4Z5ZA

The 2.5-angstrom crystal structure of mg(2+)-bound pqqb from pseudomonas putida
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
308
structure length
308
Chain Sequence
b'MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme PQQ synthesis protein B
publication title Crystal structures reveal metal-binding plasticity at the active site of PqqB
rcsb
source organism Pseudomonas putida (strain kt2440)
molecule tags Hydrolase
total genus 103
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4z5zA00
5HISA 2WYMC 2XF4A 4UAMA 1K07A 4FSBA 2M5DA 1YCFA 5LS3A 3BV6A 4KEQA 2BG8A 4B87A 4C1GA 2NZFA 4EXSA 1QH3A 3R2UA 4H0DA 4CHLA 3X2ZA 1KO3A 5B1UA 4RAMA 4EXYA 3PG4A 5AHOA 2AZ4A 2VW8A 3KL7A 3X2YA 2Y8AA 3G1PA 5K0WA 5KIKA 4FEKA 2OHIA 4C1EA 2I7XA 2WRSA 5HH6A 1M2XA 1JT1A 4RL2A 1BMCA 2ZWRA 2QEDA 3FAIA 5AYAA 3IELA 5HH5A 2HB9A 4AX0B 2BGAA 2GKLA 4XWTA 4BP0A 5ACUA 2Q0JA 5ACPA 3BK1A 3S0ZA 4UWOB 5AXRA 5LCHA 4HKYA 2BR6A 3MD7A 1ZTCA 4UWPB 2NXAA 1WRAA 4EY2A 4D1WA 3IOFA 2OHHA 4EYBA 4EYLA 2M5CA 4J5HA 4RAWA 4GYUA 3RKKA 2YNTB 2GMNA 4P62A 2GCUA 1JJTA 2GFKA 2QDSA 2YNTA 2FU9A 2CBNA 4HL2A 4DIKA 5DPXA 1X8GA 4YSBA 5EV8A 2WYLA 4ZO2A 5AHRA 3PY6A 3KNSA 4V0HA 5EW0A 2YNVB 4D1VA 4C09A 5LE1A 5LSCA 3RPCA 3ZR9A 1E5DA 1WUPA 5KILA 4LE6A 5ACWA 1XM8A 5EVBA 4WD6A 2FHXB 1QH5A 2BMIA 4Z7RA 4RM5A 1WUOA 3ZNBA 3SBLA 4D1UA 3AF5A 4ZO3A 4YSLA 3AJ3A 4D1TA 2A7MA 2Q42A 1BVTA 1DXKA 4ZEJA 5EWAA 3ZWFA 1A8TA 1P9EA 4EYFA 4BZ3A 3VPEA 1VJNA 3Q6VA 5LCAA 4TYFA 2BFZB 1YCGA 4AWZA 3T9MA 3QH8A 5HIQA 2Y87A 4Z67A 2XR1A 1X8HA 2BFLA 4GCWA 3T3OA 5ACVA 1KO2A 4UA4A 4F6ZA 3DHBA 5FQBA 4DILA 1A7TA 5A5ZA 4KEPA 1DD6A 3DHCA 2FK6A 5EVKA 4U4LA 4JO0A 4Z60A 3BC2A 1YCHA 2YZ3A 5EV6A 2FU7A 4J5FA 2QDTA 3I11A 3RKJA 3PY5A 5ACXA 5EHTA 5K4MA 5IQKA 4FR7A 3ZQ4A 1HLKA 2DKFA 5HIOA 1ZKPA 3IE2A 4AX1B 2BG7A 5A0TA 4XWWA 2WHGA 2YNWA 4AWYB 2FU6A 2H6AA 1WW1A 4PVTA 2QJSA 2Q9UA 2DOOA 3JXPA 4TZEA 2P18A 1DDKA 2YNVA 3T3NA 2P1EA 4TZBA 2I7TA 5ACRA 1VGNA 5HIPA 4TZ9A 2ZNBA 5B15A 4UWSB 4RBSA 5EVDA 4AD9A 2FHXA 4F6HA 3TP9A 2NYPA 4NQ6A 2QINA 3P2UA 1XTOA 2AIOA 1KR3A 4TYTA 2BG8B 3X30A 3SW3A 1X8IA 2GFJA 2P97A 2R2DA 5ACSA 3AF6A 4UBQA 5LM6A 2BFKA 3WXCA 2BFZA 4C1HA 1VMEA 2Y8BA 4EFZA 5LMCA 3I15A 2Q0IA 2BIBA 2I7VA 3LVZA 4PVOA 4ZNBA 1SMLA 2UYXA 3SD9A 3SFPA 3DH8A 3H3EA 3KNRA 4O98A 3VQZA 1MQOA 3IE0A 1ZNBA 3BK2A 4XUKA 4GYQA 5K4NA 2P4ZA 2E7YA 4YSKA 5K4KA 1BC2A 2BG2A 3SRXA 4C1DA 2NZEA 2ZZIA 3ADRA 2WYMA 1JJEA 3SPUA 3F9OA 3ESHA 3I14A 3L6NA 2YNUA 3IEKA 5HH4A 1Y44A 5A0VA 5AXOA 5LCFA 4UWRB 4HL1A 4Z5YA 3X2XA 2YCBA 4C1CA 4D02A 2BTNA 5A87A 5LLDA 2ZO4A 5AEBA 2OHJA 3I13A 2BC2A 4Z6XA 4RL0A 3I0VA 2FM6A 4NQ2A 4TZFA 5ACQA 5EH9A 3DHAA 4C1FA 3IE1A 3A4YA 3IOGA 3FCZA 4NQ5A 5B3RA 4NQ4A 1L9YA 5ACTA 3IEMA 2BG6A 3IDZA 4Z5ZA 5FQCA 5FQAA 2FU8A
chains in the Genus database with same CATH superfamily
5HISA 2WYMC 2XF4A 4UAMA 1K07A 4FSBA 2M5DA 1YCFA 5LS3A 3BV6A 4KEQA 2BG8A 4B87A 4C1GA 2NZFA 4EXSA 1QH3A 3R2UA 4H0DA 4CHLA 3X2ZA 1KO3A 5B1UA 4RAMA 4EXYA 3PG4A 5AHOA 2AZ4A 2VW8A 3KL7A 3X2YA 2Y8AA 3G1PA 5K0WA 5KIKA 4FEKA 2OHIA 4C1EA 2I7XA 2WRSA 5HH6A 1M2XA 1JT1A 4RL2A 1BMCA 5AJLA 2ZWRA 2QEDA 3FAIA 5AYAA 3IELA 5HH5A 2HB9A 4AX0B 2BGAA 2GKLA 4XWTA 4BP0A 5ACUA 2Q0JA 5ACPA 3BK1A 3S0ZA 4UWOB 5AXRA 5LCHA 4HKYA 2BR6A 2YHEA 3MD7A 1ZTCA 4UWPB 2NXAA 1WRAA 4EY2A 4D1WA 3IOFA 2OHHA 4EYBA 4EYLA 2M5CA 4J5HA 4RAWA 4GYUA 3RKKA 2YNTB 2GMNA 4P62A 2GCUA 1JJTA 2GFKA 2QDSA 2YNTA 2FU9A 2CBNA 4NURA 4AXHA 4HL2A 4DIKA 5DPXA 1X8GA 4YSBA 5EV8A 2WYLA 4ZO2A 5AHRA 3PY6A 3KNSA 4V0HA 5EW0A 2YNVB 4D1VA 4C09A 5LE1A 5LSCA 3RPCA 3ZR9A 1E5DA 1WUPA 5KILA 2CG2A 4LE6A 5ACWA 1XM8A 5EVBA 4WD6A 2FHXB 1QH5A 2BMIA 4Z7RA 4RM5A 1WUOA 3ZNBA 3SBLA 4D1UA 3AF5A 4ZO3A 4YSLA 3AJ3A 4D1TA 2A7MA 2Q42A 1BVTA 1DXKA 4ZEJA 5EWAA 3ZWFA 1A8TA 1P9EA 4EYFA 4BZ3A 3VPEA 1VJNA 2CFZA 3Q6VA 5LCAA 4TYFA 2BFZB 1YCGA 4AWZA 3T9MA 3QH8A 5HIQA 2Y87A 5A23A 4Z67A 2XR1A 1X8HA 2BFLA 4GCWA 3T3OA 5ACVA 1KO2A 4UA4A 4F6ZA 3DHBA 5FQBA 4DILA 1A7TA 5A5ZA 4KEPA 1DD6A 3DHCA 2FK6A 5EVKA 4U4LA 4JO0A 4Z60A 3BC2A 1YCHA 2YZ3A 5EV6A 2FU7A 4J5FA 2QDTA 3I11A 3RKJA 3PY5A 5ACXA 5EHTA 5K4MA 5IQKA 4FR7A 3ZQ4A 1HLKA 2DKFA 5HIOA 1ZKPA 3IE2A 4AX1B 2BG7A 5A0TA 4XWWA 2WHGA 2YNWA 4AWYB 2FU6A 2H6AA 1WW1A 4PVTA 2QJSA 2Q9UA 2DOOA 3JXPA 4TZEA 2P18A 1DDKA 2YNVA 3T3NA 2P1EA 4TZBA 2I7TA 5ACRA 1VGNA 5HIPA 4TZ9A 2ZNBA 5B15A 4UWSB 4RBSA 5EVDA 4AD9A 2FHXA 4F6HA 3TP9A 2NYPA 4NQ6A 2QINA 3P2UA 1XTOA 2AIOA 1KR3A 4TYTA 2BG8B 3X30A 3SW3A 1X8IA 2GFJA 2CG3A 2P97A 2R2DA 5ACSA 3AF6A 4UBQA 5LM6A 2BFKA 3WXCA 2BFZA 4C1HA 1VMEA 2Y8BA 4EFZA 5LMCA 3I15A 2Q0IA 2BIBA 2I7VA 3LVZA 4PVOA 4ZNBA 1SMLA 2UYXA 3SD9A 3SFPA 3DH8A 2CFUA 3H3EA 3KNRA 4O98A 4PDXA 3VQZA 1MQOA 3IE0A 1ZNBA 3BK2A 4XUKA 4GYQA 5K4NA 2P4ZA 2E7YA 4YSKA 5K4KA 1BC2A 2BG2A 3SRXA 4C1DA 2NZEA 2ZZIA 3ADRA 2WYMA 1JJEA 3SPUA 3F9OA 3ESHA 3I14A 3L6NA 2YNUA 3IEKA 5HH4A 1Y44A 5AIJA 5A0VA 5AXOA 5LCFA 4UWRB 4AV7A 4HL1A 4Z5YA 3X2XA 2YCBA 4C1CA 4D02A 2BTNA 5A87A 5LLDA 2ZO4A 5AEBA 2OHJA 3I13A 2BC2A 4Z6XA 4RL0A 3I0VA 2FM6A 4NQ2A 4TZFA 5ACQA 5EH9A 3DHAA 4C1FA 3IE1A 3A4YA 3IOGA 3FCZA 4NQ5A 5B3RA 4NQ4A 1L9YA 5ACTA 3IEMA 2BG6A 3IDZA 4Z5ZA 5FQCA 5FQAA 2FU8A
chains in the Genus database with same CATH topology
5HISA 2WYMC 2XF4A 4UAMA 1K07A 4FSBA 2M5DA 1YCFA 5LS3A 3BV6A 4KEQA 2BG8A 4B87A 4C1GA 2NZFA 4EXSA 1QH3A 3R2UA 4H0DA 4CHLA 3X2ZA 1KO3A 5B1UA 4RAMA 4EXYA 3PG4A 5AHOA 2AZ4A 2VW8A 3KL7A 3X2YA 2Y8AA 3G1PA 5K0WA 5KIKA 4FEKA 2OHIA 4C1EA 2I7XA 2WRSA 5HH6A 1M2XA 1JT1A 4RL2A 1BMCA 2ZWRA 2QEDA 3FAIA 5AYAA 3IELA 5HH5A 2HB9A 4AX0B 2BGAA 2GKLA 4XWTA 4BP0A 5ACUA 2Q0JA 5ACPA 3BK1A 3S0ZA 4UWOB 5AXRA 5LCHA 4HKYA 2BR6A 3MD7A 1ZTCA 4UWPB 2NXAA 1WRAA 4EY2A 4D1WA 3IOFA 2OHHA 4EYBA 4EYLA 2M5CA 4J5HA 4RAWA 4GYUA 3RKKA 2YNTB 2GMNA 4P62A 2GCUA 1JJTA 2GFKA 2QDSA 2YNTA 2FU9A 2CBNA 4HL2A 4DIKA 5DPXA 1X8GA 4YSBA 5EV8A 2WYLA 4ZO2A 5AHRA 3PY6A 3KNSA 4V0HA 5EW0A 2YNVB 4D1VA 4C09A 5LE1A 5LSCA 3RPCA 3ZR9A 1E5DA 1WUPA 5KILA 4LE6A 5ACWA 1XM8A 5EVBA 4WD6A 2FHXB 1QH5A 2BMIA 4Z7RA 4RM5A 1WUOA 3ZNBA 3SBLA 4D1UA 3AF5A 4ZO3A 4YSLA 3AJ3A 4D1TA 2A7MA 2Q42A 1BVTA 1DXKA 4ZEJA 5EWAA 3ZWFA 1A8TA 1P9EA 4EYFA 4BZ3A 3VPEA 1VJNA 3Q6VA 5LCAA 4TYFA 2BFZB 1YCGA 4AWZA 3T9MA 3QH8A 5HIQA 2Y87A 4Z67A 2XR1A 1X8HA 2BFLA 4GCWA 3T3OA 5ACVA 1KO2A 4UA4A 4F6ZA 3DHBA 5FQBA 4DILA 1A7TA 5A5ZA 4KEPA 1DD6A 3DHCA 2FK6A 5EVKA 4U4LA 4JO0A 4Z60A 3BC2A 1YCHA 2YZ3A 5EV6A 2FU7A 4J5FA 2QDTA 3I11A 3RKJA 3PY5A 5ACXA 5EHTA 5K4MA 5IQKA 4FR7A 3ZQ4A 1HLKA 2DKFA 5HIOA 1ZKPA 3IE2A 4AX1B 2BG7A 5A0TA 4XWWA 2WHGA 2YNWA 4AWYB 2FU6A 2H6AA 1WW1A 4PVTA 2QJSA 2Q9UA 2DOOA 3JXPA 4TZEA 2P18A 1DDKA 2YNVA 3T3NA 2P1EA 4TZBA 2I7TA 5ACRA 1VGNA 5HIPA 4TZ9A 2ZNBA 5B15A 4UWSB 4RBSA 5EVDA 4AD9A 2FHXA 4F6HA 3TP9A 2NYPA 4NQ6A 2QINA 3P2UA 1XTOA 2AIOA 1KR3A 4TYTA 2BG8B 3X30A 3SW3A 1X8IA 2GFJA 2P97A 2R2DA 5ACSA 3AF6A 4UBQA 5LM6A 2BFKA 3WXCA 2BFZA 4C1HA 1VMEA 2Y8BA 4EFZA 5LMCA 3I15A 2Q0IA 2BIBA 2I7VA 3LVZA 4PVOA 4ZNBA 1SMLA 2UYXA 3SD9A 3SFPA 3DH8A 3H3EA 3KNRA 4O98A 3VQZA 1MQOA 3IE0A 1ZNBA 3BK2A 4XUKA 4GYQA 5K4NA 2P4ZA 2E7YA 4YSKA 5K4KA 1BC2A 2BG2A 3SRXA 4C1DA 2NZEA 2ZZIA 3ADRA 2WYMA 1JJEA 3SPUA 3F9OA 3ESHA 3I14A 3L6NA 2YNUA 3IEKA 5HH4A 1Y44A 5A0VA 5AXOA 5LCFA 4UWRB 4HL1A 4Z5YA 3X2XA 2YCBA 4C1CA 4D02A 2BTNA 5A87A 5LLDA 2ZO4A 5AEBA 2OHJA 3I13A 2BC2A 4Z6XA 4RL0A 3I0VA 2FM6A 4NQ2A 4TZFA 5ACQA 5EH9A 3DHAA 4C1FA 3IE1A 3A4YA 3IOGA 3FCZA 4NQ5A 5B3RA 4NQ4A 1L9YA 5ACTA 3IEMA 2BG6A 3IDZA 4Z5ZA 5FQCA 5FQAA 2FU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HIS A;  2WYM C;  2XF4 A;  4UAM A;  1K07 A;  4FSB A;  2M5D A;  1YCF A;  5LS3 A;  3BV6 A;  4KEQ A;  2BG8 A;  4B87 A;  4C1G A;  2NZF A;  4EXS A;  1QH3 A;  3R2U A;  4H0D A;  4CHL A;  3X2Z A;  1KO3 A;  5B1U A;  4RAM A;  4EXY A;  3PG4 A;  5AHO A;  2AZ4 A;  2VW8 A;  3KL7 A;  3X2Y A;  2Y8A A;  3G1P A;  5K0W A;  5KIK A;  4FEK A;  2OHI A;  4C1E A;  2I7X A;  2WRS A;  5HH6 A;  1M2X A;  1JT1 A;  4RL2 A;  1BMC A;  2ZWR A;  2QED A;  3FAI A;  5AYA A;  3IEL A;  5HH5 A;  2HB9 A;  4AX0 B;  2BGA A;  2GKL A;  4XWT A;  4BP0 A;  5ACU A;  2Q0J A;  5ACP A;  3BK1 A;  3S0Z A;  4UWO B;  5AXR A;  5LCH A;  4HKY A;  2BR6 A;  3MD7 A;  1ZTC A;  4UWP B;  2NXA A;  1WRA A;  4EY2 A;  4D1W A;  3IOF A;  2OHH A;  4EYB A;  4EYL A;  2M5C A;  4J5H A;  4RAW A;  4GYU A;  3RKK A;  2YNT B;  2GMN A;  4P62 A;  2GCU A;  1JJT A;  2GFK A;  2QDS A;  2YNT A;  2FU9 A;  2CBN A;  4HL2 A;  4DIK A;  5DPX A;  1X8G A;  4YSB A;  5EV8 A;  2WYL A;  4ZO2 A;  5AHR A;  3PY6 A;  3KNS A;  4V0H A;  5EW0 A;  2YNV B;  4D1V A;  4C09 A;  5LE1 A;  5LSC A;  3RPC A;  3ZR9 A;  1E5D A;  1WUP A;  5KIL A;  4LE6 A;  5ACW A;  1XM8 A;  5EVB A;  4WD6 A;  2FHX B;  1QH5 A;  2BMI A;  4Z7R A;  4RM5 A;  1WUO A;  3ZNB A;  3SBL A;  4D1U A;  3AF5 A;  4ZO3 A;  4YSL A;  3AJ3 A;  4D1T A;  2A7M A;  2Q42 A;  1BVT A;  1DXK A;  4ZEJ A;  5EWA A;  3ZWF A;  1A8T A;  1P9E A;  4EYF A;  4BZ3 A;  3VPE A;  1VJN A;  3Q6V A;  5LCA A;  4TYF A;  2BFZ B;  1YCG A;  4AWZ A;  3T9M A;  3QH8 A;  5HIQ A;  2Y87 A;  4Z67 A;  2XR1 A;  1X8H A;  2BFL A;  4GCW A;  3T3O A;  5ACV A;  1KO2 A;  4UA4 A;  4F6Z A;  3DHB A;  5FQB A;  4DIL A;  1A7T A;  5A5Z A;  4KEP A;  1DD6 A;  3DHC A;  2FK6 A;  5EVK A;  4U4L A;  4JO0 A;  4Z60 A;  3BC2 A;  1YCH A;  2YZ3 A;  5EV6 A;  2FU7 A;  4J5F A;  2QDT A;  3I11 A;  3RKJ A;  3PY5 A;  5ACX A;  5EHT A;  5K4M A;  5IQK A;  4FR7 A;  3ZQ4 A;  1HLK A;  2DKF A;  5HIO A;  1ZKP A;  3IE2 A;  4AX1 B;  2BG7 A;  5A0T A;  4XWW A;  2WHG A;  2YNW A;  4AWY B;  2FU6 A;  2H6A A;  1WW1 A;  4PVT A;  2QJS A;  2Q9U A;  2DOO A;  3JXP A;  4TZE A;  2P18 A;  1DDK A;  2YNV A;  3T3N A;  2P1E A;  4TZB A;  2I7T A;  5ACR A;  1VGN A;  5HIP A;  4TZ9 A;  2ZNB A;  5B15 A;  4UWS B;  4RBS A;  5EVD A;  4AD9 A;  2FHX A;  4F6H A;  3TP9 A;  2NYP A;  4NQ6 A;  2QIN A;  3P2U A;  1XTO A;  2AIO A;  1KR3 A;  4TYT A;  2BG8 B;  3X30 A;  3SW3 A;  1X8I A;  2GFJ A;  2P97 A;  2R2D A;  5ACS A;  3AF6 A;  4UBQ A;  5LM6 A;  2BFK A;  3WXC A;  2BFZ A;  4C1H A;  1VME A;  2Y8B A;  4EFZ A;  5LMC A;  3I15 A;  2Q0I A;  2BIB A;  2I7V A;  3LVZ A;  4PVO A;  4ZNB A;  1SML A;  2UYX A;  3SD9 A;  3SFP A;  3DH8 A;  3H3E A;  3KNR A;  4O98 A;  3VQZ A;  1MQO A;  3IE0 A;  1ZNB A;  3BK2 A;  4XUK A;  4GYQ A;  5K4N A;  2P4Z A;  2E7Y A;  4YSK A;  5K4K A;  1BC2 A;  2BG2 A;  3SRX A;  4C1D A;  2NZE A;  2ZZI A;  3ADR A;  2WYM A;  1JJE A;  3SPU A;  3F9O A;  3ESH A;  3I14 A;  3L6N A;  2YNU A;  3IEK A;  5HH4 A;  1Y44 A;  5A0V A;  5AXO A;  5LCF A;  4UWR B;  4HL1 A;  4Z5Y A;  3X2X A;  2YCB A;  4C1C A;  4D02 A;  2BTN A;  5A87 A;  5LLD A;  2ZO4 A;  5AEB A;  2OHJ A;  3I13 A;  2BC2 A;  4Z6X A;  4RL0 A;  3I0V A;  2FM6 A;  4NQ2 A;  4TZF A;  5ACQ A;  5EH9 A;  3DHA A;  4C1F A;  3IE1 A;  3A4Y A;  3IOG A;  3FCZ A;  4NQ5 A;  5B3R A;  4NQ4 A;  1L9Y A;  5ACT A;  3IEM A;  2BG6 A;  3IDZ A;  4Z5Z A;  5FQC A;  5FQA A;  2FU8 A; 
#chains in the Genus database with same CATH topology
 5HIS A;  2WYM C;  2XF4 A;  4UAM A;  1K07 A;  4FSB A;  2M5D A;  1YCF A;  5LS3 A;  3BV6 A;  4KEQ A;  2BG8 A;  4B87 A;  4C1G A;  2NZF A;  4EXS A;  1QH3 A;  3R2U A;  4H0D A;  4CHL A;  3X2Z A;  1KO3 A;  5B1U A;  4RAM A;  4EXY A;  3PG4 A;  5AHO A;  2AZ4 A;  2VW8 A;  3KL7 A;  3X2Y A;  2Y8A A;  3G1P A;  5K0W A;  5KIK A;  4FEK A;  2OHI A;  4C1E A;  2I7X A;  2WRS A;  5HH6 A;  1M2X A;  1JT1 A;  4RL2 A;  1BMC A;  5AJL A;  2ZWR A;  2QED A;  3FAI A;  5AYA A;  3IEL A;  5HH5 A;  2HB9 A;  4AX0 B;  2BGA A;  2GKL A;  4XWT A;  4BP0 A;  5ACU A;  2Q0J A;  5ACP A;  3BK1 A;  3S0Z A;  4UWO B;  5AXR A;  5LCH A;  4HKY A;  2BR6 A;  2YHE A;  3MD7 A;  1ZTC A;  4UWP B;  2NXA A;  1WRA A;  4EY2 A;  4D1W A;  3IOF A;  2OHH A;  4EYB A;  4EYL A;  2M5C A;  4J5H A;  4RAW A;  4GYU A;  3RKK A;  2YNT B;  2GMN A;  4P62 A;  2GCU A;  1JJT A;  2GFK A;  2QDS A;  2YNT A;  2FU9 A;  2CBN A;  4NUR A;  4AXH A;  4HL2 A;  4DIK A;  5DPX A;  1X8G A;  4YSB A;  5EV8 A;  2WYL A;  4ZO2 A;  5AHR A;  3PY6 A;  3KNS A;  4V0H A;  5EW0 A;  2YNV B;  4D1V A;  4C09 A;  5LE1 A;  5LSC A;  3RPC A;  3ZR9 A;  1E5D A;  1WUP A;  5KIL A;  2CG2 A;  4LE6 A;  5ACW A;  1XM8 A;  5EVB A;  4WD6 A;  2FHX B;  1QH5 A;  2BMI A;  4Z7R A;  4RM5 A;  1WUO A;  3ZNB A;  3SBL A;  4D1U A;  3AF5 A;  4ZO3 A;  4YSL A;  3AJ3 A;  4D1T A;  2A7M A;  2Q42 A;  1BVT A;  1DXK A;  4ZEJ A;  5EWA A;  3ZWF A;  1A8T A;  1P9E A;  4EYF A;  4BZ3 A;  3VPE A;  1VJN A;  2CFZ A;  3Q6V A;  5LCA A;  4TYF A;  2BFZ B;  1YCG A;  4AWZ A;  3T9M A;  3QH8 A;  5HIQ A;  2Y87 A;  5A23 A;  4Z67 A;  2XR1 A;  1X8H A;  2BFL A;  4GCW A;  3T3O A;  5ACV A;  1KO2 A;  4UA4 A;  4F6Z A;  3DHB A;  5FQB A;  4DIL A;  1A7T A;  5A5Z A;  4KEP A;  1DD6 A;  3DHC A;  2FK6 A;  5EVK A;  4U4L A;  4JO0 A;  4Z60 A;  3BC2 A;  1YCH A;  2YZ3 A;  5EV6 A;  2FU7 A;  4J5F A;  2QDT A;  3I11 A;  3RKJ A;  3PY5 A;  5ACX A;  5EHT A;  5K4M A;  5IQK A;  4FR7 A;  3ZQ4 A;  1HLK A;  2DKF A;  5HIO A;  1ZKP A;  3IE2 A;  4AX1 B;  2BG7 A;  5A0T A;  4XWW A;  2WHG A;  2YNW A;  4AWY B;  2FU6 A;  2H6A A;  1WW1 A;  4PVT A;  2QJS A;  2Q9U A;  2DOO A;  3JXP A;  4TZE A;  2P18 A;  1DDK A;  2YNV A;  3T3N A;  2P1E A;  4TZB A;  2I7T A;  5ACR A;  1VGN A;  5HIP A;  4TZ9 A;  2ZNB A;  5B15 A;  4UWS B;  4RBS A;  5EVD A;  4AD9 A;  2FHX A;  4F6H A;  3TP9 A;  2NYP A;  4NQ6 A;  2QIN A;  3P2U A;  1XTO A;  2AIO A;  1KR3 A;  4TYT A;  2BG8 B;  3X30 A;  3SW3 A;  1X8I A;  2GFJ A;  2CG3 A;  2P97 A;  2R2D A;  5ACS A;  3AF6 A;  4UBQ A;  5LM6 A;  2BFK A;  3WXC A;  2BFZ A;  4C1H A;  1VME A;  2Y8B A;  4EFZ A;  5LMC A;  3I15 A;  2Q0I A;  2BIB A;  2I7V A;  3LVZ A;  4PVO A;  4ZNB A;  1SML A;  2UYX A;  3SD9 A;  3SFP A;  3DH8 A;  2CFU A;  3H3E A;  3KNR A;  4O98 A;  4PDX A;  3VQZ A;  1MQO A;  3IE0 A;  1ZNB A;  3BK2 A;  4XUK A;  4GYQ A;  5K4N A;  2P4Z A;  2E7Y A;  4YSK A;  5K4K A;  1BC2 A;  2BG2 A;  3SRX A;  4C1D A;  2NZE A;  2ZZI A;  3ADR A;  2WYM A;  1JJE A;  3SPU A;  3F9O A;  3ESH A;  3I14 A;  3L6N A;  2YNU A;  3IEK A;  5HH4 A;  1Y44 A;  5AIJ A;  5A0V A;  5AXO A;  5LCF A;  4UWR B;  4AV7 A;  4HL1 A;  4Z5Y A;  3X2X A;  2YCB A;  4C1C A;  4D02 A;  2BTN A;  5A87 A;  5LLD A;  2ZO4 A;  5AEB A;  2OHJ A;  3I13 A;  2BC2 A;  4Z6X A;  4RL0 A;  3I0V A;  2FM6 A;  4NQ2 A;  4TZF A;  5ACQ A;  5EH9 A;  3DHA A;  4C1F A;  3IE1 A;  3A4Y A;  3IOG A;  3FCZ A;  4NQ5 A;  5B3R A;  4NQ4 A;  1L9Y A;  5ACT A;  3IEM A;  2BG6 A;  3IDZ A;  4Z5Z A;  5FQC A;  5FQA A;  2FU8 A; 
#chains in the Genus database with same CATH homology
 5HIS A;  2WYM C;  2XF4 A;  4UAM A;  1K07 A;  4FSB A;  2M5D A;  1YCF A;  5LS3 A;  3BV6 A;  4KEQ A;  2BG8 A;  4B87 A;  4C1G A;  2NZF A;  4EXS A;  1QH3 A;  3R2U A;  4H0D A;  4CHL A;  3X2Z A;  1KO3 A;  5B1U A;  4RAM A;  4EXY A;  3PG4 A;  5AHO A;  2AZ4 A;  2VW8 A;  3KL7 A;  3X2Y A;  2Y8A A;  3G1P A;  5K0W A;  5KIK A;  4FEK A;  2OHI A;  4C1E A;  2I7X A;  2WRS A;  5HH6 A;  1M2X A;  1JT1 A;  4RL2 A;  1BMC A;  2ZWR A;  2QED A;  3FAI A;  5AYA A;  3IEL A;  5HH5 A;  2HB9 A;  4AX0 B;  2BGA A;  2GKL A;  4XWT A;  4BP0 A;  5ACU A;  2Q0J A;  5ACP A;  3BK1 A;  3S0Z A;  4UWO B;  5AXR A;  5LCH A;  4HKY A;  2BR6 A;  3MD7 A;  1ZTC A;  4UWP B;  2NXA A;  1WRA A;  4EY2 A;  4D1W A;  3IOF A;  2OHH A;  4EYB A;  4EYL A;  2M5C A;  4J5H A;  4RAW A;  4GYU A;  3RKK A;  2YNT B;  2GMN A;  4P62 A;  2GCU A;  1JJT A;  2GFK A;  2QDS A;  2YNT A;  2FU9 A;  2CBN A;  4HL2 A;  4DIK A;  5DPX A;  1X8G A;  4YSB A;  5EV8 A;  2WYL A;  4ZO2 A;  5AHR A;  3PY6 A;  3KNS A;  4V0H A;  5EW0 A;  2YNV B;  4D1V A;  4C09 A;  5LE1 A;  5LSC A;  3RPC A;  3ZR9 A;  1E5D A;  1WUP A;  5KIL A;  4LE6 A;  5ACW A;  1XM8 A;  5EVB A;  4WD6 A;  2FHX B;  1QH5 A;  2BMI A;  4Z7R A;  4RM5 A;  1WUO A;  3ZNB A;  3SBL A;  4D1U A;  3AF5 A;  4ZO3 A;  4YSL A;  3AJ3 A;  4D1T A;  2A7M A;  2Q42 A;  1BVT A;  1DXK A;  4ZEJ A;  5EWA A;  3ZWF A;  1A8T A;  1P9E A;  4EYF A;  4BZ3 A;  3VPE A;  1VJN A;  3Q6V A;  5LCA A;  4TYF A;  2BFZ B;  1YCG A;  4AWZ A;  3T9M A;  3QH8 A;  5HIQ A;  2Y87 A;  4Z67 A;  2XR1 A;  1X8H A;  2BFL A;  4GCW A;  3T3O A;  5ACV A;  1KO2 A;  4UA4 A;  4F6Z A;  3DHB A;  5FQB A;  4DIL A;  1A7T A;  5A5Z A;  4KEP A;  1DD6 A;  3DHC A;  2FK6 A;  5EVK A;  4U4L A;  4JO0 A;  4Z60 A;  3BC2 A;  1YCH A;  2YZ3 A;  5EV6 A;  2FU7 A;  4J5F A;  2QDT A;  3I11 A;  3RKJ A;  3PY5 A;  5ACX A;  5EHT A;  5K4M A;  5IQK A;  4FR7 A;  3ZQ4 A;  1HLK A;  2DKF A;  5HIO A;  1ZKP A;  3IE2 A;  4AX1 B;  2BG7 A;  5A0T A;  4XWW A;  2WHG A;  2YNW A;  4AWY B;  2FU6 A;  2H6A A;  1WW1 A;  4PVT A;  2QJS A;  2Q9U A;  2DOO A;  3JXP A;  4TZE A;  2P18 A;  1DDK A;  2YNV A;  3T3N A;  2P1E A;  4TZB A;  2I7T A;  5ACR A;  1VGN A;  5HIP A;  4TZ9 A;  2ZNB A;  5B15 A;  4UWS B;  4RBS A;  5EVD A;  4AD9 A;  2FHX A;  4F6H A;  3TP9 A;  2NYP A;  4NQ6 A;  2QIN A;  3P2U A;  1XTO A;  2AIO A;  1KR3 A;  4TYT A;  2BG8 B;  3X30 A;  3SW3 A;  1X8I A;  2GFJ A;  2P97 A;  2R2D A;  5ACS A;  3AF6 A;  4UBQ A;  5LM6 A;  2BFK A;  3WXC A;  2BFZ A;  4C1H A;  1VME A;  2Y8B A;  4EFZ A;  5LMC A;  3I15 A;  2Q0I A;  2BIB A;  2I7V A;  3LVZ A;  4PVO A;  4ZNB A;  1SML A;  2UYX A;  3SD9 A;  3SFP A;  3DH8 A;  3H3E A;  3KNR A;  4O98 A;  3VQZ A;  1MQO A;  3IE0 A;  1ZNB A;  3BK2 A;  4XUK A;  4GYQ A;  5K4N A;  2P4Z A;  2E7Y A;  4YSK A;  5K4K A;  1BC2 A;  2BG2 A;  3SRX A;  4C1D A;  2NZE A;  2ZZI A;  3ADR A;  2WYM A;  1JJE A;  3SPU A;  3F9O A;  3ESH A;  3I14 A;  3L6N A;  2YNU A;  3IEK A;  5HH4 A;  1Y44 A;  5A0V A;  5AXO A;  5LCF A;  4UWR B;  4HL1 A;  4Z5Y A;  3X2X A;  2YCB A;  4C1C A;  4D02 A;  2BTN A;  5A87 A;  5LLD A;  2ZO4 A;  5AEB A;  2OHJ A;  3I13 A;  2BC2 A;  4Z6X A;  4RL0 A;  3I0V A;  2FM6 A;  4NQ2 A;  4TZF A;  5ACQ A;  5EH9 A;  3DHA A;  4C1F A;  3IE1 A;  3A4Y A;  3IOG A;  3FCZ A;  4NQ5 A;  5B3R A;  4NQ4 A;  1L9Y A;  5ACT A;  3IEM A;  2BG6 A;  3IDZ A;  4Z5Z A;  5FQC A;  5FQA A;  2FU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...