4Z68A

Hybrid structural analysis of the arp2/3 regulator arpin identifies its acidic tail as a primary binding epitope
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
b'SEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-2
publication title Hybrid Structural Analysis of the Arp2/3 Regulator Arpin Identifies Its Acidic Tail as a Primary Binding Epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 48
structure length 155
sequence length 155
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2015-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4z68A00
5AQBA 1UOHA 1OY3D 5AQ9A 5EIDA 5ENPD 1S70B 5FIOA 2BKKB 5FINA 3TWRA 3V2OA 1A5EA 1DC2A 4O1PA 5HRYA 5EN5D 2DVWA 4N5QA 4TUMA 5CBOA 3LJNA 1D9SA 1YCSB 5CERB 5AQ7A 2ZGGA 4YDWA 1TR4A 3EHRA 4K5BA 3TWTA 4F6RD 2F37A 3DEOA 2MYOA 3JXIA 5BXOA 2VGEA 3EHQA 4U95D 3TWVA 3V31A 3W9FA 4G8KA 4CYMD 4HNAD 4OAVB 2DWZA 1IHBA 4HRMB 3ZKJA 1K1BA 2V4HC 1G3NB 5CEDB 2PNNA 3ZU7B 4G8LA 3B95A 1N0RA 5CEAA 3NBNB 4GPMA 1IXVA 3TWWA 3V30A 5CBNA 1MX4A 2ZGDA 3TWUA 4O60A 3NOGD 1BD8A 5KNGA 4B93B 3Q9NC 4HRNA 4K5CA 4DX6D 2RFMA 3TWSA 2QYJA 3TWQA 4F1PA 1IKND 4DX7D 2JABA 4DUIA 5KBAA 5ENTD 5ENOD 3UI2A 3NOCD 5D66A 2BKGA 4Z68A 3ZNGA 1DCQA 2XEEA 5AARA 1MJ0A 4DRXE 1OT8A 4HI9A 2RFAA 5EILA 1WDYA 5HKPA 5BXUA 3J5PA 4LSZE 3IXEA 3TWXA 2B0OE 5EYLA 3T8KA 1NFIE 4HQDA 4U8VD 5ENQD 3DEPA 4U96D 2Y1LE 5EYPF 3W9GA 4HBDA 2ETCA 3HG0D 3SO8A 4ZHBA 2L6BA 2F8YA 1SW6A 4J8YA 4ATZD 2A5EA 4BETA 5AN8A 5ENRD 5KWDA 2XEHA 4BESA 1QYMA 4HLLA 5KNHD 2P2CP 1AP7A 1K1AA 1WG0A 4DX1A 4LNUD 4DX5D 4LG6A 1MX6A 3HRAA 1MYOA 1AWCB 2ETAA 3UTMA 5JA4D 4BSZB 2HE0A 3EU9A 3J5QB 2NYJA 3JXJA 1K3ZD 1MX2A 4U8YD 2J8SD 5HS0A 4GMRA 4CZ2D 3JUEA 1BLXB 2FO1E 1YYHA 4QQIA 4K5AB 3Q9UC 3C5RA 4HI8A 4HB5A 5AQAA 4BERA 1BU9A 2XENA 5EIBE 4DX2A 2ETBA 3T9KA 4OAUC 4NIKA 4J7WA 3D9HA 2F8XK 4QFVA 5CECB 4BEPA 4YDYA 2KBXA 5ITZF 3V79K 2V5QC 1BI8B 4ZFHA 5AAOA 1N11A 2KXPC 3ZUVB 1N0QA 3AJIA 5JMND 4C48B 3KEAA 1YMPA 3B7BA 3F6QA 5ENSD 2QC9A 4RLYA 4HRLA 3AAAC 1SVXA 2AJAA 2DZNA 4O1OA 1BI7B 2XZTG 2Y0BG 4UUCA 3UXGA 4A63B 4JB8P 2XZDG 2DZOA 3V2XA
chains in the Genus database with same CATH superfamily
2WXGA 1INZA 3OXGA 1OXJA 3C98A 2XCCA 3EU5A 2KCLA 3TG5A 1HZ4A 1D9SA 4ME2A 3NF1A 1YCSB 3CHOA 3AG2E 3S7BA 3PZDA 2XGOA 2VGXB 4RG9A 1KZPA 2H6FA 2H6IA 4CDMA 3L13A 5E76A 4KMOA 2XCBA 1MX4A 2UY1A 2P58C 3Q9NC 4K5CA 4HLEA 3LEWA 4I6JA 3KEZA 5CRUA 2P9SG 2IFUA 3RIBA 4XKCA 5ENTD 3FEYA 4AEZC 4Z68A 5KJKA 4JD2G 3ASDA 4J8FA 5EDSA 4GA2A 5EILA 4FLHA 3IXEA 2DIWA 5BT1A 3D9OA 2WXPA 2ETCA 2NSZA 4I1AA 4ZHBA 5IY5E 3CHMA 3IV0A 4HLLA 2YINA 4G24A 3LXUX 3LY8A 4LNUD 1SZ9A 4E6HA 1MX6A 4J8SA 4JA7A 2NYJA 1N9AA 3MKRA 3ABKE 4FLBA 4H7XA 3RJVA 3UIOC 4GZ3A 1FT1A 4UWLA 4U07A 4FHKA 4BEPA 3MKQB 5JJ6A 3CVVA 2J9QA 2CFUA 1QQEA 5D2MC 1BI7B 1QZ2A 5BV1A 4Y6CA 3TJPA 1A5EA 4ACLA 1UJJA 5E75A 4LERA 3ZVVA 5CERB 4B94A 2GROB 2E0IA 4WNEA 2LSVA 2XPIA 3FUKA 3L08A 3B95A 3FH5A 1S0PA 2IOSA 4GZ6A 4RQIA 1HU3A 3B13A 4DUIA 4EZKA 4GTQA 1TJFA 2WM9A 3SBTB 4AIFA 1TNZA 2KM4A 4DI3A 2JLBA 3KSLA 2VJ8A 3W9GA 2KCKA 5EX0A 4MS6A 2L6BA 2F8YA 1TN8A 1MQSA 4HS2A 5FZSA 1K1AA 4DX1A 5A23A 2WXHA 5JA4D 4FP7A 1MX2A 3UM3A 5KJMA 3ZYQA 3BEEA 5G04J 5ANRA 4GPKA 3VLDA 1UJKA 1HG2A 2F8XK 2L9BA 2IEJA 3LPZA 2KBXA 4ANVA 3FTVA 2VTBB 2R03A 1RW2A 4RLYA 1ELWA 3Q5MA 4BWRA 3RRNB 3UXGA 1SZAA 5B1BE 5BXUA 2DZOA 2AWIA 5AQ9A 4B0ZA 3UT4A 1VDYA 3APCA 4CGWA 3ESKA 4JPSA 5D0OD 1U2VG 2VSNA 4ANXA 3RSEG 4GMLA 5BXOA 2VGEA 3EHQA 4L23A 3V31A 4JHKA 4U0ZA 2DWZA 1O1TA 3NAWA 3IHVA 3D9IA 2GGFA 3PE3A 2V4LA 5ANLA 3Q79A 3TWSA 1D8DA 4GYWA 4HORA 3DXMG 5ENOD 2GRNB 4GZ5A 3MZLB 1MJ0A 3L82A 3C3RA 3SO8A 3LY9A 4FU3A 5BPPA 3L9TA 1HF8A 3L17A 4BSXA 4KYOB 3ULYA 2GRLA 3Q7FA 3LJ3A 3FTUA 3ZHEA 2J08A 1TNOA 3KAEA 3G2UA 4V3IA 4DLQA 3PNLB 4L1BA 3ZFWA 5ITZF 3URZA 4O6FA 3ULEG 1HX8A 4ZFHA 1JCRA 2HO1A 1E7UA 5ENSD 4XI9A 4B8AA 2MRIA 2PM7A 1Y8MA 1W3BA 2WXFA 4BT9A 2WB2A 3CVUA 5G05J 1ZBPA 1EPUA 5DBKA 1Z6TA 2C0LA 3FH8A 2MYOA 3D9KA 4CYMD 2M63A 3U9WA 3ZKJA 3IBEA 3OTNA 3NBNB 2A4ZA 5FQ6A 3EHMA 4O60A 3NOGD 3PUJA 3BG0B 2WXJA 4GTVA 1OCRE 5AYWD 1JWFA 3LCAA 4Q69A 1A17A 3TGOA 3EHNA 4K0RA 4U7EB 3SF4A 1WDYA 1NFIE 4HQDA 2X6JA 4RSYA 2YHCA 2FO7A 1V55E 3RAUA 5CCLA 2FEZA 1XNFA 1O5MA 4J8DA 3HRAA 1MYOA 3ABME 3UUXA 3SNXA 4F3VA 2C2LA 4NRHB 1YYHA 4I2ZA 3E33A 2CG2A 2VSYA 2WXOA 4EBAG 3MV2B 3AS8A 3CV0A 4BT8A 3SHFA 4J7WA 3GZ2A 4LNBA 3MX3A 3RU0A 3UINC 1YMPA 1H0AA 3AAAC 4UUCA 4PUCA 4D10C 5AQBA 3L54A 5T4YA 2PQRA 2EILE 4YVQC 1DC2A 4O1PA 3MCXA 4HVBA 5CBOA 3CVNA 3QOUA 4EECA 2IQCA 4L9PA 4K5BA 4JA9A 1KZOA 2IY0C 1N4PA 3U64A 3UKUG 2WXKA 4AY5A 1IHGA 4U0UA 3ZU7B 3UT7A 3G2TA 1N0RA 1N4QA 2PZIA 1N94A 1IYGA 3MA5A 2EIJE 3HXFA 4AP2A 3CK9A 1BD8A 2E2EA 4DX7D 1IQRA 2WXQA 2L6JA 2BKGA 4AOFA 2I2OA 3PREA 3QJZA 2XEEA 1EDUA 3CHQA 4K03A 3T8KA 2QFCA 4UI9J 5BV0A 1H19A 1SQMA 5JHBA 4XZ4A 4BETA 4NQ0A 2ZISA 2XRYA 3JQ1A 3KSQA 3HDXA 3ASFA 2DYSE 3QWVA 3UIPC 1X81A 3ZPJA 5HS0A 4HOTA 4GMRA 2HR2A 3O4ZA 3CVQA 2NC9A 3NB2A 3ZGQA 3D9HA 2DYRE 3QK0A 4GCNA 1BI8B 4WWNA 3KEAA 3VTXA 5JJTA 1O1RA 4HOUA 1H2TC 1OCZE 4JB8P 3DWLG 3V2XA 4DX5D 3AS5A 4CDRA 2J07A 3ZN3A 2J09A 4I43A 4ABNA 4Q94A 4YDWA 1TR4A 5ARGA 4J0UA 3DSWA 3D3MA 2BEDA 3HXDA 4BFRA 5G04C 3FU0A 5CEAA 3U4TA 4ANWA 4CGVA 4B93B 1N4RA 2CHZA 3FU5A 1HFAA 3L16A 3JCKC 3VLFA 4DLOA 4DK5A 1QBQA 4F7AA 1V54E 3E34A 3FEXA 3FUIA 5AARA 2EIME 4C0EA 1OWMA 2B0OE 5EYLA 3TAXA 3HG0D 3PUKA 3ESLA 4NACA 3CQGB 5BNWA 1QYMA 3B7SA 4EZLA 3E4BA 2CFZA 5CMWA 1PC2A 4BSZB 2HE0A 3J5QB 4CZ2D 5ARFA 4HI8A 4ILGA 4DX2A 2PQNA 4N3AA 5A7DB 4CT4A 3ZYLA 3F6QA 3JUIA 3FP3A 5D0QD 2DZNA 3FUEA 2X6IA 4I6EA 3T8MA 1N4SA 4JL0A 3SBSA 2ZIRA 5H7PA 3S2AA 2KZTA 2OV8A 3FUJA 1HE8A 1JUQA 2F37A 3PZ1A 1KT1A 3R7QA 4WWOA 4APFA 4JEUA 3HVEA 3UMVA 4G23A 5FQ8A 4MLPA 4TUUA 1IQUA 3CKBA 3ABLE 2C0MA 1U3DA 2RG8A 4UQYA 2WQ6A 4YNDA 3S7JA 5G05C 3JYSA 4LSZE 3DSTA 1KT0A 4XIFA 2RD0A 5ENRD 4BX9A 4N3BA 1UG3A 5KJNA 4XEIG 3C72A 2YNQA 3I4RB 2BF0X 1FCHA 2ZXWE 4X8QA 2ILRA 1DCEA 4QQIA 4W9RA 2WXMA 5AQAA 1MHQA 2OOEA 1HXIA 2P9KG 2VGXA 3VLEA 1TNBA 4GTOA 3T5VA 4DI4A 1P5QA 3QWWA 3ZHEB 3ZUVB 3AJIA 5JMND 2H6GA 3B7UX 3PVLA 2AJAA 1B89A 1E8ZA 1UOHA 2KCVA 3EJNA 5EIDA 5FIOA 4JEHA 4MKTA 3D9JA 4M3OA 2LNIA 3PS6A 4A1SA 2FBNA 3W9FA 2OVBA 3I3NA 4HXIA 2GRMA 3E37A 2XRZA 4F53A 2J4DA 4HRNA 1KLXA 1XGWA 2Y3AA 4A55A 4C0MA 3ASHA 3NOCD 3ZXPA 2R59A 3OAWA 4N3CA 1DCQA 1EYHA 2P9UG 5LOZA 4DRXE 3CHRA 3U3WA 3MKQA 3QB2A 2Y1LE 4EQFA 3D9PA 4UWKA 4TV3A 3FUNA 2NXPA 3E30A 3HXBA 1H2UA 2ETAA 3AG1E 2Y69E 4Y6WA 3QARA 3TG4A 4BX8A 4U8YD 2AXUA 3DBSA 2F0YA 3ZEFA 5EIBE 3RK6A 4NIKA 2V5QC 3AG4E 5KJLA 3DXKG 2IONA 4R7LA 3B7TA 2XPZA 3CVLA 2MHKA 3CVWA 4GTMA 2GRPB 1O1SA 4JW1A 3E32A 2I9CA 1E8XA 3LVRE 4I9CA 3Q47B 4A3VA 5AQ7A 2XGMA 3QDNA 2ZGGA 3TWTA 4N2QA 3DEOA 4DPRA 2WXLA 3QNKA 5DIZA 4P29A 1PY1A 1GW6A 3CLJA 3LDZA 2OCCE 2IO3C 4DJAA 3ASNE 2ZGDA 3TWUA 2P9PG 1OWNA 4MRUA 3DSUA 3GZ1A 5KBAA 1Q2ZA 1U3CA 3K9IA 4GTTA 2I1JA 3RRUA 3SFYA 1K8KG 1N54A 1OWLA 2GRQB 5C2YA 3AU4A 2Y4TA 2OEWA 3NZUA 3FHEA 1FT2A 1OWOA 4YDEA 3SFXA 2XS1A 3WG7E 2A5EA 1LF8A 3FTWA 4UWGA 3QWPA 5KCMA 2VQ2A 3ML9A 3KD7A 1TYQG 4IRUA 2HYZA 2BUGA 3JUEA 3ZIMA 5AJLA 4F1SA 1OWPA 3PNTB 4I1OB 5G2NA 4YDYA 3ONKA 3DSXA 1FPPA 4TRQA 2EINE 4GTRA 3RRMB 1X5BA 4HRLA 4L2LA 2VYIA 4O1OA 4A63B 4I2WA 4G2VA 1S70B 2BKKB 5EN5D 4GYOA 4GU5A 2V0PA 2HM8A 4F6RD 3JXIA 2LSUA 1PAQA 2FULA 3X2QE 2V5FA 1FVFA 3PEUB 2R05A 3V30A 1TNUA 3G2SA 4GZCA 4B8CB 2IOLA 4GZDA 4DX6D 1TN6A 5AIJA 3FY4A 3CHPA 4KVMA 3ISMC 2WQ7A 3RKVA 4HI9A 3ZYKA 3J5PA 4NURA 4AXHA 2QY7A 5HI7A 2CHWA 1LTXA 3S7FA 4M7CA 4ILIA 5FZQA 3SQVA 4HOSA 4WNGA 2UY1B 4U63A 3UTMA 3FTZA 3KS2A 3FUDA 5LX8A 2FO1E 5BUZA 2LAIA 1TN7A 4IULA 2IU1A 2VSXE 4UWFA 3HYMB 4XKBA 2XEVA 3EIJA 5LFAA 4Q96A 5A6CA 4RVBA 1BPOA 1UN8A 2JEKA 5ENPD 3TWRA 3SFZA 3Q7AA 3MYVA 3LJNA 2PL2A 4JHRA 4OYSA 2ZU6B 4TXPA 2WXIA 1JCQA 1YA0A 5FWQA 5B3SE 3ZYMA 3I4GA 3IKOB 4OVUA 3FTXA 2LXMA 2FF4A 3SI5A 2X6FA 3HVEB 2AW6A 3BG1B 2JABA 3RO3A 2WVIA 3TXNA 5D66A 4GA0A 3BUAA 1NZNA 3FU3A 1S64A 4U8VD 4CEMA 1L5JA 4HBDA 2RKKA 1S63A 1SW6A 2L0TB 4YDOA 5AN8A 1HG5A 5KWDA 5LP0A 3HXEA 2I6HA 2V8SE 2VGYA 4J6IA 3QAQA 3ZRHA 4CT0A 4WNFA 3WXXA 3GW4A 4K5AB 4WNDA 2LXLA 4EHMA 3Q9UC 2GRRB 3P1UA 1NI1A 1Y6IA 2KC7A 4E85A 1JWGA 4RG6A 4QFVA 3V79K 2YHEA 3CSTA 5AAOA 4PDXA 3BQOA 3I5PA 3CK8A 2QC9A 4GTPA 2R5SA 1LD8A 4BTAA 5EX3A 1WY6A 3SY2A 4L2YA 3FTYA 1E8WA 4IYPA 1E7VA 2X6KA 3LVQE 4N5QA 1ZB1A 3EIQC 4C9BB 4N2SA 5FTPA 3CIAA 4U95D 4G8KA 3C3QA 4J8EA 1Z3YA 3SZ7A 3UPVA 2PNNA 4G8LA 2B6CA 2WPVA 4APOA 3LS8A 3FDHA 3PZ3A 4A3TA 5FQ4A 2QYJA 3DPYA 1UN9A 2WXRA 1H6OA 5C1DA 2OVFA 2IO2C 4G11A 4JXTA 2KATA 5EKQD 4LRZA 4LNGA 2LO6A 4UQZA 2XHEA 5T3RA 3APDA 3DRAA 2AVPA 3ONLA 4ATZD 3CVPA 4JC8A 2YQ8A 2P2CP 1AP7A 1NA0A 3HHMA 5FT9A 4GA1A 4HFGA 3EU9A 2DBAA 3B7RL 5LCWJ 4U0SA 1JCSA 3C5RA 3CGHA 1BU9A 1DVPA 2XENA 3S7DA 2ETBA 1ELKA 1WAO1 5CECB 1N11A 4HOQA 4PS7A 3LKUA 1TJCA 2GW1A 3Q49B 2IJGX 3CK7A 3UM1A 1QNFA 2L0IA 2DVWA 3C3OA 1E96B 3CQCB 2FI7A 1TNYA 3PH0C 3NQPA 3FULA 2EQXA 3CSFA 2XPYA 3Q15A 4BTBA 1E90A 4GYYA 3QC1A 3DSVA 4PH4B 4KXKB 2WMOA 4XX5A 4JZYA 2BTDA 3APFA 3TWQA 1IKND 4FJYA 3Q78A 3SD5A 3UQ3A 4KBQA 2I1KA 5HKPA 3MEKA 1KPSB 1SA5A 4URKA 4N5CA 4PS8A 4WUYA 4OVVA 4CRWA 5J08A 4AV7A 4LUNU 5G55A 4A1GA 4GAAA 2AXZA 4PS3A 4JHJA 1E8YA 1ELRA 4U04A 3CR3A 4G1TA 3ZXSA 2WQHA 3FFLA 3JXJA 1K3ZD 2LUHA 3D9LA 2J8SD 4GB9A 3D9MA 3ASOE 3IEGA 1DNPA 1NL4A 1H6KA 4CCAA 4FADA 3LYAA 2R2LA 5M72A 4AJWA 3Q75A 3HXCA 3ENEA 1N0QA 4GCOA 1RZ4A 3G2VA 2Y0BG 2XZTG 3L22A 4JVSA 1FVHA 5FINA 5CRVA 4GTSA 4EPZA 4XE0A 5AJDA 4OAVB 5AENA 2X3MA 1G3NB 3LY7A 2AXVA 3CEQA 3UT8A 4LEUA 4UI9C 4XI0A 3TWWA 4U8HA 5KNGA 4I9EA 2QYUA 2RFMA 2P9IG 3DPDA 3UI2A 4KZ0A 3ZNGA 2P9NG 3MJWA 3EDTB 3QKYA 1WM5A 2MOWA 3TWXA 5ENQD 3DEPA 4U96D 3D9NA 4TXRA 2XQ0A 4J8YA 4BESA 5FQ7A 3CVXA 3TXMA 3PRZA 2X6HA 1AWCB 1Z3XA 5B1AE 3UX4A 1D8EA 5FZRA 3FTSA 3ML8A 2VTBA 1SA4A 3NZSA 3Q4AB 4OAUC 3ASGA 1N95A 2J49A 4UWHA 3GYZA 4C48B 2R17C 1NP7A 1H6PA 4AVXA 2VSOE 2WXNA 3UM2A 5FJYA 3VTYA 4UI9K 3FUHA 3V2OA 5HRYA 2X38A 4I17A 3P2BA 4B89A 2UWJG 3IHYA 2H6HA 4H7YA 4L7TA 5CHEE 2P9LG 4KVOA 3CVYA 4G26A 1OUVA 3N71A 1IHBA 4HRMB 1K1BA 4MBGA 2V4HC 5CEDB 3UM0A 4GPMA 4TXQA 1IXVA 1OCOE 2LAHA 3FUMA 3AU5A 3MV3B 3MGBA 1N52A 3R9MA 3FU6A 4FHJA 4I1MA 2OEVA 3U66A 5BW8C 3BU8A 4BY6A 3PDNA 1OT8A 1HH8A 3T5XA 4ATGA 3PZ4A 3CHSA 4FC8A 3R9AB 1HO8A 3FUFA 5KNHD 3L6AA 4LG6A 4WAFA 2XGSA 1HS6A 4FJZA 1H2VC 4N39A 3TL5A 1BLXB 3O48A 2Q7FA 4GMJA 2QZAA 3AS4A 3Q73A 2J4BA 1EF1C 4IN3B 2CHXA 3B7BA 2A5UA 1NA3A 5ENNA 4AM9A 1SVXA 3UKRG 4G25A 4EBAA 1OY3D 2WMNA 5CMYA 4TUMA 3EHRA 1LD7A 1OCCE 3TWVA 5JHAA 1ZU2A 2EIKE 4ILHB 4HNAD 4KZCA 2CG3A 5JJ7A 5LCWC 3R7RA 1JPLA 5CBNA 3ZW3A 2Y4UA 4I6GA 4CDNA 4F1PA 1MZCA 3EUVA 4AY6A 2IF4A 3OXFA 4FA6A 4UQXA 3PZ2A 4YVOA 2KZTB 5HQ8A 3PE4A 3HIZA 3ULQA 3OXLA 3G2WA 4KT6B 3DSSA 2RFAA 5EYPF 3RO2A 5T8IA 4EZJA 4LCTA 2XEHA 3FWVA 1WG0A 1UW4B 3SGHA 1Z5SC 3GZSA 4FULA 2XS8A 3CKCA 3PEVB 4HB5A 4BERA 5J90A 4ACKA 4ANUA 3T9KA 2DCPA 2R02A 2ONDA 2PM6A 2KXPC 3AG3E 3JQ0A 5CCMA 3FH7A 1TEZA 4WWPA 2XZDG
chains in the Genus database with same CATH topology
5AQBA 1UOHA 1OY3D 5AQ9A 5EIDA 5ENPD 1S70B 5FIOA 2BKKB 5FINA 3TWRA 3V2OA 1A5EA 1DC2A 4O1PA 5HRYA 5EN5D 2DVWA 4N5QA 4TUMA 5CBOA 3LJNA 1D9SA 1YCSB 5CERB 5AQ7A 2ZGGA 4YDWA 1TR4A 3EHRA 4K5BA 3TWTA 4F6RD 2F37A 3DEOA 2MYOA 3JXIA 5BXOA 2VGEA 3EHQA 4U95D 3TWVA 3V31A 3W9FA 4G8KA 4CYMD 4HNAD 4OAVB 2DWZA 1IHBA 4HRMB 3ZKJA 1K1BA 2V4HC 1G3NB 5CEDB 2PNNA 3ZU7B 4G8LA 3B95A 1N0RA 5CEAA 3NBNB 4GPMA 1IXVA 3TWWA 3V30A 5CBNA 1MX4A 2ZGDA 3TWUA 4O60A 3NOGD 1BD8A 5KNGA 4B93B 3Q9NC 4HRNA 4K5CA 4DX6D 2RFMA 3TWSA 2QYJA 3TWQA 4F1PA 1IKND 4DX7D 2JABA 4DUIA 5KBAA 5ENTD 5ENOD 3UI2A 3NOCD 5D66A 2BKGA 4Z68A 3ZNGA 1DCQA 2XEEA 5AARA 1MJ0A 4DRXE 1OT8A 4HI9A 2RFAA 5EILA 1WDYA 5HKPA 5BXUA 3J5PA 4LSZE 3IXEA 3TWXA 2B0OE 5EYLA 3T8KA 1NFIE 4HQDA 4U8VD 5ENQD 3DEPA 4U96D 2Y1LE 5EYPF 3W9GA 4HBDA 2ETCA 3HG0D 3SO8A 4ZHBA 2L6BA 2F8YA 1SW6A 4J8YA 4ATZD 2A5EA 4BETA 5AN8A 5ENRD 5KWDA 2XEHA 4BESA 1QYMA 4HLLA 5KNHD 2P2CP 1AP7A 1K1AA 1WG0A 4DX1A 4LNUD 4DX5D 4LG6A 1MX6A 3HRAA 1MYOA 1AWCB 2ETAA 3UTMA 5JA4D 4BSZB 2HE0A 3EU9A 3J5QB 2NYJA 3JXJA 1K3ZD 1MX2A 4U8YD 2J8SD 5HS0A 4GMRA 4CZ2D 3JUEA 1BLXB 2FO1E 1YYHA 4QQIA 4K5AB 3Q9UC 3C5RA 4HI8A 4HB5A 5AQAA 4BERA 1BU9A 2XENA 5EIBE 4DX2A 2ETBA 3T9KA 4OAUC 4NIKA 4J7WA 3D9HA 2F8XK 4QFVA 5CECB 4BEPA 4YDYA 2KBXA 5ITZF 3V79K 2V5QC 1BI8B 4ZFHA 5AAOA 1N11A 2KXPC 3ZUVB 1N0QA 3AJIA 5JMND 4C48B 3KEAA 1YMPA 3B7BA 3F6QA 5ENSD 2QC9A 4RLYA 4HRLA 3AAAC 1SVXA 2AJAA 2DZNA 4O1OA 1BI7B 2XZTG 2Y0BG 4UUCA 3UXGA 4A63B 4JB8P 2XZDG 2DZOA 3V2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQB A;  1UOH A;  1OY3 D;  5AQ9 A;  5EID A;  5ENP D;  1S70 B;  5FIO A;  2BKK B;  5FIN A;  3TWR A;  3V2O A;  1A5E A;  1DC2 A;  4O1P A;  5HRY A;  5EN5 D;  2DVW A;  4N5Q A;  4TUM A;  5CBO A;  3LJN A;  1D9S A;  1YCS B;  5CER B;  5AQ7 A;  2ZGG A;  4YDW A;  1TR4 A;  3EHR A;  4K5B A;  3TWT A;  4F6R D;  2F37 A;  3DEO A;  2MYO A;  3JXI A;  5BXO A;  2VGE A;  3EHQ A;  4U95 D;  3TWV A;  3V31 A;  3W9F A;  4G8K A;  4CYM D;  4HNA D;  4OAV B;  2DWZ A;  1IHB A;  4HRM B;  3ZKJ A;  1K1B A;  2V4H C;  1G3N B;  5CED B;  2PNN A;  3ZU7 B;  4G8L A;  3B95 A;  1N0R A;  5CEA A;  3NBN B;  4GPM A;  1IXV A;  3TWW A;  3V30 A;  5CBN A;  1MX4 A;  2ZGD A;  3TWU A;  4O60 A;  3NOG D;  1BD8 A;  5KNG A;  4B93 B;  3Q9N C;  4HRN A;  4K5C A;  4DX6 D;  2RFM A;  3TWS A;  2QYJ A;  3TWQ A;  4F1P A;  1IKN D;  4DX7 D;  2JAB A;  4DUI A;  5KBA A;  5ENT D;  5ENO D;  3UI2 A;  3NOC D;  5D66 A;  2BKG A;  4Z68 A;  3ZNG A;  1DCQ A;  2XEE A;  5AAR A;  1MJ0 A;  4DRX E;  1OT8 A;  4HI9 A;  2RFA A;  5EIL A;  1WDY A;  5HKP A;  5BXU A;  3J5P A;  4LSZ E;  3IXE A;  3TWX A;  2B0O E;  5EYL A;  3T8K A;  1NFI E;  4HQD A;  4U8V D;  5ENQ D;  3DEP A;  4U96 D;  2Y1L E;  5EYP F;  3W9G A;  4HBD A;  2ETC A;  3HG0 D;  3SO8 A;  4ZHB A;  2L6B A;  2F8Y A;  1SW6 A;  4J8Y A;  4ATZ D;  2A5E A;  4BET A;  5AN8 A;  5ENR D;  5KWD A;  2XEH A;  4BES A;  1QYM A;  4HLL A;  5KNH D;  2P2C P;  1AP7 A;  1K1A A;  1WG0 A;  4DX1 A;  4LNU D;  4DX5 D;  4LG6 A;  1MX6 A;  3HRA A;  1MYO A;  1AWC B;  2ETA A;  3UTM A;  5JA4 D;  4BSZ B;  2HE0 A;  3EU9 A;  3J5Q B;  2NYJ A;  3JXJ A;  1K3Z D;  1MX2 A;  4U8Y D;  2J8S D;  5HS0 A;  4GMR A;  4CZ2 D;  3JUE A;  1BLX B;  2FO1 E;  1YYH A;  4QQI A;  4K5A B;  3Q9U C;  3C5R A;  4HI8 A;  4HB5 A;  5AQA A;  4BER A;  1BU9 A;  2XEN A;  5EIB E;  4DX2 A;  2ETB A;  3T9K A;  4OAU C;  4NIK A;  4J7W A;  3D9H A;  2F8X K;  4QFV A;  5CEC B;  4BEP A;  4YDY A;  2KBX A;  5ITZ F;  3V79 K;  2V5Q C;  1BI8 B;  4ZFH A;  5AAO A;  1N11 A;  2KXP C;  3ZUV B;  1N0Q A;  3AJI A;  5JMN D;  4C48 B;  3KEA A;  1YMP A;  3B7B A;  3F6Q A;  5ENS D;  2QC9 A;  4RLY A;  4HRL A;  3AAA C;  1SVX A;  2AJA A;  2DZN A;  4O1O A;  1BI7 B;  2XZT G;  2Y0B G;  4UUC A;  3UXG A;  4A63 B;  4JB8 P;  2XZD G;  2DZO A;  3V2X A; 
#chains in the Genus database with same CATH topology
 2WXG A;  1INZ A;  3OXG A;  1OXJ A;  3C98 A;  2XCC A;  3EU5 A;  2KCL A;  3TG5 A;  1HZ4 A;  1D9S A;  4ME2 A;  3NF1 A;  1YCS B;  3CHO A;  3AG2 E;  3S7B A;  3PZD A;  2XGO A;  2VGX B;  4RG9 A;  1KZP A;  2H6F A;  2H6I A;  4CDM A;  3L13 A;  5E76 A;  4KMO A;  2XCB A;  1MX4 A;  2UY1 A;  2P58 C;  3Q9N C;  4K5C A;  4HLE A;  3LEW A;  4I6J A;  3KEZ A;  5CRU A;  2P9S G;  2IFU A;  3RIB A;  4XKC A;  5ENT D;  3FEY A;  4AEZ C;  4Z68 A;  5KJK A;  4JD2 G;  3ASD A;  4J8F A;  5EDS A;  4GA2 A;  5EIL A;  4FLH A;  3IXE A;  2DIW A;  5BT1 A;  3D9O A;  2WXP A;  2ETC A;  2NSZ A;  4I1A A;  4ZHB A;  5IY5 E;  3CHM A;  3IV0 A;  4HLL A;  2YIN A;  4G24 A;  3LXU X;  3LY8 A;  4LNU D;  1SZ9 A;  4E6H A;  1MX6 A;  4J8S A;  4JA7 A;  2NYJ A;  1N9A A;  3MKR A;  3ABK E;  4FLB A;  4H7X A;  3RJV A;  3UIO C;  4GZ3 A;  1FT1 A;  4UWL A;  4U07 A;  4FHK A;  4BEP A;  3MKQ B;  5JJ6 A;  3CVV A;  2J9Q A;  2CFU A;  1QQE A;  5D2M C;  1BI7 B;  1QZ2 A;  5BV1 A;  4Y6C A;  3TJP A;  1A5E A;  4ACL A;  1UJJ A;  5E75 A;  4LER A;  3ZVV A;  5CER B;  4B94 A;  2GRO B;  2E0I A;  4WNE A;  2LSV A;  2XPI A;  3FUK A;  3L08 A;  3B95 A;  3FH5 A;  1S0P A;  2IOS A;  4GZ6 A;  4RQI A;  1HU3 A;  3B13 A;  4DUI A;  4EZK A;  4GTQ A;  1TJF A;  2WM9 A;  3SBT B;  4AIF A;  1TNZ A;  2KM4 A;  4DI3 A;  2JLB A;  3KSL A;  2VJ8 A;  3W9G A;  2KCK A;  5EX0 A;  4MS6 A;  2L6B A;  2F8Y A;  1TN8 A;  1MQS A;  4HS2 A;  5FZS A;  1K1A A;  4DX1 A;  5A23 A;  2WXH A;  5JA4 D;  4FP7 A;  1MX2 A;  3UM3 A;  5KJM A;  3ZYQ A;  3BEE A;  5G04 J;  5ANR A;  4GPK A;  3VLD A;  1UJK A;  1HG2 A;  2F8X K;  2L9B A;  2IEJ A;  3LPZ A;  2KBX A;  4ANV A;  3FTV A;  2VTB B;  2R03 A;  1RW2 A;  4RLY A;  1ELW A;  3Q5M A;  4BWR A;  3RRN B;  3UXG A;  1SZA A;  5B1B E;  5BXU A;  2DZO A;  2AWI A;  5AQ9 A;  4B0Z A;  3UT4 A;  1VDY A;  3APC A;  4CGW A;  3ESK A;  4JPS A;  5D0O D;  1U2V G;  2VSN A;  4ANX A;  3RSE G;  4GML A;  5BXO A;  2VGE A;  3EHQ A;  4L23 A;  3V31 A;  4JHK A;  4U0Z A;  2DWZ A;  1O1T A;  3NAW A;  3IHV A;  3D9I A;  2GGF A;  3PE3 A;  2V4L A;  5ANL A;  3Q79 A;  3TWS A;  1D8D A;  4GYW A;  4HOR A;  3DXM G;  5ENO D;  2GRN B;  4GZ5 A;  3MZL B;  1MJ0 A;  3L82 A;  3C3R A;  3SO8 A;  3LY9 A;  4FU3 A;  5BPP A;  3L9T A;  1HF8 A;  3L17 A;  4BSX A;  4KYO B;  3ULY A;  2GRL A;  3Q7F A;  3LJ3 A;  3FTU A;  3ZHE A;  2J08 A;  1TNO A;  3KAE A;  3G2U A;  4V3I A;  4DLQ A;  3PNL B;  4L1B A;  3ZFW A;  5ITZ F;  3URZ A;  4O6F A;  3ULE G;  1HX8 A;  4ZFH A;  1JCR A;  2HO1 A;  1E7U A;  5ENS D;  4XI9 A;  4B8A A;  2MRI A;  2PM7 A;  1Y8M A;  1W3B A;  2WXF A;  4BT9 A;  2WB2 A;  3CVU A;  5G05 J;  1ZBP A;  1EPU A;  5DBK A;  1Z6T A;  2C0L A;  3FH8 A;  2MYO A;  3D9K A;  4CYM D;  2M63 A;  3U9W A;  3ZKJ A;  3IBE A;  3OTN A;  3NBN B;  2A4Z A;  5FQ6 A;  3EHM A;  4O60 A;  3NOG D;  3PUJ A;  3BG0 B;  2WXJ A;  4GTV A;  1OCR E;  5AYW D;  1JWF A;  3LCA A;  4Q69 A;  1A17 A;  3TGO A;  3EHN A;  4K0R A;  4U7E B;  3SF4 A;  1WDY A;  1NFI E;  4HQD A;  2X6J A;  4RSY A;  2YHC A;  2FO7 A;  1V55 E;  3RAU A;  5CCL A;  2FEZ A;  1XNF A;  1O5M A;  4J8D A;  3HRA A;  1MYO A;  3ABM E;  3UUX A;  3SNX A;  4F3V A;  2C2L A;  4NRH B;  1YYH A;  4I2Z A;  3E33 A;  2CG2 A;  2VSY A;  2WXO A;  4EBA G;  3MV2 B;  3AS8 A;  3CV0 A;  4BT8 A;  3SHF A;  4J7W A;  3GZ2 A;  4LNB A;  3MX3 A;  3RU0 A;  3UIN C;  1YMP A;  1H0A A;  3AAA C;  4UUC A;  4PUC A;  4D10 C;  5AQB A;  3L54 A;  5T4Y A;  2PQR A;  2EIL E;  4YVQ C;  1DC2 A;  4O1P A;  3MCX A;  4HVB A;  5CBO A;  3CVN A;  3QOU A;  4EEC A;  2IQC A;  4L9P A;  4K5B A;  4JA9 A;  1KZO A;  2IY0 C;  1N4P A;  3U64 A;  3UKU G;  2WXK A;  4AY5 A;  1IHG A;  4U0U A;  3ZU7 B;  3UT7 A;  3G2T A;  1N0R A;  1N4Q A;  2PZI A;  1N94 A;  1IYG A;  3MA5 A;  2EIJ E;  3HXF A;  4AP2 A;  3CK9 A;  1BD8 A;  2E2E A;  4DX7 D;  1IQR A;  2WXQ A;  2L6J A;  2BKG A;  4AOF A;  2I2O A;  3PRE A;  3QJZ A;  2XEE A;  1EDU A;  3CHQ A;  4K03 A;  3T8K A;  2QFC A;  4UI9 J;  5BV0 A;  1H19 A;  1SQM A;  5JHB A;  4XZ4 A;  4BET A;  4NQ0 A;  2ZIS A;  2XRY A;  3JQ1 A;  3KSQ A;  3HDX A;  3ASF A;  2DYS E;  3QWV A;  3UIP C;  1X81 A;  3ZPJ A;  5HS0 A;  4HOT A;  4GMR A;  2HR2 A;  3O4Z A;  3CVQ A;  2NC9 A;  3NB2 A;  3ZGQ A;  3D9H A;  2DYR E;  3QK0 A;  4GCN A;  1BI8 B;  4WWN A;  3KEA A;  3VTX A;  5JJT A;  1O1R A;  4HOU A;  1H2T C;  1OCZ E;  4JB8 P;  3DWL G;  3V2X A;  4DX5 D;  3AS5 A;  4CDR A;  2J07 A;  3ZN3 A;  2J09 A;  4I43 A;  4ABN A;  4Q94 A;  4YDW A;  1TR4 A;  5ARG A;  4J0U A;  3DSW A;  3D3M A;  2BED A;  3HXD A;  4BFR A;  5G04 C;  3FU0 A;  5CEA A;  3U4T A;  4ANW A;  4CGV A;  4B93 B;  1N4R A;  2CHZ A;  3FU5 A;  1HFA A;  3L16 A;  3JCK C;  3VLF A;  4DLO A;  4DK5 A;  1QBQ A;  4F7A A;  1V54 E;  3E34 A;  3FEX A;  3FUI A;  5AAR A;  2EIM E;  4C0E A;  1OWM A;  2B0O E;  5EYL A;  3TAX A;  3HG0 D;  3PUK A;  3ESL A;  4NAC A;  3CQG B;  5BNW A;  1QYM A;  3B7S A;  4EZL A;  3E4B A;  2CFZ A;  5CMW A;  1PC2 A;  4BSZ B;  2HE0 A;  3J5Q B;  4CZ2 D;  5ARF A;  4HI8 A;  4ILG A;  4DX2 A;  2PQN A;  4N3A A;  5A7D B;  4CT4 A;  3ZYL A;  3F6Q A;  3JUI A;  3FP3 A;  5D0Q D;  2DZN A;  3FUE A;  2X6I A;  4I6E A;  3T8M A;  1N4S A;  4JL0 A;  3SBS A;  2ZIR A;  5H7P A;  3S2A A;  2KZT A;  2OV8 A;  3FUJ A;  1HE8 A;  1JUQ A;  2F37 A;  3PZ1 A;  1KT1 A;  3R7Q A;  4WWO A;  4APF A;  4JEU A;  3HVE A;  3UMV A;  4G23 A;  5FQ8 A;  4MLP A;  4TUU A;  1IQU A;  3CKB A;  3ABL E;  2C0M A;  1U3D A;  2RG8 A;  4UQY A;  2WQ6 A;  4YND A;  3S7J A;  5G05 C;  3JYS A;  4LSZ E;  3DST A;  1KT0 A;  4XIF A;  2RD0 A;  5ENR D;  4BX9 A;  4N3B A;  1UG3 A;  5KJN A;  4XEI G;  3C72 A;  2YNQ A;  3I4R B;  2BF0 X;  1FCH A;  2ZXW E;  4X8Q A;  2ILR A;  1DCE A;  4QQI A;  4W9R A;  2WXM A;  5AQA A;  1MHQ A;  2OOE A;  1HXI A;  2P9K G;  2VGX A;  3VLE A;  1TNB A;  4GTO A;  3T5V A;  4DI4 A;  1P5Q A;  3QWW A;  3ZHE B;  3ZUV B;  3AJI A;  5JMN D;  2H6G A;  3B7U X;  3PVL A;  2AJA A;  1B89 A;  1E8Z A;  1UOH A;  2KCV A;  3EJN A;  5EID A;  5FIO A;  4JEH A;  4MKT A;  3D9J A;  4M3O A;  2LNI A;  3PS6 A;  4A1S A;  2FBN A;  3W9F A;  2OVB A;  3I3N A;  4HXI A;  2GRM A;  3E37 A;  2XRZ A;  4F53 A;  2J4D A;  4HRN A;  1KLX A;  1XGW A;  2Y3A A;  4A55 A;  4C0M A;  3ASH A;  3NOC D;  3ZXP A;  2R59 A;  3OAW A;  4N3C A;  1DCQ A;  1EYH A;  2P9U G;  5LOZ A;  4DRX E;  3CHR A;  3U3W A;  3MKQ A;  3QB2 A;  2Y1L E;  4EQF A;  3D9P A;  4UWK A;  4TV3 A;  3FUN A;  2NXP A;  3E30 A;  3HXB A;  1H2U A;  2ETA A;  3AG1 E;  2Y69 E;  4Y6W A;  3QAR A;  3TG4 A;  4BX8 A;  4U8Y D;  2AXU A;  3DBS A;  2F0Y A;  3ZEF A;  5EIB E;  3RK6 A;  4NIK A;  2V5Q C;  3AG4 E;  5KJL A;  3DXK G;  2ION A;  4R7L A;  3B7T A;  2XPZ A;  3CVL A;  2MHK A;  3CVW A;  4GTM A;  2GRP B;  1O1S A;  4JW1 A;  3E32 A;  2I9C A;  1E8X A;  3LVR E;  4I9C A;  3Q47 B;  4A3V A;  5AQ7 A;  2XGM A;  3QDN A;  2ZGG A;  3TWT A;  4N2Q A;  3DEO A;  4DPR A;  2WXL A;  3QNK A;  5DIZ A;  4P29 A;  1PY1 A;  1GW6 A;  3CLJ A;  3LDZ A;  2OCC E;  2IO3 C;  4DJA A;  3ASN E;  2ZGD A;  3TWU A;  2P9P G;  1OWN A;  4MRU A;  3DSU A;  3GZ1 A;  5KBA A;  1Q2Z A;  1U3C A;  3K9I A;  4GTT A;  2I1J A;  3RRU A;  3SFY A;  1K8K G;  1N54 A;  1OWL A;  2GRQ B;  5C2Y A;  3AU4 A;  2Y4T A;  2OEW A;  3NZU A;  3FHE A;  1FT2 A;  1OWO A;  4YDE A;  3SFX A;  2XS1 A;  3WG7 E;  2A5E A;  1LF8 A;  3FTW A;  4UWG A;  3QWP A;  5KCM A;  2VQ2 A;  3ML9 A;  3KD7 A;  1TYQ G;  4IRU A;  2HYZ A;  2BUG A;  3JUE A;  3ZIM A;  5AJL A;  4F1S A;  1OWP A;  3PNT B;  4I1O B;  5G2N A;  4YDY A;  3ONK A;  3DSX A;  1FPP A;  4TRQ A;  2EIN E;  4GTR A;  3RRM B;  1X5B A;  4HRL A;  4L2L A;  2VYI A;  4O1O A;  4A63 B;  4I2W A;  4G2V A;  1S70 B;  2BKK B;  5EN5 D;  4GYO A;  4GU5 A;  2V0P A;  2HM8 A;  4F6R D;  3JXI A;  2LSU A;  1PAQ A;  2FUL A;  3X2Q E;  2V5F A;  1FVF A;  3PEU B;  2R05 A;  3V30 A;  1TNU A;  3G2S A;  4GZC A;  4B8C B;  2IOL A;  4GZD A;  4DX6 D;  1TN6 A;  5AIJ A;  3FY4 A;  3CHP A;  4KVM A;  3ISM C;  2WQ7 A;  3RKV A;  4HI9 A;  3ZYK A;  3J5P A;  4NUR A;  4AXH A;  2QY7 A;  5HI7 A;  2CHW A;  1LTX A;  3S7F A;  4M7C A;  4ILI A;  5FZQ A;  3SQV A;  4HOS A;  4WNG A;  2UY1 B;  4U63 A;  3UTM A;  3FTZ A;  3KS2 A;  3FUD A;  5LX8 A;  2FO1 E;  5BUZ A;  2LAI A;  1TN7 A;  4IUL A;  2IU1 A;  2VSX E;  4UWF A;  3HYM B;  4XKB A;  2XEV A;  3EIJ A;  5LFA A;  4Q96 A;  5A6C A;  4RVB A;  1BPO A;  1UN8 A;  2JEK A;  5ENP D;  3TWR A;  3SFZ A;  3Q7A A;  3MYV A;  3LJN A;  2PL2 A;  4JHR A;  4OYS A;  2ZU6 B;  4TXP A;  2WXI A;  1JCQ A;  1YA0 A;  5FWQ A;  5B3S E;  3ZYM A;  3I4G A;  3IKO B;  4OVU A;  3FTX A;  2LXM A;  2FF4 A;  3SI5 A;  2X6F A;  3HVE B;  2AW6 A;  3BG1 B;  2JAB A;  3RO3 A;  2WVI A;  3TXN A;  5D66 A;  4GA0 A;  3BUA A;  1NZN A;  3FU3 A;  1S64 A;  4U8V D;  4CEM A;  1L5J A;  4HBD A;  2RKK A;  1S63 A;  1SW6 A;  2L0T B;  4YDO A;  5AN8 A;  1HG5 A;  5KWD A;  5LP0 A;  3HXE A;  2I6H A;  2V8S E;  2VGY A;  4J6I A;  3QAQ A;  3ZRH A;  4CT0 A;  4WNF A;  3WXX A;  3GW4 A;  4K5A B;  4WND A;  2LXL A;  4EHM A;  3Q9U C;  2GRR B;  3P1U A;  1NI1 A;  1Y6I A;  2KC7 A;  4E85 A;  1JWG A;  4RG6 A;  4QFV A;  3V79 K;  2YHE A;  3CST A;  5AAO A;  4PDX A;  3BQO A;  3I5P A;  3CK8 A;  2QC9 A;  4GTP A;  2R5S A;  1LD8 A;  4BTA A;  5EX3 A;  1WY6 A;  3SY2 A;  4L2Y A;  3FTY A;  1E8W A;  4IYP A;  1E7V A;  2X6K A;  3LVQ E;  4N5Q A;  1ZB1 A;  3EIQ C;  4C9B B;  4N2S A;  5FTP A;  3CIA A;  4U95 D;  4G8K A;  3C3Q A;  4J8E A;  1Z3Y A;  3SZ7 A;  3UPV A;  2PNN A;  4G8L A;  2B6C A;  2WPV A;  4APO A;  3LS8 A;  3FDH A;  3PZ3 A;  4A3T A;  5FQ4 A;  2QYJ A;  3DPY A;  1UN9 A;  2WXR A;  1H6O A;  5C1D A;  2OVF A;  2IO2 C;  4G11 A;  4JXT A;  2KAT A;  5EKQ D;  4LRZ A;  4LNG A;  2LO6 A;  4UQZ A;  2XHE A;  5T3R A;  3APD A;  3DRA A;  2AVP A;  3ONL A;  4ATZ D;  3CVP A;  4JC8 A;  2YQ8 A;  2P2C P;  1AP7 A;  1NA0 A;  3HHM A;  5FT9 A;  4GA1 A;  4HFG A;  3EU9 A;  2DBA A;  3B7R L;  5LCW J;  4U0S A;  1JCS A;  3C5R A;  3CGH A;  1BU9 A;  1DVP A;  2XEN A;  3S7D A;  2ETB A;  1ELK A;  1WAO 1;  5CEC B;  1N11 A;  4HOQ A;  4PS7 A;  3LKU A;  1TJC A;  2GW1 A;  3Q49 B;  2IJG X;  3CK7 A;  3UM1 A;  1QNF A;  2L0I A;  2DVW A;  3C3O A;  1E96 B;  3CQC B;  2FI7 A;  1TNY A;  3PH0 C;  3NQP A;  3FUL A;  2EQX A;  3CSF A;  2XPY A;  3Q15 A;  4BTB A;  1E90 A;  4GYY A;  3QC1 A;  3DSV A;  4PH4 B;  4KXK B;  2WMO A;  4XX5 A;  4JZY A;  2BTD A;  3APF A;  3TWQ A;  1IKN D;  4FJY A;  3Q78 A;  3SD5 A;  3UQ3 A;  4KBQ A;  2I1K A;  5HKP A;  3MEK A;  1KPS B;  1SA5 A;  4URK A;  4N5C A;  4PS8 A;  4WUY A;  4OVV A;  4CRW A;  5J08 A;  4AV7 A;  4LUN U;  5G55 A;  4A1G A;  4GAA A;  2AXZ A;  4PS3 A;  4JHJ A;  1E8Y A;  1ELR A;  4U04 A;  3CR3 A;  4G1T A;  3ZXS A;  2WQH A;  3FFL A;  3JXJ A;  1K3Z D;  2LUH A;  3D9L A;  2J8S D;  4GB9 A;  3D9M A;  3ASO E;  3IEG A;  1DNP A;  1NL4 A;  1H6K A;  4CCA A;  4FAD A;  3LYA A;  2R2L A;  5M72 A;  4AJW A;  3Q75 A;  3HXC A;  3ENE A;  1N0Q A;  4GCO A;  1RZ4 A;  3G2V A;  2Y0B G;  2XZT G;  3L22 A;  4JVS A;  1FVH A;  5FIN A;  5CRV A;  4GTS A;  4EPZ A;  4XE0 A;  5AJD A;  4OAV B;  5AEN A;  2X3M A;  1G3N B;  3LY7 A;  2AXV A;  3CEQ A;  3UT8 A;  4LEU A;  4UI9 C;  4XI0 A;  3TWW A;  4U8H A;  5KNG A;  4I9E A;  2QYU A;  2RFM A;  2P9I G;  3DPD A;  3UI2 A;  4KZ0 A;  3ZNG A;  2P9N G;  3MJW A;  3EDT B;  3QKY A;  1WM5 A;  2MOW A;  3TWX A;  5ENQ D;  3DEP A;  4U96 D;  3D9N A;  4TXR A;  2XQ0 A;  4J8Y A;  4BES A;  5FQ7 A;  3CVX A;  3TXM A;  3PRZ A;  2X6H A;  1AWC B;  1Z3X A;  5B1A E;  3UX4 A;  1D8E A;  5FZR A;  3FTS A;  3ML8 A;  2VTB A;  1SA4 A;  3NZS A;  3Q4A B;  4OAU C;  3ASG A;  1N95 A;  2J49 A;  4UWH A;  3GYZ A;  4C48 B;  2R17 C;  1NP7 A;  1H6P A;  4AVX A;  2VSO E;  2WXN A;  3UM2 A;  5FJY A;  3VTY A;  4UI9 K;  3FUH A;  3V2O A;  5HRY A;  2X38 A;  4I17 A;  3P2B A;  4B89 A;  2UWJ G;  3IHY A;  2H6H A;  4H7Y A;  4L7T A;  5CHE E;  2P9L G;  4KVO A;  3CVY A;  4G26 A;  1OUV A;  3N71 A;  1IHB A;  4HRM B;  1K1B A;  4MBG A;  2V4H C;  5CED B;  3UM0 A;  4GPM A;  4TXQ A;  1IXV A;  1OCO E;  2LAH A;  3FUM A;  3AU5 A;  3MV3 B;  3MGB A;  1N52 A;  3R9M A;  3FU6 A;  4FHJ A;  4I1M A;  2OEV A;  3U66 A;  5BW8 C;  3BU8 A;  4BY6 A;  3PDN A;  1OT8 A;  1HH8 A;  3T5X A;  4ATG A;  3PZ4 A;  3CHS A;  4FC8 A;  3R9A B;  1HO8 A;  3FUF A;  5KNH D;  3L6A A;  4LG6 A;  4WAF A;  2XGS A;  1HS6 A;  4FJZ A;  1H2V C;  4N39 A;  3TL5 A;  1BLX B;  3O48 A;  2Q7F A;  4GMJ A;  2QZA A;  3AS4 A;  3Q73 A;  2J4B A;  1EF1 C;  4IN3 B;  2CHX A;  3B7B A;  2A5U A;  1NA3 A;  5ENN A;  4AM9 A;  1SVX A;  3UKR G;  4G25 A;  4EBA A;  1OY3 D;  2WMN A;  5CMY A;  4TUM A;  3EHR A;  1LD7 A;  1OCC E;  3TWV A;  5JHA A;  1ZU2 A;  2EIK E;  4ILH B;  4HNA D;  4KZC A;  2CG3 A;  5JJ7 A;  5LCW C;  3R7R A;  1JPL A;  5CBN A;  3ZW3 A;  2Y4U A;  4I6G A;  4CDN A;  4F1P A;  1MZC A;  3EUV A;  4AY6 A;  2IF4 A;  3OXF A;  4FA6 A;  4UQX A;  3PZ2 A;  4YVO A;  2KZT B;  5HQ8 A;  3PE4 A;  3HIZ A;  3ULQ A;  3OXL A;  3G2W A;  4KT6 B;  3DSS A;  2RFA A;  5EYP F;  3RO2 A;  5T8I A;  4EZJ A;  4LCT A;  2XEH A;  3FWV A;  1WG0 A;  1UW4 B;  3SGH A;  1Z5S C;  3GZS A;  4FUL A;  2XS8 A;  3CKC A;  3PEV B;  4HB5 A;  4BER A;  5J90 A;  4ACK A;  4ANU A;  3T9K A;  2DCP A;  2R02 A;  2OND A;  2PM6 A;  2KXP C;  3AG3 E;  3JQ0 A;  5CCM A;  3FH7 A;  1TEZ A;  4WWP A;  2XZD G; 
#chains in the Genus database with same CATH homology
 5AQB A;  1UOH A;  1OY3 D;  5AQ9 A;  5EID A;  5ENP D;  1S70 B;  5FIO A;  2BKK B;  5FIN A;  3TWR A;  3V2O A;  1A5E A;  1DC2 A;  4O1P A;  5HRY A;  5EN5 D;  2DVW A;  4N5Q A;  4TUM A;  5CBO A;  3LJN A;  1D9S A;  1YCS B;  5CER B;  5AQ7 A;  2ZGG A;  4YDW A;  1TR4 A;  3EHR A;  4K5B A;  3TWT A;  4F6R D;  2F37 A;  3DEO A;  2MYO A;  3JXI A;  5BXO A;  2VGE A;  3EHQ A;  4U95 D;  3TWV A;  3V31 A;  3W9F A;  4G8K A;  4CYM D;  4HNA D;  4OAV B;  2DWZ A;  1IHB A;  4HRM B;  3ZKJ A;  1K1B A;  2V4H C;  1G3N B;  5CED B;  2PNN A;  3ZU7 B;  4G8L A;  3B95 A;  1N0R A;  5CEA A;  3NBN B;  4GPM A;  1IXV A;  3TWW A;  3V30 A;  5CBN A;  1MX4 A;  2ZGD A;  3TWU A;  4O60 A;  3NOG D;  1BD8 A;  5KNG A;  4B93 B;  3Q9N C;  4HRN A;  4K5C A;  4DX6 D;  2RFM A;  3TWS A;  2QYJ A;  3TWQ A;  4F1P A;  1IKN D;  4DX7 D;  2JAB A;  4DUI A;  5KBA A;  5ENT D;  5ENO D;  3UI2 A;  3NOC D;  5D66 A;  2BKG A;  4Z68 A;  3ZNG A;  1DCQ A;  2XEE A;  5AAR A;  1MJ0 A;  4DRX E;  1OT8 A;  4HI9 A;  2RFA A;  5EIL A;  1WDY A;  5HKP A;  5BXU A;  3J5P A;  4LSZ E;  3IXE A;  3TWX A;  2B0O E;  5EYL A;  3T8K A;  1NFI E;  4HQD A;  4U8V D;  5ENQ D;  3DEP A;  4U96 D;  2Y1L E;  5EYP F;  3W9G A;  4HBD A;  2ETC A;  3HG0 D;  3SO8 A;  4ZHB A;  2L6B A;  2F8Y A;  1SW6 A;  4J8Y A;  4ATZ D;  2A5E A;  4BET A;  5AN8 A;  5ENR D;  5KWD A;  2XEH A;  4BES A;  1QYM A;  4HLL A;  5KNH D;  2P2C P;  1AP7 A;  1K1A A;  1WG0 A;  4DX1 A;  4LNU D;  4DX5 D;  4LG6 A;  1MX6 A;  3HRA A;  1MYO A;  1AWC B;  2ETA A;  3UTM A;  5JA4 D;  4BSZ B;  2HE0 A;  3EU9 A;  3J5Q B;  2NYJ A;  3JXJ A;  1K3Z D;  1MX2 A;  4U8Y D;  2J8S D;  5HS0 A;  4GMR A;  4CZ2 D;  3JUE A;  1BLX B;  2FO1 E;  1YYH A;  4QQI A;  4K5A B;  3Q9U C;  3C5R A;  4HI8 A;  4HB5 A;  5AQA A;  4BER A;  1BU9 A;  2XEN A;  5EIB E;  4DX2 A;  2ETB A;  3T9K A;  4OAU C;  4NIK A;  4J7W A;  3D9H A;  2F8X K;  4QFV A;  5CEC B;  4BEP A;  4YDY A;  2KBX A;  5ITZ F;  3V79 K;  2V5Q C;  1BI8 B;  4ZFH A;  5AAO A;  1N11 A;  2KXP C;  3ZUV B;  1N0Q A;  3AJI A;  5JMN D;  4C48 B;  3KEA A;  1YMP A;  3B7B A;  3F6Q A;  5ENS D;  2QC9 A;  4RLY A;  4HRL A;  3AAA C;  1SVX A;  2AJA A;  2DZN A;  4O1O A;  1BI7 B;  2XZT G;  2Y0B G;  4UUC A;  3UXG A;  4A63 B;  4JB8 P;  2XZD G;  2DZO A;  3V2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...