4Z7UB

S13 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
188
structure length
169
Chain Sequence
DSPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPLLVCSVTDFYPAQIKVRWQEETTGVVSTPLIRNGDWTFQILVMLEMDVYTCHVEHPSLQNPIIVEWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class II HLA-DQ-alpha chain
publication title Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 169
sequence length 188
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7uB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4z7uB01
5H37H 4BKLB 1TPXB 1TJHH 2OTWA 3RJDA 1EO8H 2QSCL 1AP2B 4HF5L 4R0LA 4XPFH 4JB9H 1C5CL 1CTOA 2BX5A 3P9WB 5C07E 1DBKH 5JPNA 5FYKH 4PY7B 1P84J 2JIXB 4MA7H 1T03L 4OLYL 3F7YA 4EOWL 4WUUE 2AS5M 5JR1L 1MHCA 3H9SA 2XA8L 4IDJH 3PQYB 4GBXC 1CD0A 2IFFL 5E56A 3HPJA 4OLVL 1QSZA 4XWGH 1IARB 1ZA6A 1VB9A 4WFHE 5I74B 1N5AA 5LWYL 2PTTA 3EKCA 2XN9D 3QZWB 3TBYB 3MOQA 4WW2C 3U83A 2EXWC 4QTHA 4S2SA 3H9HB 3U0PA 4WW2B 4HIEB 3KYAA 12E8H 4WTZG 3WNKA 5DD0L 5TDNB 2IQ9L 4G8EA 1AGBB 4Z7UB 5D1QB 3QUYA 3NZHL 3SDDC 1QKZL 1QA9A 4JO2H 3TO2A 5E1AB 3O6LL 4M6MH 5KS9E 3BP7A 3MRRA 2ARJQ 1A7OL 2PYEB 5JOPE 1U8IB 4APQD 4YK4C 4K3EH 5KZCB 5EOTA 3E3QC 4Y19A 4P4KB 5JMRA 4JFXA 3I6KA 1MJ7L 5EPMB 3S35L 5D2LA 4N9GB 5TE7H 4Z7WF 3ARDD 3TF7C 5DD3L 1UKSA 4ENEC 2OTUA 1FL5A 1OTTD 2V2XB 3OKDB 3MZTA 1BWMA 3G5YB 3QA3B 4JANA 5J3HD 3CC5A 5IT2H 3ETBF 4KUCF 3P4OA 4BK5A 3P4MB 2IMMA 1ADQH 3T04D 3EAKA 4EUPA 1E4WH 3EJZC 4XVUD 3C6SB 5E2WH 4JDTL 2VZ1A 3VWJB 3V9FA 1P7KB 1RZ8A 3K8KA 1P9MC 2EE6A 5GGUB 5FYJD 4KKAD 3W2DL 4BH7B 5J06A 4ZOBA 1HQRA 3VH8A 1KJ3H 3C5ZC 5H37G 5BZWA 3C5ZB 3N9GL 4KROC 2V2WB 4XVTH 5FK9A 3OG4B 1YJDL 5D6DA 1MNUH 1AGCB 5FKAA 1A9BB 2W60B 3R0NA 1XCTA 2MSPA 1NCCL 4XP5L 5LBSH 1F6FB 3MUGB 5BQ7A 2KQMA 2P8LA 5CFHA 2AV7B 5HVHC 1SBSL 3RVTC 1MLBB 1QP1A 2XG5A 4GKNA 5IF0A 5IB4A 1FYTA 3ZT5A 5FCSH 1SBBA 3LY6A 3G6DL 4KDVA 1OSZA 2A83A 3WHXA 4G8GE 4X6FA 2AK4B 5DMGC 1R5VA 3RNKA 1Y6KR 4GMTL 3S34H 1SJEA 5FDYA 4DVBB 2NY1C 5I1KL 1EEUA 1UWEH 4DOHE 4LPCA 4RAVA 2CSPA 1D7FA 2DQCL 4AMKH 3C8HA 3SKNB 1DQJB 1I7TA 1L4IA 1T04B 2EKSA 3RWFA 4K7PX 4EKXA 5GS0L 4R7DB 2Q7NA 4MWFA 1RZKH 5TE6H 3RWGB 2KQNA 3DBXA 3SDCB 4ISVB 2XWJB 1RVFL 2P5WE 4E41E 2D3VA 5DJDA 1FV1B 3H0TB 4KJYA 1OP5H 2CDFB 4U6HA 4NO3A 3ARFD 1GZQA 2IPTH 1FDLH 4JCMA 3UC0L 3SE9L 3MLTB 4DQOL 4C83B 1CGUA 3O3DA 1KCUL 1PD6A 3TJEH 3BXNA 2EDQA 1S3KL 4LHUA 2XIDA 2HYMA 5J8OA 1ZKAA 4KRPC 4UOW0 3ZE2E 4AIOA 2W9EL 4PJ9A 5A3IC 4GXUN 3STLA 4CMMA 5LAXB 2ZJSL 1IKNC 3RWDA 5B22A 3WXVH 4KC3B 1FJ1A 5SWSE 4LLQA 1FVDB 1OM3L 5CEZD 4LLYA 1JZ5A 5GRYA 3NOIA 4S11A 1XH3A 4YHLH 2ZCHL 3TESA 1HDMA 1ZHKA 2DBLH 1RPQA 2Y36L 5IEHB 3D1MC 1J8HA 5HYSG 2CLZB 1N8ZA 2EDEA 4JY6B 3BJLA 4WGVB 2XT1B 4GW4A 3T8XA 2V9TA 1T0NB 4RA0C 5IOPB 4POUB 4HLZH 5J4MA 3MRMB 4PRPE 4HUNB 2Y06H 1RY7B 3GI8H 4P3CL 4OCSH 2R0KL 4G80A 3BQUA 1MQKL 2FSEA 2VDLL 1S9YB 2DS4A 4YDLB 3EW3B 4LPYA 4HEME 4TTDD 1ZEAH 5DVKA 1DFBH 2JJTA 1NFDF 4Y4FC 3D0LB 3RFZC 3CAFA 1GAFL 3QDMD 1HEZB 2QSTA 1AXTL 4KGLA 1GL4B 2DMCA 5I1EL 2D9QB 2BVUA 3KNBB 1MRCL 1ZVHA 4P2QD 1SEQL 2OXGA 4ELKA 4X4ME 4BFEA 4WI6A 1UGNA 1LE5A 4NZRH 1H5BB 1LNUA 4GRWF 1MFCH 4H1LG 5C8JB 5E8OA 5B39G 3UPCA 1YEJH 4PUBH 2NX5E 4HCRH 3L95B 1KTLA 4OAWB 2R2BB 4Q6IC 4HPYL 1Z5LB 3OJDA 1FO0B 3BKCL 3ARBD 5BRZE 2B4CL 5ESQB 1BIHA 2CK0H 1F11A 2V9RA 5GJSH 3T0DA 3GBNL 1L7IL 2VXTH 4XPTH 3WFHB 4XBPA 1F8TL 5CGYD 1HHHA 4PJCB 3U36B 1GGCL 4JO1H 4ETQA 1KIUA 1JWMA 2EDYA 2CDGA 1HHKB 4O2CB 2EYRB 4NN5C 3ZE1E 3ZHDA 4D9RD 3KPSE 2ATPB 2QQNH 2ICCA 3T09A 2YD8A 3VDBA 4LRIA 4ZOAA 3T0EB 4M43H 1ED3B 1NSNL 5F7EH 1VCAA 4NKIH 1IJ9A 1IM3B 5EZOH 1ZHNB 1S7WA 4ZDHA 1F58H 4X98B 1CF8H 1OW0C 4FP8H 1FZKA 1M7DA 1KV3A 1RUMH 2ZUWA 3VXRB 4E5XA 1FNLA 5C7XH 3DMMA 4RGOH 1SM3H 5IB2B 3WN5A 2OCFD 4LASL 1HNFA 4X83A 5F1IA 3MYZA 5D93C 2HT4D 5IESH 1MF2L 2W0KA 3LS4H 2HVKB 3SBWC 4ELME 4WW2F 4Q9QH 1HI6A 4Y4HA 3DX7A 3CK0L 1NAKL 4PJ5A 5F8RC 3VXNA 4Z78B 2BP3A 1UG9A 4Z7UF 4X7FC 5KOVC 1IAKB 3OXRA 1J8KA 3NABH 3A6CL 4MAYB 1EUTA 1KIQB 1MWAL 3V4VL 5IW6B 4PJIE 2DAVA 5ICZB 1NAMB 3VXMA 4HLZG 1R3IL 4MYWB 3QO1B 1A6UH 2UV3A 2HRPL 2D9CA 2VRAA 1RU9L 4DKFH 1MIEH 2LTQC 5I76A 2RCSH 4P57A 4WTWA 3VRLE 5BVJB 4KRNA 2AEPL 1GPOL 5FB8A 1X7QA 3ARTA 5E03A 43C9B 3IJHA 2VDQL 1Q94B 2BY3A 2NW2A 3JV6B 5KANG 1VFBB 5CSGA 2AJZA 2BHYA 3VGHA 2R4SH 4HXBL 3EOAA 1RJZB 5DJZB 3NGBB 4V2BA 3X13B 5C0AD 3WEXA 5FECA 3BPOC 4L4TE 2XQYG 1FVCA 4CU8A 1BREA 2GIYA 3BDYH 4WUKH 1C5BL 4QNPF 1T0MA 3QI9D 4XCCL 3CX5K 4MB5A 3OJ2C 3LAFA 4HKZB 1WBZB 3A6OA 1D5BA 3IJYB 4PGCB 4WO4A 3NFSH 4NQSB 4XCFH 1UVQB 1J5OL 4MXQC 4LIQL 3RRQA 4P2RD 3UTPD 4FQHB 4K8RL 1TIUA 5GRZA 4Z7VA 3SGEI 3UTSB 2XY1A 3HZKA 1F5WA 4YDJA 1EZVY 4JFFA 5JXED 1I4FA 4GKOA 4M5ZH 4PB0L 1NCAH 1FE8L 1JPGB 1KCSH 3HR5B 5HBBA 3GSXB 3REWB 2BVEA 1ZT1A 1T1ZA 4OM0L 5JW4M 4AEHH 4LSPL 1B2WH 5C09E 4PP2B 1UH2A 4O4YH 1MWAA 2VE6B 2HT3D 3QCVL 3X3FH 1U3HA 4LSVL 4WEUD 4XCNA 3MJ8B 3UAJD 3RUGF 1ROWA 5I30L 1NAMH 2IAMD 4XAWL 1N4XL 5HXMA 1SMOA 5T1LB 1OSPL 3G9AB 3E6FA 1RIHH 1G6RA 5GS2D 4FQXA 2BFVL 1A0QL 5FF6A 2NTFA 1LE9B 3D2UD 4CNIB 2GW5A 1F4XL 1KT2A 3ZKND 1CICD 4NO5A 3EZ8A 4PBXA 5DVOA 1PG7H 3UMTA 1TJIL 4YDKL 4K7PY 4HUUB 1ZWIB 3UJIH 2G60L 4NQDA 2VLJD 3G04B 1CLZH 4U7KA 5DGQA 4M8QB 3QHTC 2VLMD 4DFHA 3UYPA 1I1CA 2OJZH 1ZVSB 5EORH 1S7VB 4MB4A 4WI3A 6FABL 1ZGLP 4L3ED 2Z8VC 4XH2A 4M8VA 3AU1A 3TWCH 5LQBL 3PUCA 1K8DA 3LKQB 4NN6B 5LG1A 3NCJL 3BH9B 4QLRA 2Z93B 3ZDYF 4HV8A 5D8JH 2JCCF 1NJ9B 1BQHB 2WUBH 2A9NH 5K9OA 3D18A 4FQIL 1TNMA 2MQ3A 4XI5D 1INQB 3BHBA 2X4NA 3D25B 3PV6A 3O6MH 3CZFB 1CIUA 3PV7A 1JGVH 2DQJH 4NQVA 2NMSA 3SJVD 3HC3H 3O81A 1K8IB 4MJ5A 4NSKA 3TT3L 5EA0H 5B4MC 1X4ZA 4X6CA 4G43A 4D0DB 2BVQA 4PJXE 5E6YA 1U8LA 4X9HA 3UPAA 1FSKB 4GRLD 4IRSD 5IW1B 1OP3H 2UWEE 5GSRB 1G7JA 1QQDA 4OJFH 1LD9B 3RPKA 4Z0BL 3CFKA 4F58H 1MJUL 1CZ8L 2P44B 3L5XL 4XTRD 4O5LL 4X8JB 4PRHD 1L6XA 1UM4H 4XX1E 3STZB 2I07B 5F7NC 2DQGH 4R4NC 3NAAH 4RFOH 3P4LA 4MA1C 3G5VB 4KHTH 2B1AH 3U1SL 3CLFL 4F7PA 1NGYA 3MLSH 5DJ0B 4KVNH 1DDHA 1I3VA 4XMPL 5HHXL 5CCKL 4Y4KB 2CKBB 3KVQA 2C26A 4U1LB 1KJ2A 3EYFA 4KMTL 4QXUL 1QO3B 4QTIL 3QUXC 1P69B 5CLWA 3W5MA 2VR9A 1ND0A 3LB6D 4YHZL 5IW3A 4ZFZB 5GGVH 4DKAA 1WTLA 1A6VL 2V7HA 4OCNC 2NXZB 1FFNA 1G6VK 3DXAA 1KCKA 3OR7B 4RMRA 4D9LH 5E2TH 1T21B 3PWVA 1Z9OA 1L0QA 2UYLB 1T3FB 4UTAL 4HWZB 2EE3A 3W39B 5DJ8B 4JFHD 5IMOB 3V2AR 3MC0A 4O00A 2EE9A 5SV4A 3MBXL 4ZUWA 1A7BA 4K23H 5IVNA 2GHWB 3FOLB 3T0AA 2EYSA 2ADFH 2JJSC 5I18L 4NJAL 4NP4L 4PJCF 2VXUH 4H26B 5MP6H 3WUWB 5GRJL 3TBVB 5E24E 1DL7H 3JTSB 4FQ1H 4R2GD 1M7IB 1DLHB 1JPST 4XB7A 4RGND 3V7AG 3RWIA 3AXLB 2YK1H 3SOBH 4OZ4B 4PJEA 1XF1A 3THMH 4PV9B 4GAYB 4PGBB 1BZ7B 5EU5B 5TE4L 2CKNA 3MRBB 1YMMA 1XGYH 4MD0A 3TVMA 1KB5B 5LGJA 2YPVL 1K6QH 4Q9RL 1TITA 3I84A 3T2OA 5C0BE 2AI0L 3WDIA 1Q9OA 5ESAA 1S5HB 5ID0A 1KG0A 4OFDA 3O3AA 1QSFB 1CYGA 2OLDA 3BISA 3GMRA 3V6ZA 1I75A 1RK0B 4P9ML 3QXAB 4C56A 3TYGL 1VERA 2LU4A 4ZNCD 1JGEB 2NY3D 4I3GA 4ZO9A 4KGJA 1JUFA 2B0SL 5CSBA 3U4BL 4YFLI 2O5XL 5DVNA 4Z7WA 1MQ8A 2NY0D 3HE7C 5D2NE 4M62H 2BC4A 4KK9D 1AXSA 2X7LA 7CGTA 3QDJB 3L3DA 3OKKA 3BH8A 2IANA 2CIIB 1BM3H 4Z7NF 1BPVA 4P5MB 3JXAA 3VFVB 1FIGL 3OJMB 5LCVL 1DCLA 4Z76B 4JY5L 2K3TA 2H26A 3QAZB 3HZMB 3O8XA 3MACH 3ZYJA 2DI9A 1RUAH 2EEBA 4X80L 4ONGL 1KENL 4U1NB 3G5XB 1VPOL 4HGKC 2F19H 3D48R 4G8FB 5E6IA 1TJGL 1IC7H 4ZTOH 4XNQB 4PJGE 4UNTA 4XPFL 1MI5B 4JB9L 4OD3H 5EOCL 2DQEH 1A2YA 5KSBF 1CS6A 4ZTPL 1DBKL 2P8PA 3MROA 1LO0H 3TBSA 4I18A 5FYKL 5EG6C 5A40E 3MNVB 1GZPB 4MA7L 3VFPA 2CGRH 1I1YA 2F74B 3H8NA 3RZCC 2H32A 3LV3A 1J12A 3ZKSD 2P49B 2GYSA 4XWGL 2HJLB 5EO0A 1PW3A 4HD9A 1HE7A 3MLXL 5KVEL 3CSYB 3FMGL 4R4BA 5C2BH 4WFFD 1AQDB 3NIGF 3QDGA 2VJXA 5DEGA 3CFEA 4XP4H 5CGMA 3KPQA 3MLYL 1C8PA 3MRQB 4MVBD 1S9WB 2AEWA 5HHME 5EN2B 1IC5L 1QLRA 4NO2A 4N0YL 4QRPE 5MERA 4YXHH 4RISH 1VGEH 3HS0A 2I24N 3O41B 4ZNEE 4M93B 2IPKA 2R23A 3TZVB 5FA4A 3KJ4B 4ZUTB 2G2RB 1WJ3A 4OIIH 4WTXA 3U9PL 3NCYP 4JFEB 1EHAA 3NCYS 1I1AA 2J88H 4NRZB 1T2QH 4TN9A 5ETUA 5ILTH 4MJIE 3F6LA 3MRIA 3OAYK 4XNYL 5E94A 3QHFL 4KI5E 2QEJA 1FGVL 1WZMA 3K4AA 3E8UL 5GS1B 3GGWB 3ARDC 4NM4H 4S1DC 2Y7QB 3Q5OA 4QHUB 5C0IB 1OTTC 3QP3A 1OAQH 4YBLC 4KWUA 1T5XA 4WV1B 2FJHB 5ANME 5IT2L 3BWUC 4GUPB 4ALAH 3MGOB 2PNDA 1OGAB 1ODAA 3O9WD 1ADQL 2DBJA 4GAJH 5GRXG 3DROB 2C1OB 5TDOB 3V5DB 1DTUA 1EEZB 2B2XH 1G7LB 5I1HL 5E2WL 3SKOB 1MREL 2DMKA 4JM4H 4RGMB 2Q6WA 4TYUA 3RDTD 4CN1A 4PR5B 3P9MA 3T2NH 3M1BB 4KKAC 4G8IB 3X14A 4JZOA 5EC1A 3DRQA 2C3WA 2CH8A 3ME0A 4XNZB 1OF2B 1JZ6A 3KG5A 5L2JB 1E28B 4ZFFA 2XN9E 1BECA 4OF5A 2EXYC 1ZLUH 1NFDA 2FIKB 4WWKD 1T2XA 2PYFB 3KXFA 2NQCA 4MA3B 2HH0H 1UEYA 3OF6D 4MJ6A 4POZC 2ZUSA 3U46B 3VGBA 3EDFA 3TO4C 4NN7C 4P99A 1LEKA 4FFWD 4EXPX 5I1IH 4GG6B 3LSOA 2YPLB 3FB7A 1YPZE 3MX0A 3U7YL 2DWDB 3G5ZB 2Y5TA 2GJ6D 3D39A 2DQTH 3OKEA 4OUUA 5IBUB 1UQSB 4FTVD 1YC8A 2V5TA 1JNLL 2GUOA 3H3PH 3WNOA 3CPLA 3WD5L 5I8CB 4M3JA 5TE6L 4BKLA 4P46B 4WVRA 3TN0B 4LNRB 3W81A 5F88B 5F1SA 4QXWA 1L0XA 2F5AL 1TTUA 1WV7T 1AP2A 4JGUA 1DZBA 1OAZH 3QUZB 1ADQA 4D94A 2FBJH 1QSED 2DM4A 4PY7A 5JIKA 3BD3A 2JIXA 4KK8D 3QIBD 4TTGA 3V6OE 4YHNB 5DYOB 3PQYA 1BGXH 5SX5H 4FZEH 4PJAB 1NGXB 2GCYB 4XC3H 3OL2A 3MSPA 3FHQA 4MNQD 3ZDZF 2AEQH 3QG6B 3ARSA 5IB5B 3FRUB 1KXTB 3QWRA 5E95B 4DZBB 4HFWB 5FYJE 1FLTX 5HGDB 1S7RB 1U58B 5D7IB 3MRDB 1Q38A 3ARYA 5I1CH 3WFEH 4YHLL 3QZWA 5C08E 4J4PA 3TBYA 2DBLL 1MHPH 3H9HA 4V2CB 4WW2A 4JPWH 3S88H 3PP3K 5E08L 4UNUA 4HIEA 1EA9C 4XC1H 5TDNA 1U8PB 3ZKXC 3NPSC 5KSAB 1AY1H 4OZHB 1RUPH 2VTFA 4Y8DC 4Z7UA 5D1QA 1PG7W 1PLGH 3MV9E 1GGBH 3GKWL 5E1AA 4F9PC 1U8HB 3GI8L 1NCBL 1MAML 3B8YA 1ZLSH 4CBPA 1K4DB 5HY9B 5JIHA 2VH5H 2PYEA 4OZGE 1U8IA 1OY3B 5A2KH 3QEGH 3QQ9D 3B9KB 4TTDC 1T1YA 1ZEAL 4P4KA 4IRZH 3R1GH 1DFBL 3D69B 1R0AH 5EPMA 2PR4H 4N9GA 5FOBB 4XNXH 3OKDA 1YQVL 2V2XA 1YEGH 3IU4H 4YH6A 1ZTXH 3G5YA 5EH1A 3QA3A 1W0WB 5E5UB 1CDJA 2EIZB 4PRBB 3RVUD 3P4MA 3KYMA 3OXSB 5DUBB 3GHBL 3Q5YA 2A6KB 1WQVT 4HCRL 1DANT 1JN6B 3C6SA 2VLKB 2EDTA 3VWJA 3SE3A 1P7KA 2CK0L 2IBZY 4JZJB 2VXTL 5GGUA 1N64H 5CGYC 3VMOA 3VXOB 4BH7A 3LD8C 5IM7B 1JCKA 4PYHA 2BRQA 4MDIB 3C5ZA 2OM5A 3AUVA 2V2WA 5C07B 2DJSA 5GGRY 1FNHA 2X40A 2ZSWB 4UIKH 1AJ7H 1AGCA 1RUQL 1A9BA 2VXVH 2W60A 4KQ4H 4R97C 5CEZE 4XP9L 4WUUB 4R97B 3RWCB 3MUGA 2CQVA 3T0VA 2AV7A 2COQA 5BW7C 1AO7D 3IDMB 4ZFOL 5L6YL 2EDLA 1MLBA 4GFTB 4NBXB 3LQAH 1CF8L 3IDYB 4LCWD 3D5OF 1D5XB 1GIGH 2IFGA 1H8OA 4PS4H 2R56H 3MV8E 5I2IB 2Y72A 3VG0L 2AK4A 4GLRI 5E0QA 3EO9L 4RMUA 3RUGA 4YIQB 4DVBA 3INUL 2LQRA 1JE6A 1SMAA 3GHEH 4Q9QL 3IRZA 1DQJA 4HMEA 1T04A 2CRMA 4R7DA 4JM2D 5K59E 1INDH 3RWGA 1KTDB 4ISVA 3SDCA 2XWJA 3QDME 5EUOB 4R8WH 1AC6A 1CGWA 5KS9B 1A14L 1FV1A 4P5TD 3H0TA 5IBLD 4OQTL 4CMHC 2CDFA 3QCUL 2WW8A 4P2QE 1AI1L 2C3XA 2QQKH 3LEXB 3D3VD 5JIIA 4HCRA 3MLTA 3T0BA 1KELH 3R4DA 5INDA 1V3JA 3AREB 4UT9H 1RAMA 2BNUB 5JW3H 4PJ7F 1NMBH 3RGVB 4HWEL 1FO0L 1WFUA 3BKMH 1PGRB 5IBUG 3E0GA 2JF1A 5LAXA 1LK2B 4PIRF 4XHJD 2R4SL 5J6HB 4ESKA 4M6AA 4A2LA 2GKIA 1YEIL 1FVDA 1B4JL 5CKAA 4G6FD 1ZT7B 2BOBB 2W0PA 4JO3H 3K81A 1U9KA 1AKJD 1QFUH 3OGCB 1QBLH 5IEHA 4XPGL 2VDNH 2ED8A 4J12A 2A6JB 1FAIH 2CLZA 4HT1H 5D9SB 1ZXQA 2FDBP 1T0NA 1OWWA 5IOPA 4HC1L 4MXVF 1OQOA 4BZ1L 1B6UA 3EYSL 3RVWC 3NFSL 2QQQA 4XCFL 4K7PH 4U1HB 3U7WL 3QJFB 2VDRH 5HVGB 4OGXH 3S96B 5DD6B 3CFBB 1HXMB 3P0VH 3T3PE 1OP5K 5JXEC 3S4SB 1X5KA 4N1HB 4M5ZL 1MCSA 1FNEB 5C0DB 1IMHC 1JRHI 3D0LA 3MLWH 4NWUH 2DKMA 1HEZA 5D1ZB 4M4PA 3FN9A 3IXTB 4ZS7H 1U91A 4ODTH 4AEHL 1MELA 3KNBA 4ZSOE 2HT3C 2EDKA 2MWCA 1UJTA 5DQDH 2E7LC 2Z91B 2KUTA 3JVGC 3X3FL 5A2FA 4NKDB 4JCLA 4G8GB 1H5BA 1KGCD 3UAJC 3KYKH 1J1PH 4OCLC 5C8JA 2IAMC 2XZQL 1ZMYA 4DOHB 4NGHH 3L95A 4OAWA 1RIHL 2R2BA 3OTTA 3AGVA 1JHLH 1FO0A 5DK0B 5L0QB 5ESQA 1CXHA 1KB9J 2P5WB 3WFHA 4E41B 4FZ8H 1N3NB 4Z8FH 4PJCA 4RFEB 3SGEH 5F72S 3GSNB 3U36A 3ZTNL 2QADD 3U82B 5EZLB 1J0ZA 3BZ4B 1HHKA 4O2CA 4G9DB 2EYRA 2D03L 1UEMA 2ATPA 3WHE1 4CUCA 5C0AE 3KR3H 4XPBH 3IDXL 2OJZL 1ED3A 5AYUH 3B9AA 4PJAF 4S1SH 1VEOA 4UDUB 2BCKB 1IM3A 4HC1A 3CIQA 4AYFA 1ZHNA 4JRYE 2ZUYA 4MS8D 4YAQB 1WK0A 4M3KB 5IWLA 4ERSH 2WUBL 5HI5C 2PTUA 3FONB 1CLYH 4MCZB 2YD3A 3VXRA 3JV5A 3O6ML 4U2ZA 3H9SD 4HBCL 2DQJL 2YPKB 2NY2D 5ACZA 3PWPD 2HVKA 3P0YH 4N0FB 2W1NA 3BE1H 2BK8A 4KXZI 3RTQD 4M1GL 2M8XA 4XCEB 5DT1H 4OZHF 4IRSC 4Z78A 4PRPB 1IAKA 4LBEB 2HFTA 4OJFL 4O02H 1QD0A 2NLJB 2C7UB 5IKCB 1KIQA 3DUUB 4ZOCA 5IW6A 1OPGH 5ICZA 4XTRC 1NAMA 2FX8L 4UILH 3QO1A 3KYOB 3KLSA 3NAAL 3RWJA 1H8NA 2HG5B 4KHTL 1JHKH 2B1AL 1UC6A 2DM2A 1SYVA 4ODUB 2X05A 5BVJA 3QIWB 5I1JH 3DO7B 4AZ8A 3I2CL 1HK6A 4F37F 5T3XD 3LB6C 1Q94A 3CJJA 3JV6A 4FFVD 1VFBA 4LP5A 4M5YL 4HKXB 3GSNH 1RJZA 4OGAD 5DJZA 5KSBA 5HDQL 2NY4C 2IADB 2NX5B 2E8YA 2VLJE 1CR9H 3RX8A 1D6VH 1NCWH 5BRZB 2VLME 2VUOA 3O2WH 5IBTL 3TPKA 4HKZA 5IFHH 2DYPD 1WBZA 2ADFL 4KJWD 4AY0A 5MP6L 4NQSA 3DVIA 1UVQA 4MSWB 4LHJB 1G0XA 5CIPH 4YWGL 4FQHA 4RGNC 3KPTA 4LNVA 3KPSB 1HHJB 5FA3B 3UTSA 3SOBL 2HRLA 3SE4A 4LSQL 1JPGA 1J88A 3HR5A 2DQFB 3GSXA 3REWA 1XGYL 1ORQB 5T5FH 4PP2A 4L8DB 3OBAA 2VE6A 4CKVX 4FNLL 3T1WA 1BZQK 2YRLA 2VO5A 2C4FU 1ETZB 4QWWD 3V0WL 4YLQT 1WWBX 1PBYA 4ELMB 5T1LA 4JDZB 3RWEB 2NY3C 4KDWA 4PRHE 5FYLE 5I1DB 3ZO0A 1EVUA 4JO4H 4R3SB 2NY0C 2QJDA 3HI6H 5B38G 5I1LB 5I66B 4CJ0A 4TVSa 4M62L 3TCXA 1LE9A 5EUOF 4LEOA 2FJGB 4N1EA 2CKBL 5IJVB 2BVOB 4XP6H 2EDFA 1A3LH 1K2DB 3HNVL 5CWSB 4PJIB 5E99H 4ORGA 1ZHBB 1BM3L 1E27B 3MBEB 3G04A 2NY6D 4M8QA 3SDAC 3NMEA 1JFQH 3SDAB 1FNSH 3DSFL 1ZVSA 1S7VA 3OAZK 3BPNB 3GO1H 1I1FB 4MMXC 3LKQA 4P5KB 4L3AA 3AY4C 4ZAKD 2Z93A 2AJXH 1OLLA 3QUMH 5AAWA 1NJ9A 1BQHA 2X1XR 4OD3L 3ES6B 1BX2B 1GH7A 1INQA 3D25A 3BMWA 3HAEH 4TNVF 4LHUD 3VFRA 4L4TB 1BZ9B 1K8IA 1RZJC 2A6DB 3QYCA 3TCLB 3VE0B 5HHNB 4D0DA 1MCPL 1LEIB 3IT8D 3KPPB 1MEXL 2Y5EA 4PJDE 2FX7H 1BEYH 2ADJB 2ATKB 1SJHB 1Q8MA 4WI5A 5IW1A 2C3VB 5GSRA 1CD1B 1KB5L 1JGUL 2LVEA 4A2MA 1PEZA 4XP4L 4U1IB 5HD8D 1J8HD 4MVBC 4NQED 4NT6B 2Z8RA 3IKCB 2MQCA 4X8JA 4BQCA 3STZA 2I07A 4LCCC 3N1GC 1PY4A 4EN3B 3G5VA 4HAFA 4EDWL 1U8OB 5DJXB 1EFXB 4HMCA 4YXHL 5DJ0A 4KZDL 4Y4KA 1NLDL 2EH8H 2CKBA 3A6BL 4U1LA 5C09B 1QO3A 2QHLA 3L3KB 1HKLH 2H9GB 2P7TB 5T3ZE 5EIVA 4ZFZA 4F2MB 3VXQB 3MOAH 4YQXH 4PGEB 5AZ2L 3OR7A 5GS0D 3AS1A 1DVFB 1T21A 2WQ8A 1WWAX 2JJUA 2VISB 4JDVB 2UYLA 4X7SH 3ZT7A 1OT2A 4HWZA 5IVXE 3W39A 3I6LD 2EC9T 2EICA 5DJ8A 5MEQB 5SV3A 5IMOA 2AAVA 4NM4L 1AXIB 2EZ0D 4ODWB 4RZCB 2ICWJ 3FOLA 2AQ3A 3TEUA 3MMEB 5EU3B 3VWKB 4H26A 3WUWA 3TBVA 3JTSA 3MLPA 3O9WC 4LCUB 1I7RB 2O5ZH 1OP3K 1G9NC 4NFCA 1OOAA 1DLHA 2AXFB 2FGWL 4GXVL 4WNQB 2QL1A 2VDPH 2FHCA 3MCG1 1MFDL 1HIML 2B2XL 3AXLA 4OZ4A 5ISZB 1K85A 2A77H 5K33A 4GAYA 4PGBA 3ZE2F 1BZ7A 5EU5A 5C6WH 4HZLB 2HAZA 1KB5A 1LO4L 5BVPL 2G5RA 1N6VA 3VU2A 1YYLH 2CMRH 1XMWA 3GSRB 4WFFE 4EQ3A 3C6LC 1S5HA 3D6GA 3MA9H 1FQ9C 1YN6B 1QSFA 4LVOB 1RK0A 3MLZH 3QXAA 3HE6C 1JGEA 4PJXB 3HAEG 1A3QA 4Q9CA 4HAGA 2HH0L 4XP1H 2UWEB 2HFEA 3S3JA 5T1DL 4QOKB 5E7BA 3QDJA 5GGRB 3LRGA 1KFAH 4Y4HD 5DZLA 2CIIA 5CEYB 1J1OL 4P5MA 3VFVA 3X11B 4Z76A 3HI5L 1NCDH 3ULVC 5JHLH 3WJLC 3HZMA 2NXYD 4XT1C 1X9QA 3C60B 1MUJB 1N6UA 1HH9B 4U1NA 3GI9H 4FMFA 3G5XA 4G8FA 4U1JB 1HINL 3MR9B 1YQ2A 3VXMD 4FN0A 4XRCB 4XNQA 5I1AB 2BMKB 2HFFB 5HPOA 4I8DA 2VSCA 4NZUH 5JOFB 4X99A 1IC4H 2FR4B 4RAUB 4EJ1C 1UA6H 4KK8C 3QIBC 3MNVA 1GZPA 5JNYB 4TUJB 5DRZB 2ZUQB 2J12B 4I0PC 5CBEB 2F74A 1C12B 3N1QC 3FFCD 4FZEL 4JHAL 3WO4B 5ESVB 2APTA 4PB9H 4KTDH 4I1NB 1RFDH 1JTPA 5D72H 2BDNL 4HXAH 1OARL 3UBXI 1AQDA 4OLWL 4YFLF 1PKQA 3MRQA 3NZ8B 3WFEL 3LRHA 3ZE1F 5ADPH 1U2HA 2ARJB 1S9WA 4AQOA 5EN2A 3S88L 3NFNB 1P84K 3NTCH 1R3KB 4N5EC 4LVHC 4WO4D 5DZNA 4XC1L 3FRPA 1UCBL 2BJML 5JW4R 1ZE3C 1AY1L 1G9MH 2KH2B 3O41A 1RUPL 3TH2T 5CS7A 2ZWLT 4NIKB 4ZUTA 4OZFH 2G2RA 5EBGA 4JFEA 5F6IC 1ZLSL 1A7QH 3IFLL 4NRZA 5C0BB 4CJ1A 2VH5L 2ED7A 4XXCC 2CIKB 3VCLB 1X5IA 3QEGL 3QFJD 3F6IA 1Q72H 2DQIL 4LDLB 5E8PB 5GRUH 2W91A 4XPAH 4Z77B 1FFOB 1MFAH 1R0AL 1L0YA 2X5PA 4GSDH 5GS1A 5JDSB 3GGWA 3QO0B 2WMPA 4I9WD 4FTVE 2Y7QA 1Z2KA 4H8WC 5C0IA 4S1RL 5D2NB 4PJ8C 4XNXL 1BJMA 1YEGL 4DUVA 1U3HD 2ENYA 3HRPA 4PG2A 4WV1A 3EBAA 2VLLB 2FB4L 2FJHA 4LKXB 5J11C 4GUPA 3NCFB 3MGOA 2BVTA 4KUZH 3L9RB 1OGAA 3HKFA 3HMXL 3QULB 2YEZB 3ZHLA 1DQQB 4OI8A 4FQXD 4N8VG 3DROA 2C1OA 3V5DA 2P48B 1EEZA 4LSTL 3OKOB 1D9KB 1NUDA 1QSEE 1G7LA 1WFOA 2DI8A 1CXFA 3M45A 5F96L 3SKOA 3VRLF 2HKHL 3PGCB 2WBWB 2HFGH 3BKYL 4Y5VB 3CFDB 3M1BA 1XIWC 3GBML 4FA8A 4G8IA 4MNQE 4PJGB 2YRPA 4P2CG 1YZZA 2GEEA 3QXWA 2R29H 1OF2A 1FH5H 3FB5B 1OAUH 3JWOC 2VWEC 4KJQD 4MJ4A 2IPUK 4O51A 4JN1L 1U8QB 2IBBA 5L2JA 1E28A 3LIZH 4RMWA 1MPAL 3MXWL 4AIZB 1KC5L 5GSVB 2FIKA 4HJJH 1RJCA 1CLCA 1BQUA 2I9LB 5DD1L 4POYA 2PYFA 4K8RD 4B41A 4MA3A 2FX9H 3LQAL 3U46A 2A0LD 2DIAA 4O58H 4MNGB 3TO4A 4GG6A 1LP9F 2OBGA 2YPLA 2IH1B 4YE4H 2OMNA 2FL5B 4N8CL 4P23B 2DWDA 3G5ZA 3QH3B 1FFPB 1UQSA 8FABB 4QRPB 3U30B 5KAQF 5IEKB 4JFPB 3T08A 5I8CA 1I7ZA 4JM2C 1FIEA 3IB4A 1INDL 5KBNC 4P46A 3TN0A 4LNRA 4NUGH 5F88A 4QRQB 4R8WL 4P5TC 5EU7C 3HMXA 4MJIB 3QUZA 1IQDB 5C0ND 1IM9B 3FTGB 2ZP0T 4OZFG 3CFJB 3ZKQD 1KELL 1R6VA 3CVIH 3HLAB 1ERNA 4DN4H 4UT9L 2Q8BH 1NMBL 1E6JL 1H3GA 3A0OA 4YHNA 3LKPB 5DYOA 3I50H 2JB5L 4PJAA 2P8MB 3NN8B 1NGXA 2GCYA 4RCAA 4U1MB 3QG6A 3Q6GL 3X3GL 2ZNWA 5JHDD 5GGQH 5IB5A 2W07A 4AEIH 4ZO6A 3FRUA 4XHJC 4JJHA 4ZOEA 1Q9WB 3GM0A 5ANMB 4DZBA 3JUZA 1P4BL 2JELH 4HFWA 4J3UA 2CLRB 5HGDA 1CFNB 5AWNH 3CFCH 1U58A 1S7TB 5D7IA 3RVXD 3MRDA 3CLEH 5GGTL 1FN4B 2H2SC 4PRAB 4JO3L 3WJJC 3LPFA 1QBLL 5IIEB 2V5MA 5I6XC 4OLEA 1FAIL 3VG9C 2CO6B 4HPOL 2X9XA 3KDMB 4LAJH 5C6TH 1U8PA 2H3NB 2AXJA 3VI3E 5KSAA 3C09B 1FRGL 1UACH 2AVGA 4OZHA 4XNUH 1V3MA 1U8HA 3ZMRA 4LOUD 4K7PL 4F9PA 1E4XL 2NY5C 4D3CH 5HY9A 1NEZB 4OGXL 5F9JB 4TSAH 4GQ9L 4O2EB 1I9RH 4WI8A 3B9KA 1YNKH 3HMWH 4NHUB 5FHAH 1EDQA 3D69A 1YMMD 3TVMD 2QQLH 2X44D 1MCHA 4D0BA 5FOBA 2A73A 1NLBL 4LEXH 5DUMH 4DK3A 4HW6A 5HI4D 1MHEB 5A2JH 3ZSSA 4L8CA 1W0WA 1YPZB 3TNMB 2EIZA 4PRBA 1MY5A 2DLFH 3GMPB 3KYKL 1J1PL 1KLUB 5DUBA 4UTBL 4P9HC 4NFDA 2A6KA 4QT5B 5DWUH 4APQB 1LO3H 3PWUB 4MD4B 4U1SB 1JN6A 3D3VE 3ULVF 1FLRH 2VLKA 4K94L 3HZYA 4JZJA 3J7HA 5ITFB 4OFIA 5B21A 4KUCD 2GT9A 2IAND 3DI3B 3VXOA 4Z8FL 2LAGB 5IM7A 2QADC 5C6PB 1M05B 1TDQA 4MDIA 3V4UL 5GGTA 5C07A 2VUYA 3O8XD 5ENWB 1RULH 3BPLC 1JRHH 2APWA 1T1WB 4RA3A 1LDPH 4XPBL 3RWCA 4WUUA 4EXKA 2BSSB 4PGJA 5DDHB 5E6ID 4S1SL 1OAXH 3IDMA 1N5YH 4G7YH 1NGQH 2HN7B 4R0LC 4U6YB 1ORSB 1L7TH 4LSRL 4X4XB 1A6TB 1D5XA 2CR3A 4ERSL 4IJ3C 3SDYL 3W9EA 3C2AH 4DN3L 5C08B 4ODXB 4YIQA 1XF4B 1VESA 4QF1B 3MXVL 5SWQB 2LFGA 1J05B 1TFHA 4JRXD 3HG1A 1U93B 1MSPA 3HNTH 4K3DH 5LGKA 1QNZL 5AZEH 5IUSA 3QDGD 1AHWB 1KTDA 3MV9B 1Z9MA 5EUOA 5FGBA 2PW2B 4WGWB 3QIUC 2NYYD 4G6JH 4UV4H 5DI8B 4OZGB 3LEXA 5I8KL 4MDJB 4QHKI 5I15H 3AREA 3QUYC 1GHFL 1MCRA 1QR4A 2BNUA 4P2YA 3RPIB 1R5WB 1QG3A 1KEMH 5JW4Q 3RGVA 1KTRL 4MA8H 5I1JL 2NR6C 1JYWA 4QHNB 5HYIA 5C3TA 5JMOC 3G6JF 1I1AD 4L5FL 4U1GC 1A6WL 1LK2A 5DD5H 3RIAF 5J6HA 3IGAB 5EWIH 1WZLA 2MKWA 3GSNL 3NH7L 1KTKE 1WZ1L 3U4EA 3CCHA 4KXZH 3ARFB 2QTEA 1ZT7A 2BOBA 5DA4A 5FUZL 3OGCA 1EO5A 4N90D 5EC2B 1YECH 4JE4B 3BEVB 2A6JA 1NMAL 5D9SA 4LPWA 2R8SH 2VSDA 4HUWB 5FUCE 3WNNA 1IAII 4KJWC 4UNVA 5GRVL 4JAMB 4QXGH 5FYKD 1OLZA 1DN2A 3IDGB 4PJGF 5T5NF 3MCLL 1SVZA 4U1HA 5FYJH 1WEJH 3QJFA 1U8NB 3DRTB 3S96A 5DD6A 3CFBA 1CI5A 1HXMA 5KTEH 4F37K 3S4SA 3IU3B 2GJZB 5T1KD 3PP4H 5DK2B 1FNEA 3PWPE 5C0DA 5J57B 1AGEB 5AG8A 3VFSA 1HKFA 5D1ZA 1EAJA 4MAUH 2X4QB 1UM5H 3MJGX 4J3WA 5D6DC 5IHUH 3J8F7 3EGSB 2YHGA 3K1DA 4M7ZB 2Z91A 2ADGB 3MV8B 4NKDA 9CGTA 4M9OA 3JVGA 4G8GA 4ZFGH 4QHKJ 5C0RL 2DQDL 2VZSA 2Q8AH 1RK1B 5DFVD 1E0OB 4N0RA 2X4SB 3LZFL 3KXFD 1XF3B 1XR9B 4AIXA 5F7MC 1IBGH 2ICWB 4ZPTB 5FGSA 1V8HA 1NEZG 3PL6B 4RIRA 5DK0A 2OI9B 3HI6L 3IFPB 1CDYA 1Y18B 3BKJH 4BUHA 3QDMB 2XTJD 2P5WA 3U7AA 3GSUB 3OHXB 4E41A 4JFYB 1N3NA 3V4PH 1HSBB 2YMXL 4RFEA 1Q0YH 3GSNA 4QRRE 3D39D 4P2QB 5F71A 5EZLA 2XQBH 3WO3B 4P2OB 1INEH 3BZ4A 3I9GH 1FGNH 4G9DA 3SGDI 3MGTA 4U4BA 4KI5F 2F8XC 1KN2H 4F7EA 2R0ZL 1JFQL 1ZSDA 4FXKB 4DGIH 4LVNC 4S10A 3PHOB 4UDUA 2BCKA 4YUEH 3ARBB 3GO1L 3O0RH 4XVSL 2FECL 1BQLL 4DGVL 4YAQA 5FDWB 1UB6B 1BD2E 1EK3A 5DVMA 3FONA 2JIXD 3IJSB 1EJOH 3PQYD 2YPKA 3QFDB 4GBXD 1JGDB 4N0FA 5CEZH 4PJ9C 1L9NA 7FABH 3UTTD 2WLYA 1T66D 1P4LB 3ECBB 3O2DH 5HJ3B 3QWRD 4IS6B 4XCEA 1CXIA 1BEYL 3L3IB 4PRPA 4FQLL 4LBEA 5L7XL 3ZE0E 4EVNB 4HUMB 2NLJA 2C7UA 4UINL 4TQEH 5IKCA 3D85B 3DUUA 3MNZA 5HD8C 1HCFX 1MRDL 1NBZB 4TVPL 3PE9A 4BSJA 1MCWW 3KYOA 3JUYA 1NCUA 3NIDE 3LKOB 5JZ7C 1FC1A 5IMLB 1V3KA 2HG5A 5KN5B 3U2SB 1KEGL 1JVKA 5EOQH 2D2OA 4ODUA 5EUKB 3QIWA 3NFPB 3DO7A 4C4KO 1I3UA 2EH8L 3BQUC 4TNVK 1IC1A 2KL6A 4ZSOB 4F7CB 4OCRH 3IDNB 4X4MA 1HKLL 3O45B 3M8OH 1NGPH 4YGVA 4HKXA 3DV6B 5DXWA 5T33H 4P4KD 3T0WA 1F4HA 4BZ2L 2IADA 1UXSB 2NX5A 3KPRD 4L3CB 2CR6A 4X7SL 3TIEB 2GK2A 3O4OB 2AV1A 2FEDD 4ENED 1REIA 2H41A 3CVHB 5BRZA 3V7AE 2EZ0C 3DGCR 2OMBA 3OJVC 4J3XA 1JI2A 2WP3T 2ZCKH 3SDXE 1BQSA 4UMGA 1KPRB 4MSWA 1C16B 2YZ1A 1CG9B 3VI4E 2GY5A 4N5UA 3WIFB 5E4EC 4KZEH 2O5ZL 3K0WA 3EFFB 4PRID 3QNYB 4QEGA 3KPSA 4FQJH 1HHJA 5FA3A 1V7MH 3JSSA 2ZG3A 2YSSB 4DEPB 4Z7OE 2HVJB 2ORBH 2OJEB 3QNZA 1CU4H 1N7ML 2A77L 4Q6YA 4H0GA 1GGIL 1MLCB 5KSVB 1BFTA 2DQFA 3GJFA 4JRYB 1DLFH 3QI9B 4NNPL 4WU7B 3C5ZD 1CN4A 1ORQA 4KROD 3WLWD 3F58H 25C8H 2B1HL 4WY7H 4L8DA 2A1WL 1ONQA 1CTNA 4CADB 4LRIC 5KVDH 1U6AH 4OZIE 1ETZA 1CBVH 5CJQL 2MFNA 4ELMA 1J8HE 4NQEE 5F1OB 3RVTD 2FNBA 4JDZA 2FZ3B 3RWEA 4KMQA 4YR6B 5I1DA 1U3JA 4IMLB 1S9KC 5I1LA 5I66A 3DMMC 1A6ZB 1F90L 4XP1L 2FJGA 3WN5C 2BVOA 4KAQH 1DQLH 2AK4D 2MKLC 1U8JB 5DMGD 1K2DA 5D7SH 3QXUA 2WLZA 5CWSA 5F6HJ 4Y4HC 2NY1D 3E2HB 3OPZH 4HK3N 1WWWX 1ZHBA 3MOBH 4Y5YB 1E27A 2FEEL 3MBEA 4OCWL 1EUUA 4FQ2L 1RMFH 2NXYC 2P5ED 3SDAA 3UBXB 3SDCD 1AQKH 1SEBA 3OB0H 2DQHH 3I6LE 4JKLA 2B5IB 5D7JB 5I9QC 5MHSE 3CVHH 2VDOL 3MJ7B 4H20H 3SKJL 1P4IH 1I1FA 3MODL 4P5KA 4PGDB 2H2PD 2AJVH 2XZAL 5JXAL 2GFBB 3V52H 1CICB 3ES6A 4TOYL 3V8CA 1BX2A 1G9EA 5DHVB 1Q9LB 2B4CC 3DWTA 5INCB 2VKWA 4KH2A 4V1DD 1BZ9A 4D9QD 1G7PB 2VLJB 4KRPD 3MLRH 2A6DA 3JWDH 4F15B 1I85A 1LK3H 3TCLA 2D4FA 1UCTA 3DX9B 3VE0A 5HHNA 3OSKA 1CK0L 1LEIA 3K2UH 3KPPA 1ULVA 5L88H 5LXGH 2ADJA 1DQMH 1C7TA 2ATKA 1SJHA 5D72L 4HXAL 4LKCB 4R26H 1T89A 3TT1L 1NBVL 2C3VA 3RA7L 5I75B 1CD1A 1X5HA 4TPRH 3IDUA 3AS3A 4BSWB 1T20B 4NZTH 5ADPL 4NT6A 1C1EL 1YUHB 3IKCA 1PG7X 4WI2A 3ROLB 3LS5L 5SX4I 4EN3A 4KKCC 2DDQH 4WO4C 1BJ1J 1U8OA 5DJXA 1EFXA 4K2UL 4XNMB 3OZ9L 1RIVL 2AABH 5K9JL 1LHZA 4QCIB 5DTFB 3L3HB 1FORH 4AK1A 4MB3A 5C09A 3VGDA 1E4JA 1O7VA 4GRLB 3L3KA 2H9GA 1A7QL 1NQBA 2P7TA 5D71L 4F2MA 3VXQA 4PGEA 4M1CD 5GHWH 1TCMA 1DVFA 2VAJA 5I1GH 4KV5F 3AMKA 4R96B 4Y4FD 2VISA 5LGHL 4UT7H 4JDVA 3FB8B 2VDKH 4G42B 4PRHB 3N1FC 3MA7B 5MEQA 4PP1D 4PJFE 4YDIH 5K59F 3ULVL 1XZ0B 3LH2H 1CDHA 4RZCA 5MI0C 1U3HC 2DF3A 3ULUE 1CDIA 4AENB 3MMEA 5E70A 5EU3A 3VWKA 5CKGA 4HS3B 1UZ6E 3BAEL 1ZHLB 1TZHB 4DUWA 4FQCH 3VXME 4LCUA 8CGTA 3CH1B 5CJOH 3GJFK 4U6TA 5GJTH 4FQXC 1FPTH 5DHVH 2AXFA 4WNQA 1N2RB 3MTRA 1A6AB 3QXTA 3ZKMC 1QVOB 3W9DB 5ISZA 2OK0H 2HFGL 4ODSL 3O6FB 3KPLB 3K2MC 5TQ0H 3ZYIA 4EIZC 3AM8A 3FFCE 4HZLA 3DJ9A 3O4LE 4NO0D 1B0RB 2YD2A 4FQPA 4KKLD 1FP5A 5DUPL 1OAUL 4KJQC 1A7RH 3UTZB 1YN6A 3C6LA 4JREC 4R2GB 1MCWM 2HT2C 5CILL 3WXWH 1J0YA 4UQ3B 2G5BB 3ISWA 4MLSA 1KYOJ 5DRXB 4G9FD 4PJXA 4ZPVB 3R0MA 1FL6B 1DJSA 3AC0A 2V7NA 4L4VE 4PJDB 4PJBE 1GGUA 3VXRD 2A0LC 2UWEA 1RZFL 5TQ2H 4OGYH 2FLBT 4QOKA 3T3ME 3RL1B 5GGRA 4KJPC 1W72B 5CEYA 1J0HA 3X11A 4PREB 2YC1B 1YEKH 3QFJE 2GSGB 3RBSA 3C60A 1MUJA 5FYLH 1HH9A 3X17A 1QBMH 3G6AB 4J8RA 1UJ3C 4NUGL 4I9WE 1UJ3B 4U1JA 3MR9A 4OBSA 1CGSH 4NRYA 1BIIB 4TRPH 4XRCA 5I1AA 2BMKA 4B7IA 2HFFA 2LAAA 3HUJF 4AL8L 5JOFA 4GXUM 1DP0A 3WYRA 1N0LA 4RAUA 2FR4A 3TM6A 2GJJA 2NTSP 3CVIL 5IVXB 2Q8BL 5J56B 5JNYA 4TUJA 5DRZA 5IVZB 3FT3B 5CBEA 4I0PA 1C12A 1WF5A 1MVUB 3I50L 4NQXB 4UV7H 5ESVA 1Q0XL 1QFWH 3Q1SH 4N0CC 3M07A 1VDGA 2EC8A 5KW9H 1J10A 1IGFL 4ONHB 1DQTA 1KIPB 5DC9B 1P1ZB 5DSCB 2DWEB 1UM6L 4JG0L 1OVZA 5BV7B 3CFCL 5A16B 3DX8B 3NZ8A 1X5XA 4D0CB 4G7VH 4R90H 2D7QA 3N1PC 1VACB 4YC2C 2FATH 3HNSH 3NFNA 3PJSB 1R3KA 3PG2A 1VFAB 5EBLB 5IQ9A 1UACL 4MXQD 4LIQE 4XNUL 2DD8H 3DTXB 2WNGA 2AQ1A 4LOUC 3ESUF 1JWUB 1UXWB 4EBQL 3UTSD 3BZDA 2AK1L 5C0BA 4DTGL 3IDJB 3MLVH 3STBA 4X0KB 4GRMB 1W72H 2CIKA 3VCLA 2FYYB 1I9RL 2R2CA 2R2HB 1VSCA 4ODHH 5E8PA 4CGTA 3DO3A 4Z77A 3MFGB 1FFOA 4NC1E 5JDSA 3QO0A 1H3WM 3GSVB 5D2NA 4LARL 2C3GA 4OLXH 3QCTH 3FHAA 4LEXL 5DUML 2E27H 5HI4C 1MCLA 2VLLA 4LKXA 5ICYB 2IGFL 3H7LA 2UY7A 5T1LD 2DLFL 3UJJH 3L9RA 3UEZA 4U6VH 3QULA 3EJYD 2YEZA 2YN5A 1DQQA 2GTZB 1NGWA 2V5YA 3OKOA 1D9KA 1K4CB 2Q7YB 3PGCA 5C9JB 3VXPA 4M03A 3PWLB 3UO1H 3CFDA 3BT2L 5E2UH 5IJKC 4RRPG 3B3IB 2IH3B 3CDYA 2XWBB 4J6RH 4PJGA 1TZGL 1R24B 3BUTA 4GS7C 5JHDE 4I0CC 4X9IA 1WC7B 3O8XC 3FB5A 3C2SA 1YYML 5BV7H 2F53E 1RULL 3K3QA 4XAKD 1TVBB 1JIBA 1U8QA 4L8BB 4P4RA 1JZ8A 3FQWB 4EI5B 4PBVC 1NUGA 4K71B 5E6IC 3PWJB 4AIZA 2OSLA 5GSVA 3SCMC 3SCMB 2AJYH 1L7TL 2APXA 2I9LA 4X6DF 5CGTA 4PV8B 5FO8B 3RDTB 2DKUA 3WCYA 3OR6B 2J5LC 4I18C 4MNGA 5EO1B 5D5MB 5A1AA 4HK0B 3C2AL 4PD4K 1NC2A 2CUHA 2IH1A 2FL5A 1IGMH 4P23A 5B4MD 1WISA 3QH3A 2Y25A 1FFPA 1L9MA 1TVDA 5DR5H 1T7XA 3GDBA 8FABA 5GGSY 3HN3A 2X41A 4HLJA 2YA2A 4TSCH 4QRPA 5IQ7H 3NACL 4YHML 5JPMB 1CFQB 5IEKA 4JFPA 3HNTL 4K3DL 1A4KB 3P40A 1YMME 2R0WH 4UQ2A 1HZHH 4ZNEA 3ALXA 4WWKB 1GXEA 1FNGB 4LSUL 4QRQA 1JPTH 1Q9KB 4X7DC 4H0IA 2NYYC 4OT1H 3H42H 3QPXH 1WCBB 4QHMB 4DWHA 4MJIA 1IQDA 1IM9A 3FTGA 3OKMA 4XVJH 5C0JB 5ACLA 3CFJA 1OAYH 3HLAA 5I15L 2Z9TA 4Y4KD 4P9HL 2VXQH 1KJMB 1S7QB 1KEML 4JPKH 3LKPA 2VZVA 4FTVB 3KLAB 2P8MA 3NN8A 3QUXD 2Z31B 3LEVH 3JTTB 4U1MA 5FUOH 3BSZL 1NPUA 3OAUH 3HA0A 1CQKA 3CSPA 2EC9U 4QRUB 5DD5L 5ANMA 1Q9WA 4IBLT 3P30H 5F70A 2CLRA 1CFNA 4GKSB 4JHBA 3S5LG 1S7TA 3SO3C 2BHZA 1FCCA 1FN4A 4KY1L 4PRAA 1MIMH 3FO1B 1QSEB 2G9HB 2H6PB 1BBJB 5IG7B 5HYJE 1DQDH 2H3NA 2E5EA 2XKNB 3AB0B 1TQBB 2WP3O 4MNQB 5DHYB 1P7QD 2HP4A 2W9DL 1JV5B 3VRJB 5CEXB 1NEZA 4K9EH 1RI8A 5F9JA 2FH6A 1TXKA 3K4DA 4L9LB 4O2EA 5KTEL 3BDXA 2ICEB 5DQ9B 4NHUA 3RIAK 2AJ3B 2I5YL 4FHBD 4JKWA 3ARGC 3VRIA 3E1F1 3MRCB 1LMKA 2RIKA 4JRXE 1JYVA 1CLOH 2ESVE 4MAUL 1B0GB 4TUOB 1UM5L 1KUMA 5IHUL 3O6KL 3QDGE 3F65A 3HHRB 1MHEA 3WFDH 2M26A 2ZPKH 3TNMA 2XRAH 3GMPA 1KLUA 4X6CF 5DFVC 5DEFB 3NA9L 2Q8AL 5DHXB 1C7SA 4ZXBC 2F54E 4CRPA 4QT5A 1JZ3A 4APQA 3PWUA 4MD4A 3QQ3B 2XICA 4TUKL 4U1SA 6CGTA 4DKEL 1IBGL 3HE7D 4HFUH 4DVRL 2XZCL 1KULA 1Z9LA 3ALPA 2R1YB 3LMJH 3BKJL 4IOSD 3QDJD 1IFHH 5ITFA 5EU6D 3DVFA 4YFEA 2CJUH 3V4PL 2NNAB 5IHLB 3FQTB 1M05A 1TZIB 4PG9B 5EIQA 1RJYB 5KAQG 2V2TB 1WITA 5ENWA 4FABH 4I3RH 1GVIA 5HDLA 1T1WA 4ONFL 4I77L 3V6OA 2BSSA 4ODVH 1TPXC 1W0YT 5DDHA 5IR1B 5DA0B 4DGIL 1B90A 4N1CA 4N90E 3KJ6H 1KXQE 2HN7A 4X4XA 1N26A 1ORSA 4U6YA 1BBDH 1FYHB 3O0RL 5HYSB 3DIFB 1IEAB 1AD9B 1MCFA 3VD3A 1A6TA 1KB9K 1CCZA 5CJXA 1TETH 1CFVH 3CXHJ 2BVPB 3F7QA 1EJOL 2PCPB 2BOCA 1WWCA 2F5BL 4RMQA 5C08A 3K46A 1S7XB 4ODXA 3RZCD 1XF4A 4DZ8B 4QF1A 4RDQG 1N6QL 7FABL 5F1NB 1T66C 1YNLL 2EO1A 5SWQA 1J05A 4NWTH 1U93A 1ES0B 5I74C 2AGJH 4M7LH 3NBNA 2VDMH 4ZS6C 1AHWA 3MV9A 1QRNE 2AJSH 4JVPA 4IDLA 5EDXA 3SGDH 2FWOB 4U6XB 5TFSL 4J4PC 4JFZL 3QIUA 4HGWB 4OZGA 5DI8A 2OYPA 2J8OA 3KS0J 4NJ9L 4PJEF 3DOSA 1NMCB 1J0JA 4MDJA 4U3CA 3UPRB 4H1LB 5D1QC 1NFDE 5B39B 3RPIA 4CVZB 1R5WA 1U95A 2J2ZA 3GK8L 1TCRB 4LLMB 4QHNA 4TSBL 1PDKA 3DUHA 4LK4A 2HLFC 4A6YB 1A8JH 2DLGA 3GNML 1MCCA 2UVEA 2ZG1A 2XTJE 1F3JB 3M8OL 4BH8B 3IGAA 4GRWE 4P4KC 5C0CD 1F4AA 3D39E 1CDCA 1RZKC 2ZKHH 3ARFA 4S1DD 3D3VB 2YWYA 2FEDC 2BY2A 1KNOB 5EC2A 5FM5O 5KJRL 4OF3A 2W38A 3BEVA 3V6FB 3WL9B 4NQTA 4HUWA 2BVYA 2F9BT 4DGYH 2EEDA 2X42A 2XNAB 2D0FA 3RKPA 2ZCKL 1S7SB 4JAMA 3DX6B 3IDGA 2QSQA 2B7DT 2XFXA 3ZL4H 4LHQB 1U8NA 2ZOKB 3DRTA 5CUSH 3EOYG 1QHOA 4FQJL 3VWJC 1MAKA 1F6AB 3SE3C 5J6GB 1V7ML 4G6FB 2O26U 2APFA 3B2UC 2GJZA 3IU3A 4R9HA 2ERJB 5DK2A 2APVA 5ALBL 15C8H 1CU4L 1AGEA 3IFNL 4RX4A 1EZVX 3KAAA 3MV01 3UTTE 3TA3B 3WLWC 2RHEA 2X4QA 3PGFH 2D7TH 2IMNA 2CRYA 5D5MF 3EGSA 4WY7L 3V0VB 3AFLA 5DMIH 2EH7H 1FBIL 2ADGA 3MV8A 5KVGL 4OLUL 5KVDL 4M61A 1T83C 3BYYA 3PIQA 3QXDB 1F02I 1RK1A 2X4PB 3BRFA 2EXYD 4NYLB 2X4SA 1GGTA 1XF3A 4G5ZL 1XR9A 1WBYB 3DURB 4H1LH 2C4FT 2ICWA 4POZD 4ZPTA 5J0BA 3U9UB 2YD7A 3PL6A 3QEQD 3BGFB 4W6XB 4Z7UE 3IFPA 3TO4D 1Y18A 5CBAB 3VJ6B 1T22B 3QDMA 4GMSH 2BXYA 3GSUA 4PGZA 3OHXA 4ONOA 4JFYA 2YPLD 4HMDA 4KPHH 1HSBA 1YN7B 4A6YH 1IZKA 5E9DD 2B39A 4QRSB 5D7SL 5ERWB 4P2QA 4LF3A 4P2OA 5DF0A 4IOIB 4Y1AD 4ETYA 3S36X 5HHVH 4F3FB 1NBYB 4X7CC 3E3QE 4YBQC 4DW2H 3BN3B 4S1QH 1J87A 2EDOA 1U8KB 4P46D 3SDCC 3TN0D 2Z8SA 3KPRE 1FHGA 4XPHH 4FXKA 3PHOA 1G7MB 4RFNB 3M17B 2PXYB 4OLZH 4M1DH 3ARBA 5IMMB 1II4E 1ZLVK 2H2PC 3QUZD 4FFYH 5FDWA 1UB6A 1RHFA 1ZS8B 4OFPA 3BI9X 3DVGB 3IJSA 3P2TA 1EGJH 1RURH 5GZND 5I0ZA 5BS0D 4HJ0C 2I9TB 3QFDA 1BJ1H 4PRIE 1LO5A 3JWDL 1I3GH 4QNPE 4AM0B 2DIJA 4OCXL 1VKXA 1EMTL 4WEBH 4AG4H 1P4LA 3ECBA 4WCYL 5HJ3A 3K2UL 2CXGA 4IS6A 4O9HL 4HQQH 4NQCD 2M2DA 5LXGL 1DQML 3O3BB 4M6NH 1MFEH 5DJ2B 2UZIH 5D7KD 3MUZ1 4EVNA 2OP4H 3BW9B 3DI2B 3QHZH 3D85A 4M7KH 2EIBA 3LKRB 3O3EB 3VW3H 3N50A 1JGLL 3LKOA 1DBBH 4JG1H 2NY2B 5IMLA 3ZHKA 2DDQL 3PWPB 3U2SA 5KN5A 2OL3B 2R4RL 5EUKA 4M6OL 5JUEH 2KZWA 3FN0L 3NFPA 1Z9SA 2AABL 3RTQB 3BP5B 4LRNL 1J1XL 1G0DA 4XMLH 3VXSD 1FORL 1BFVH 4ZSOA 3KWWB 4F7CA 5JQ6H 4U0RC 5IB1B 4YDLC 3O45A 4U0RB 5CLTA 3B9VA 4E0RB 1S9VB 1LO2L 3B9KD 3UJTL 3HUJA 4M1CC 1E6OH 2BNQA 3DV6A 3FAXA 5GHWL 3RUGE 4M7JL 5HDBE 2ZCLL 1NUFA 2OR9H 1UXSA 4MQSB 4L3CA 3RWHB 3TIEA 1CL7L 4PP1C 3VGAB 3TBTB 4YDIL 4LLWB 1HNGA 1UZ8B 1BAFH 2P5EE 3LH2L 4G6MH 5TPWL 4Y88A 3U0WH 1H5BC 1IE5A 2WINB 1KPRA 4QRRB 3CMOL 1C16A 4TULH 1CG9A 3WIFA 2F8OA 4KVCH 5SX4H 5CJOL 3FO0H 1P2CB 3EFFA 2PO6B 4IIQB 3QNYA 1HILB 3MLUH 2YSSA 4V1DE 2OK0L 4D9QE 2OJEA 2E9BA 1GC1H 5TQ0L 1MLCA 2PUQT 5KSVA 4JRYA 3QI9A 4GKZB 4WU7A 3ZYOA 2P4AB 2IALB 4OBRA 4K7FB 4RMTA 2JCCE 1EVTC 1BD2B 2DYPB 1FAKT 2X2YA 3K8MA 4KKLC 2OZ4H 3EO1B 1IGJB 5FKPB 4GAGH 4CADA 3GKZA 3T0EC 1A7RL 3V5HA 4EUPB 1F4WH 4MZ2A 5HHOE 1PSKH 2HWZH 5HYQB 3BWAB 1O7SA 2YD4A 2FZ3A 4D8PA 4EI6B 1H3PH 5IWLC 1U3ZA 1GGYA 1ACYH 2OL3H 4IMLA 3MFFB 4WFHD 1HYSC 4Z95H 4YHYB 1A6ZA 1HQRB 3VH8B 1HOCB 5TQ2L 3BO8B 1N0XL 3ALWA 1KCVL 5L9DL 2JLLA 1TENA 1AFVH 1YDPB 3HG1D 2NPLX 3MYJB 2FHBA 1KXVC 3UBXA 3TH4T 3UCRA 3WUZA 5FYLL 4MAYC 3O2VH 1ZV5A 5D7JA 2X1OA 1QYGH 5E8NB 3MJ7A 3PHQB 1CGSL 1QLEL 4JVUA 3N85H 4PGDA 2O5YH 2VLRE 3F7PC 2GFBA 4X6FB 1R5VB 1CICA 1F13A 5BOPA 3H3KA 3ARED 5DHVA 1Q9LA 4BK4A 4LSSL 5GGSB 5INCA 5EU4B 3LHPH 1G6RL 4H5SB 3HC4L 2K9UA 3B2VL 3WKMH 4Q9BA 1G7PA 5FM4A 2ZUUA 5IROC 1IL1B 5E1HB 3HPLB 5CJBA 2NY6B 1DBJH 4Y2OA 3DX9A 2VZ3A 1QFWL 3LN9A 4X6DA 2AJUH 1P6FA 3BESR 5KW9L 2QKIB 3SDXB 2QSCH 3NGBC 3O3UN 4HF5H 3WSQL 4ZAKB 1I3RB 4BSWA 1T20A 3VD7A 1FNAA 1YUHA 1I9IL 1JK8B 4OLYH 4R90L 4EUPH 3BXNB 3ROLA 2YRZA 3HNSL 4YDVA 2I60L 2IFFH 4YEEA 2PF6A 1QFWM 3RVWD 3HI1B 4XNMA 1JP5A 4G9FE 4QCIA 5DTFA 3L3HA 3H2WA 1MCJA 5LWYH 4GRLA 1CWVA 1NKOA 1K9TA 4Y5XB 4R4FL 5CSZA 3SE4C 4OZIB 2CD0A 4CW1B 4OV5A 1J8HB 4NQEB 4R96A 4JZNB 4YPJA 3VXUE 3FB8A 5D1ZD 5FCUL 4G42A 1CE1L 5DD0H 5EBWB 1M71B 3MA7A 1F3RB 2IQ9H 1F3DJ 2NY7L 2VIRB 4F8TA 1XGUB 2V9QA 5F89B 3NZHH 1QKZH 3W0WE 3O6LH 3HB3D 3TIDB 1JTOA 3QCTL 2BSED 4AENA 2E27L 2IF7A 1K5NB 4HS3A 4XGZB 1A7OH 4X6BB 2N4IA 5T3ZL 4IRJB 3CH1A 3EJYC 3H3BC 3FQNB 4HH9B 1S5IH 1N2RA 1A6AA 1MJ7H 3S35H 4ZD3L 1QVOA 2P5WD 3RI5K 3W9DA 5DD3H 1EEYA 3O6FA 3KPLA 1KJ2L 5JW5B 2RR3A 1MRFH 1G84A 2VR5A 5CINL 2DM3A 3FKUS 5E2UL 2XZZA 1QR1B 1WGOA 3BVNA 3BX7C 2HLAB 3QG7H 4CVXB 4U7SA 4NHCL 3WS3B 5ADOL 5KSBE 1DEEB 1TNNA 3NIFE 5BV7L 3BFOA 3UTZA 5HGBB 5SWZB 1OGTB 3E6HB 5BMFL 4JDTH 2G5BA 4UQ3A 4NM8L 4NN6C 5DRXA 4HUVB 3UYRL 5MEOB 4ZPVA 3S8WA 1FL6A 4PJDA 2AJYL 2WWKT 4I5BB 5HI5D 1SYSB 5JO5B 2A9MH 1X4YA 5DEZA 5D1XB 5I71B 3NIGE 3N9GH 3D9AH 3RL1A 2HA1A 3OB8A 4UOJA 1W72A 1YJDH 1NFIB 1NEUA 2KDGA 3L3JB 1NCCH 5L2KD 5TGBB 2BSTB 2J8UE 1P53A 1FSKC 4TSCL 3I6GB 4PREA 1CT8B 2YC1A 5I73B 3CSBA 2GSGA 2MPAL 4EUPG 2R0WL 3G6AA 2YWZA 1A1MB 3D0VA 1UJ3A 3G6DH 4ZUSB 5E2VH 2FO1A 1VFMA 1M1SA 1BIIA 3JV4B 3WV0A 1Z0NA 4OT1L 3K8LA 3H6JA 4PYGA 1FVEB 5JQHC 4Z5RA 5ITBL 4GMTH 3UTQB 5I1KH 3VH8G 3CGTA 2ADIB 5IVXA 4Y4KC 4AJ0A 1BWWA 5IVZA 4F7MB 4PJFB 2VXQL 5GS0H 4BQ9A 3FT3A 1MVUA 5HGGS 1KN4L 4QXTB 4NQXA 1RVFH 3LEVL 4H88H 5J9PB 1MCOL 4RQQB 2ARWA 2NXZC 2FRGP 1HXYB 4ONHA 1KIPA 1IKFL 1P1ZA 2NY4D 5DSCA 3P30L 2DWEA 4DAGL 1T2JA 3VXMB 3B43A 5A16A 4U33A 4EDXB 3DX8A 4DQOH 1DBML 4D0CA 3HFML 3LEYL 4QY8B 5EFIA 4XAKE 1VACA 1U42A 1E4KA 4OKDA 3PJSA 1JPFB 4UUJB 3TYFB 3RIFF 1KLGB 1VFAA 2W9EH 5EBLA 3FFCB 2NW2B 4IOFD 2ZJSH 2ITDB 3O4LB 3DTXA 1NH6A 1JMZA 1JWUA 1UXWA 3KPSD 4MD5B 4JFDD 1OM3H 3N06B 1B4RA 3REVB 1QUNA 4K9EL 3IDJA 4U0QB 1AE6L 4GRMA 3ZDXF 2FLRT 2FYYA 2ZCHH 2Y36H 4FRWA 2R2HA 2FIRT 4JQXA 4O2FB 2VAAB 4LLUB 4L4VB 3VFWA 4PJBB 2A38A 3EYVB 1G7HB 3GSVA 2IQAB 4TVPD 5KOMC 4P3CH 3ZE0F 2FCBA 2V5SA 3ILQD 2PTVA 4LHUG 3TV3L 2E6PA 3WFDL 5ICYA 4YX2H 5J12B 3GIZL 1MQKH 3FQXB 2VDLH 1IILE 5HI3D 4KTEL 1JPSL 3VMPA 2GTZA 5H94B 1K4CA 3QFJB 2Q7YA 3CXDL 2Z4QB 3RJQB 1AXTH 4GO6B 5CJ8A 5C9JA 3P11L 5I1EH 3PWLA 2CJUL 4JN2B 3MV7E 3ULUH 5IJKA 2IH3A 5ALCL 2XWBA 1G1YA 2IBZX 1R24A 1RUKH 3S3SA 4XCNB 1UT9A 1WC7A 3QAZC 3SDAD 5DMKB 1TVBA 2Y07L 3ELAT 4L8BA 4M7LT 3ZSTA 4HPYH 5F3BB 4EI5A 2I25N 4YXKH 3BKCH 2B4CH 3G9VA 3PWJA 1B9ZA 1TJHL 3IFOB 1EO8L 2NTFB 3KJ6L 3GBNH 4Y16B 5CJ5A 3SCMA 3ZDZE 1Z3GH 1BBDL 1F8TH 1UWXK 4PV8A 3A67H 3RDTA 3SDXF 4UOW1 4WTZA 5IV2B 3OR6A 5EO1A 5D5MA 1TETL 1CFVL 4HK0A 3NCEB 4JEGB 5CD3A 3KS0H 1MHHB 5KSUB 4JHWH 4IDJL 4OD2B 4GW5B 3WNMA 3ORJA 1G7IB 1NSNH 3T1FB 4F57H 2JTDA 5JPMA 4W6YB 1WLHA 5L8KB 4M4RA 1CFQA 4M9PA 2EDXA 1A4KA 4HS6B 4HGMA 2VDML 4WWKA 4N68A 1FNGA 1WTGT 4KKBD 1SJVA 2OS7A 1A4JB 1Q9KA 2WWMD 5DC0A 2VERN 5K9OB 1JF5A 5GISH 1EHXA 4QHMA 1WCBA 4LASH 3T4YA 4EN3D 2YBRB 4OZIF 1CIDA 2BNRE 1MF2H 2CUIA 1EAPB 4K07A 5C0JA 1EFXD 5T1MB 12E8L 2N1KA 4JKMA 1NFKA 3CK0H 1NAKH 2VITB 4YHKH 5CP7A 1CD9B 4M93C 4KK5D 1KJMA 1U8LB 4JO2L 3TZVC 5B8CB 3KJ4C 5C09D 1XF2B 4FTVA 3KLAA 4M6ML 4OSUH 2F58H 2Z31A 3JTTA 3S37X 4C55A 1MWAH 3DYPA 5EU6E 3V4VH 4QRUA 4Z7QE 1DVFD 4H25B 4MHHI 5K9KB 4K3EL 4I13B 4OD1H 1F2QA 3PDDA 4GKSA 1WICA 4H0HB 5GS1C 4CL7A 3F7VB 1RU9H 5TE7L 3FO1A 2WBJB 4MQXC 2G9HA 1DN0B 5D96B 4PTTB 4PG2C 2H6PA 1BBJA 4WV1C 5IG7A 3IVKB 1A1NB 3VWKD 3WIIH 1GPOH 4DGYL 2XKNA 5H35B 2VDQH 3MRNB 3BIKB 3RX7A 4MNQA 5DHYA 1JV5A 5JHDB 3CX2A 3VRJA 5CEXA 1E4WL 1ZANH 3ZL4L 2F53B 3GMNB 3H9ZA 4RGMC 5ISZD 3RZWA 1PZ5A 1K3IA 2ICEA 4G6AD 1C5BH 2AJ3A 4XCCH 4ZUWB 3BUYB 1BFSA 1OAKH 3ARGA 4RSVA 3MRCA 1KJ3L 1D3CA 2LE9A 1MCEA 4XNZC 3TBWB 4E42B 4LIQH 4XVTL 4TUOA 3PGFL 1UH3A 4OIAA 4K8RH 1MNUL 3C6LD 4JHZA 2EH7L 3QEUB 1PKQE 5EB9A 2D4DA 5LBSL 3WFCH 5DEFA 3HE6D 4J7RA 2LU3A 4PB0H 5TH2B 4ZXBA 1IT9H 3QQ3A 2Q1EA 3C87A 3GZKA 2EYTB 4C59B 1YMMB 3TVMB 2R1YA 4QOKD 4LSPH 2EO9A 4GMSL 4JFOB 2NNAA 3QCVH 4HULB 5HSFA 2NZ9D 4LSVH 1W8OA 3FQTA 3S34L 1TZIA 5ID0B 1RJYA 1UWEL 3EYUH 2V2TA 5I30H 4YNYB 2HKFH 3HRZB 4AMKL 4XAWH 1N4XH 3WS6C 3ULVD 2DN7A 3C60D 4LVEA 5HHVL 2ZOLB 5C0CE 3ABZA 1UYWH 2CXKA 1RZKL 4P46C 1K3ZA 4S1QL 3TN0C 4PJ7E 2ITCB 2BFVH 1A0QH 5IR1A 4S0TD 4X4YB 1BOGB 2YUVA 1AD0B 2CRZA 5HYSA 3ULUF 1GOFA 3DIFA 1IEAA 1X6NA 2IPTL 3QUZC 5HGAB 1TJIH 4YDKH 1FDLL 3SGJA 3BEWB 2BVPA 2G60H 3LDBB 2FGZA 3QQNA 5GZNC 5KVFH 2PCPA 4I0PD 3RY4A 4FG6C 3TJEL 4W70A 5E8EB 1S7XA 3FO2B 4DZ8A 1I3GL 6FABH 5HYJB 5F1NA 4WEBL 4AG4L 5F7DB 1C08B 1ES0A 4RWHA 4RBPH 3WXVL 3NCJH 4M6NL 3VGFA 3MNWB 2FWOA 1KPVB 5CP3H 5D7LD 1NDGB 4FQIH 2WAHA 3T77B 4HGWA 3FO9B 3TGXA 3BJ91 2KPNA 4N5ED 2XKSA 4P59H 3U48A 3TT3H 4UAOB 5KSAC 3LQAC 1DBBL 4H1LA 4JG1L 5B39A 1AGBA 4CVZA 3DPBA 4PJBF 2Y06L 1TCRA 4LLMA 4OCSL 4XMLL 4JRXB 1KLFA 2ESVB 5C0BD 3IAQA 3QEQE 4A6YA 1X5YA 3QDGB 4Z0BH 5DEGB 5JQ6L 2RB8A 1G7QB 3CFEB 3T3MF 2FO4B 1MJUH 1CZ8H 3KPQB 1F3JA 4BH8A 3B9KC 3L5XH 2BXZA 1R3LB 4O5LH 5E9DE 1Z0MA 3UDWA 2E7MA 2F54B 4MLIA 3U1SH 4CAGA 4Y1AE 5LJYH 1KNOA 4C58B 5IHZB 3TFKD 1CQYA 4PJ8D 3HS0B 3V6FA 3WL9A 5CCKH 5HHXH 2MHAB 4KMTH 4QTIH 2XNAA 2DLIA 2EDBA 4NZRL 1S7SA 1VGKB 1MFCL 1OTSD 3DX6A 1A6VH 1YEJL 3ET9F 4PUBL 3RY6A 3PWNB 2NW3B 3FO0L 1D9KD 4KMLB 1GRWA 2ZOKA 1X5LA 4RMSA 4UTAH 1F6AA 5J6GA 3MLUL 4JZJC 2MTPA 5GJSL 5BS0E 1UENA 4XPTL 1P6AB 4KKNA 1XIWD 4PD4J 1XAUA 3P77B 5I18H 3TA3A 4JO1L 4NP4H 3UXFA 4KU1A 4ORZC 5GRJH 1ITCA 3C8KB 4Q97A 3PNWB 4NQCE 2ZUTA 3V0VA 5D7KE 2QQNL 2PN5A 5BCAA 4M43L 4LDOB 3QXDA 1T83A 1PSKL 2HWZL 2X4PA 5F7EL 4NKIL 4NYLA 1IAMA 5EZOL 3MRGB 4KTYA 1WBYA 3DURA 3IDYC 1F58L 4FP8L 5T1KB 3U9UA 3OWEA 4G6KH 3VFNB 2OL3L 2X6MA 4OZHE 1YEFH 4Z95L 5CBAA 3VJ6A 1QRNB 1RUML 1T22A 2WWKO 5C7XL 4EEEA 4RGOL 1NC2D 1SM3L 3T65B 4Q9RH 3VXSE 1YN7A 5J13B 3IKKA 4P23D 4QRSA 2AI0H 5ERWA 3V0AC 5IESL 3LS4L 1ACZA 2BSRB 4IOIA 4OF6A 3SKNA 3FB6B 1NBYA 1DEDA 3TYGH 4L8SB 4F3FA 1AC0A 2DQUH 2B0SH 1U8KA 3SEPA 4WDIB 4QHLB 3UZQA 5FGBC 1X4XA 1ZAGA 3NABL 1G7MA 3M17A 2PXYA 4NKMB 1TQCC 1UB5B 2WV3A 5IMMA 2LV4A 1TQCB 4NCC1 1IM9D 2XTJB 3PP3H 1ZS8A 4TNWK 4GRWB 4KI5D 4OIBA 1A6UL 3DVGA 3MRJB 3AREC 4K94C 4C83A 5FYJU 5FEBA 1FIGH 4DKFL 1MIEL 4F80A 3RGVC 1MOEA 2RCSL 2XWTB 4WI4A 2I9TA 3K1KC 3CPLB 5H8DA 2Z92B 3ZZ1A 2V5RA 1KENH 4AM0A 1VPOH 5F7FA 1DBJL 2WQRA 2AJUL 3O3BA 4B7LA 1JZ2A 1TJGH 3IXAB 5DJ2A 1OT1A 2EEAA 4DFIA 3CDCA 2QSVA 2OZ4A 5EOCH 1X5AA 3BW9A 3IF1B 1JNHB 4ZTPH 2H2SD 3LKRA 3O3EA 3VDCA 4ZQKB 5HPMB 1MJ8H 3VD4A 4HIIB 3BDYL 3IETB 4D9RE 4WUKL 4JY6A 5MEND 1F3DH 5F7HA 4YZFF 4MQ7B 1BOYA 3PWPA 4GBXB 1CVRA 2LVCA 2OL3A 3MRMA 3S36H 3UTTB 3RTQA 3DV4B 2XKUA 3BP5A 1B0WA 4KQ3H 3MLXH 5KVEH 3FMGH 1BVLB 1X3DA 3KWWA 5DK3A 5B38B 3QEHB 1S9YA 1WT5A 5IB1A 2VXSH 3MLYH 4E0RA 1S9VA 2UZXB 1NCAL 4OCMC 1IC5H 1IGIH 1WZKA 1KCSL 4N0YH 4CU6A 5D1ZC 3RWHA 1XFPA 3HG1E 3TBTA 4LLWA 2X1PA 1B2WL 1UZ8A 4O4YL 3SDDB 5EUOE 3HB3C 4GG6F 3B8SA 3BGAA 3EHBD 3U9PH 2WINA 5J1SC 4QRRA 2IJ0C 1NAML 2VN7A 4GRWH 5GIRB 4XNYH 3L3GB 4YK4B 5F9DC 1P2CA 3QHFH 5GQBA 4CDHA 2PO6A 4IIQA 1T1YB 1Z5LA 5C71A 1FGVH 5L0QC 3VA2C 1S5IL 1HILA 2QR0B 3E8UH 1PX4A 1NCTA 3KPRB 3NA4A 4XBEH 5L8JB 3QRGH 2D31B 1PG7L 1MRFL 4HBQA 3VGEA 4LPXA 4GKZA 2IALA 1HHIB 4K7FA 1BD2A 2DYPA 3QG7L 3UJIL 4LLDB 3KYMB 1CLZL 3EO1A 1IGJA 4YHOH 5FKPA 5HDOA 3DHMA 3CMGA 3T0EA 3U6RB 5HVFB 5EORL 3KLDA 3LPWA 4ZG1A 5I1HH 4PRIB 1MREH 1UFUA 5HYQA 4MCYB 2I27N 3BWAA 1PVHA 2AW2A 4NNYB 3TWCL 4EI6A 2H8PB 1IVLA 3T4AB 4X98A 2C4XA 2WBKA 5D8JL 3MFFA 5CIPB 4HWNA 3RAJH 4AQ1B 5SWSB 2A9NL 3GJEB 3T2QA 2A9ML 5D7IF 1HOCA 1A64A 4Q58C 3ZT6A 5IB2A 2R1WB 3BO8A 4P2RE 1UH4A 4X9FA 3D9AL 5C08D 4KROB 1JGVL 3UTPE 2XQYK 3HC3L 1YY9D 5EA0L 1XGQB 4Y2DC 1WAAE 3NCBB 2B20A 4Y2DB 1YDPA 3TJHD 3MYJA 5HVHB 3MV9D 4NKOB 5DMYA 5JLZB 4X5XB 4MAYA 1KYOK 5E8NA 3ARWA 2HJFB 3S3PA 1LGVA 3RVVC 4F58L 5C92A 3PHQA 3QIUD 5E2VL 1QPPA 4HDIB 5BJTB 2AXHA 1UM4L 1QEWB 3C5JB 3U7YH 3RUGB 2DQGL 4RFOL 4MXWH 3Q2CA 3QUYD 5GGSA 5TDPB 5EU4A 4B50A 2NY1B 3QIWC 3MLSL 4H5SA 4KVNL 1I8LA 1YMHB 3FQUB 1JNLH 4NNXB 2NR6D 3WD5H 1IL1A 2Y6SC 3HPLA 5IROA 2GY7B 4JKPH 2P5EB 43C9A 2CO7B 4H88L 5HHQB 5GGVL 1S78C 2F5AH 2QKIA 2G75B 1TTGA 3SDXA 5JOEA 4Y19D 3X13A 4D9LL 4HKBB 5E2TL 5I8OH 4ZAKA 1I3RA 2X89A 3BZFB 3MCKB 5INDB 1A7NH 3OG6B 1JK8A 2Q76B 3DETC 1EHLH 4K23L 4V1DB 3IJYA 3QUMB 4L3EE 4KRPB 4PGCA 4F9LC 2VXUL 3HI1A 4IOFC 1DL7L 1EH9A 1JF1B 4FQ1L 2FBOJ 2JCCB 1T6WA 3HAEB 3RGHA 2CPCA 4MX7B 2YK1L 4Y5XA 4Y7MA 3SQBA 5HHOB 4OZIA 4AEEA 3VXTB 3SJVE 4CW1A 4NQEA 3THML 4RX4D 5E08H 2VYRE 4JZNA 4ZFOB 1CXEA 3EYQC 5EBWA 5L2KE 1M71A 2VIRA 3HCVB 1XGUA 2X10A 5F89A 2Q3ZA 2ZSVB 3X12B 1K6QL 1WUNT 5CZKA 3GKWH 4K3GA 3MQIA 3MV8D 3TIDA 3GIVB 1DSFH 3ILQC 3VFMB 1NCBH 1MAMH 4LMQE 3C5SB 1K5NA 3MJ8A 4XGZA 3QB7C 4X6BA 4YX2L 1J7VR 4XXDB 3CNKA 5HI3C 3RIFK 4IRJA 3FQNA 1CXKA 1DBAH 4HH9A 1FYTD 3I85A 3PL6D 3IAGC 4Y4FB 5FGCE 2W0FB 3QZWG 2X9YA 1YQVH 4CNIA 5KS9F 1U91B 5JW5A 2VQUA 4MNHB 3SQOH 4HUUA 1QR1A 4P2OD 3ULUL 5CZXC 1ZWIA 2HLAA 2VLRB 1J11A 1F45A 1RUKL 3MBEC 4CVXA 4NKQB 3OQ3B 3WS3A 1DEEA 3GHBH 2GITB 5TJWK 1BHGA 2ILLA 4FXLA 3MACL 1RUAL 5SWZA 5HGBA 5D70H 1OGTA 3SKUD 4LDEB 3BPNC 3E6HA 4Q6IB 3HZVB 4JFHE 4YXKL 2F19L 2RBLA 4HUVA 2PETA 5GZOD 5MEOA 3BH9A 2D7OA 1IC7L 4ZTOL 1Z3GL 4I5BA 4CDGC 1VENA 1X5JA 3A67L 2E7HA 1IGTB 1SYSA 5JO5A 2DQEL 2XA3A 5D1XA 1LO0L 3CZFA 4BQ8A 5DFTA 4NO0B 4I4WB 3QXVA 3EDKA 2CGRL 1I85C 1NFIA 4RGNE 4NN5B 1T0PB 1RUQH 4IHOB 4JFDE 4JHWL 3L3JA 3EZJB 4PJ9D 4XP9H 5B3JE 5TGBA 1NC4B 2BSTA 1T4KB 4F57L 3I6GA 3ARPA 1CT8A 4X8XA 2DM7A 5L6YH 1T89C 5C2BL 4G9FB 1LD9A 3D85D 4HKJB 4KKBC 1A1MA 5DGRA 4ZUSA 2WWMC 2YD1A 3JV4A 5GISL 3BPCB 4TVPE 3VG0H 1FVEA 5J1TC 4EN3C 3EO9H 3TPUB 3UTQA 4BFIB 2VB5A 5ACZB 5D93B 5JZ7D 3INUH 2C9AA 3SGKA 2MCPH 2EDWA 2W65B 4RISL 3VXUB 2ADIA 4LSDA 1VGEL 4YHKL 4KK5C 4F7MA 4PJFA 1JL8A 4N8VB 3BQUD 3VFTB 4OSUL 4OIIL 4QXTA 3BP4B 5CZVH 2F58L 3W0WB 5J9PA 1OB1B 4RQQA 4XWOC 2J88L 3MRLB 1QFOA 1A14H 1T2QL 2BNQD 4PRNB 1HXYA 4OQTH 3QCUH 5ILTL 3QPQD 1JZ4A 1DVFC 3N1MC 5DFWH 1AI1H 4OD1L 4WFGD 3OKNB 1A7PH 1A3RH 1T3FA 3DUSB 4EDXA 4HH8A 4OF7A 1E4XI 1FC2D