;  2E3K A;  4A9J A;  5AME A;  4LC2 A;  3U5L A;  4O71 A;  3TLP A;  2OO1 A;  5DBM A;  4IR5 A;  5FB0 A;  4MR6 A;  5EWC A;  5C85 A;  4NS5 A;  5F62 A;  4NYV A;  2L85 A;  5F60 A;  2E7N A;  4NXJ A;  5EQ1 A;  5HRW A;  2D9E A;  4CUQ A;  4J3I A;  5A83 A;  5LKT A;  5HEM A;  5ETB A;  5LVQ A;  5FH6 A;  5I7Y A;  4MEP A;  1WUG A;  3P1D A;  5D26 A;  4WHU A;  4ZQL A;  5DLX A;  4LYS A;  5CRZ A;  5H1T A;  4A9M A;  5HEN A;  4MR3 A;  1PUO A;  5ENB A;  5I83 A;  5LJ2 A;  5E3D A;  4ZC9 A;  5CFW A;  3U5N A;  5A82 A;  4QSR A;  4UIU A;  4E96 A;  4C66 A;  4IR4 A;  5A5Q A;  5LJ0 A; 
#chains in the Genus database with same CATH homology
 5I86 A;  5LKZ A;  4YC9 A;  2OUO A;  5A5O A;  3O36 A;  5C7N A;  4IR3 A;  4XY9 A;  5KHM A;  4QC3 A;  5FFY A;  5I29 A;  5CPE A;  3G0J A;  4QEV A;  1X0J A;  4OGJ A;  4TT6 A;  5CUE A;  3D7C A;  5FBX A;  2FSA A;  5HJC A;  2RO1 A;  4PCE A;  4HBX A;  4O7C A;  5HRV A;  4A9F A;  4CUT A;  5LJ1 A;  5IGK A;  4AKN A;  5FDZ A;  5E9I A;  3ONI A;  3UVD A;  3HMH A;  2YEK A;  4OUF A;  2YQD A;  5L97 A;  2RNY A;  4HBY A;  5BT3 A;  5D3S A;  4HBW A;  5EWW A;  4CFL A;  4PY6 A;  5EV9 A;  4O76 A;  5ENJ A;  4CUS A;  2DKW A;  5CQ5 A;  5HFQ A;  4QR5 A;  2R0Y A;  5ENF A;  4ZW1 A;  5F5Z A;  5CU8 A;  3MB4 A;  3UV4 A;  5CZG A;  4TS8 A;  5H1V A;  4QR3 A;  5E9L A;  5LUU A;  4HXM A;  2RFJ A;  3O33 A;  4HBV A;  4N3W A;  5EI4 A;  4C67 A;  5J0D A;  4O7B A;  2YW5 A;  5CUC A;  4N4I A;  4KCX A;  3MUL A;  5F3A A;  5D0C A;  4YY4 A;  5FH7 A;  5HQ7 A;  4HXS A;  5DKC A;  4A9K A;  4KV1 A;  5CUB A;  3U5O A;  2DVV A;  3UW9 A;  2OSS A;  3JVL A;  5FE8 A;  3MUK A;  4YYM A;  2DWW A;  5I89 A;  5CY9 A;  4PS5 A;  4HXO A;  5D25 A;  2NXB A;  5FH8 A;  3RCW A;  5CQ8 A;  4XY8 A;  4TTE A;  4BW3 A;  3QZS A;  2DAT A;  5II1 A;  4A9N A;  5DFC A;  5ENG A;  5DYC A;  4O74 A;  3SVG A;  5TB6 A;  5FE9 A;  5EWV A;  5C89 A;  4PCI A;  4NR4 A;  3O37 A;  5LVR A;  5EWH A;  4Z6H A;  4MEO A;  3JVK A;  2L84 A;  4N4F A;  5K29 A;  3MB3 A;  4CFK A;  4BW4 A;  5I7X A;  4NYW A;  3LQJ A;  5H85 A;  5JI8 A;  5CTL A;  3Q2E A;  5TCM A;  4RVR A;  3I3J A;  2RNW A;  5EPB A;  2R0V A;  4NR7 A;  5EIS A;  3MQM A;  4TZ2 A;  4TT2 A;  4NQN A;  4UIY A;  5D3N A;  5FFV A;  4NR6 A;  4NRC A;  4QY4 A;  3IU6 A;  5HLS A;  5F36 A;  5DX4 A;  5A5N A;  2WP2 A;  4O78 A;  4A9E A;  5IG6 A;  4QYD A;  1EQF A;  5L8U A;  3LXJ A;  5D7X A;  4PKL A;  5HM0 A;  4CUP A;  2R0S A;  3AQA A;  4BJX A;  4O75 A;  2WP1 A;  4UYF A;  4A9O A;  4QSP A;  5FE2 A;  5DLZ A;  5A5P A;  2D82 A;  3JVM A;  4QSX A;  5D3H A;  5E9M A;  2YDW A;  2L5E A;  5FE6 A;  4YAT A;  3LQI A;  5D3R A;  4NQM A;  4KV4 A;  4NUC A;  4NUD A;  4Q0O A;  5H1U A;  5CQ6 A;  5A7C A;  5FE7 A;  4QEW A;  5A5S A;  4YYK A;  4HXL A;  3DWY A;  5I40 A;  4HXN A;  5FE0 A;  5D3J A;  5G4R A;  3K2J A;  5C4Q A;  5FE3 A;  3O34 A;  2DVR A;  5I1Q A;  2MJV B;  4O7F A;  4LZR A;  4XUB A;  5I80 A;  5KTX A;  5BT5 A;  4IR6 A;  4QSV A;  4QST A;  4YAB A;  5DYU A;  5FB1 A;  5F1L A;  2R10 A;  5ENE A;  4J1P A;  3AAD A;  5D3P A;  4LDF A;  5E74 A;  5CP5 A;  4WIV A;  5EU1 A;  3MXF A;  5HFR A;  4A9H A;  5HQ6 A;  4YYN A;  3P1C A;  4YYG A;  5CRM A;  4PTB A;  4DON A;  4UYG A;  1N72 A;  4QSS A;  3G0L A;  2GRC A;  5C8G A;  5FG5 A;  5CQ3 A;  4LZ2 A;  5E73 A;  5A5R A;  2I8N A;  3IU5 A;  4X2I A;  3FKM X;  5LKU A;  4QBM A;  5AMF A;  4NRB A;  2RI7 A;  3SVH A;  5FE5 A;  4LRG A;  4BHW A;  3Q2F A;  4N4G A;  4BW2 A;  3O35 A;  4O72 A;  2YEM A;  5DFB A;  5IGM A;  4NUE A;  3LJW A;  3GG3 A;  3UV2 A;  4NYX A;  2G4A A;  4QSU A;  5A81 A;  5KTW A;  4O7A A;  4BW1 A;  3P1E A;  4YAX A;  4LYI A;  5IGN A;  4YBM A;  2YEL A;  5EGU A;  5FE4 A;  3HMF A;  1WUM A;  4QNS A;  5FG4 A;  3HME A;  5CQ7 A;  3P5O A;  2RS9 B;  5E9V A;  5DKD A;  4YH4 A;  4YYH A;  5E9K A;  5F2P A;  3NXB A;  4CUU A;  2I7K A;  4YBT A;  4GPJ A;  4NR8 A;  5I88 A;  4QYL A;  5CUG A;  5FE1 A;  5JWM A;  4QB3 A;  5L96 A;  4LR6 A;  4ALG A;  4QR4 A;  5E3G A;  5EIC A;  3DAI A;  4LYW A;  5DW1 A;  4TZ8 A;  2RNX A;  5DYA A;  4TU6 A;  5EWD A;  2N9G A;  5AD3 A;  5CGP A;  4LZS A;  5EP7 A;  4UIW A;  5A85 A;  1ZS5 A;  4QSQ A;  5EPS A;  2F6J A;  4YK0 A;  2YYN A;  5E9Y A;  4Z1Q A;  4FLP A;  5L98 A;  4QUT A;  4CL9 A;  5LKX A;  4HXK A;  5CUD A;  5II2 A;  4ALH A;  2DVQ A;  3U5P A;  4J0S A;  4HXR A;  4TYL A;  5HRX A;  4QZS A;  5DFD A;  5G4S A;  5KU3 A;  2F6N A;  3LQH A;  3QZV A;  4UYH A;  4IOO A;  5F63 A;  3ZYU A;  4MEN A;  5EVA A;  5CQT A;  4QUU A;  5ENI A;  2H60 A;  4O7E A;  4UYD A;  3U5K A;  3S91 A;  4QSW A;  5EPR A;  5IID A;  4OGI A;  4YAD A;  3QZT A;  4UYE A;  4NR5 A;  5F1H A;  4YYD A;  4MR5 A;  4NR9 A;  4TU4 A;  4XYA A;  5DY7 A;  5F61 A;  2E7O A;  4YYI A;  5ACY A;  2KTB B;  4IOR A;  2DVS A;  5CUA A;  4TQN A;  4CUR A;  4MEQ A;  4J0R A;  1JM4 B;  4YH3 A;  4QC1 A;  4UYF B;  4F3I A;  5COI A;  5F25 A;  4O70 A;  4IOQ A;  4TT4 A;  5L8T A;  5DKH A;  4MR4 A;  4XUA A;  5E7D A;  4A9I A;  4O77 A;  5CQ4 A;  5IBN A;  5E0R A;  5BT4 A;  4Y03 A;  5ETD A;  3UVY A;  5HCL A;  4A9L A;  5KO4 A;  5EK9 A;  1E6I A;  4UIZ A;  3UVX A;  4Z1S A;  3SVF A;  4NRA A;  5HEL A;  4UIX A;  4Z93 A;  5AD2 A;  5D3T A;  5EM3 A;  5DYX A;  4Q0N A;  5CS8 A;  1JSP B;  5DW2 A;  4N4H A;  5EA1 A;  5ENH A;  4HXP A;  5KTU A;  4Z6I A;  3U5J A;  3U5M A;  4WHW A;  5D24 A;  1F68 A;  4YBS A;  4YYJ A;  5IGL A;  3UV5 A;  4UIT A;  4CLB A;  5C87 A;  3S92 A;  5FG6 A;  5L99 A;  2LSP B;  3UVW A;  3P1F A;  3JVJ A;  4UIV A;  5ENC A;  5FFW A;  4QEU A;  5CQA A;  5D3L A;  4YY6 A;  5HQ5 A;  2E3K A;  4A9J A;  5AME A;  4LC2 A;  3U5L A;  4O71 A;  3TLP A;  2OO1 A;  5DBM A;  4IR5 A;  5FB0 A;  4MR6 A;  5EWC A;  5C85 A;  4NS5 A;  5F62 A;  4NYV A;  2L85 A;  5F60 A;  2E7N A;  4NXJ A;  5EQ1 A;  5HRW A;  2D9E A;  4CUQ A;  4J3I A;  5A83 A;  5LKT A;  5HEM A;  5ETB A;  5LVQ A;  5FH6 A;  5I7Y A;  4MEP A;  1WUG A;  3P1D A;  5D26 A;  4WHU A;  4ZQL A;  5DLX A;  4LYS A;  5CRZ A;  5H1T A;  4A9M A;  5HEN A;  4MR3 A;  5ENB A;  5I83 A;  5LJ2 A;  5E3D A;  4ZC9 A;  5CFW A;  3U5N A;  5A82 A;  4QSR A;  4UIU A;  4E96 A;  4C66 A;  4IR4 A;  5A5Q A;  5LJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...