4Z7VA

L3-12 complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
180
structure length
180
Chain Sequence
VADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class II HLA-DQ-alpha chain
publication title Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 180
sequence length 180
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7vA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4z7vA01
2AGJL 3O8XA 2F54A 2KL6A 4U49A 4QHLA 3BD4A 4I2XE 3D6GA 5BRZA 1AD9B 2B39A 4JQXA 3VFMB 3WD5L 3SGDH 1TMCB 4XPHL 4RGOH 4N68A 3MRRA 4HFWB 5DQDL 2GT9A 4XCNB 4JRXD 3OX8A 2R2HB 3D48R 1XR9A 2P5WE 5HPMB 3J7HA 3ARSA 2OI9C 3QNXA 5TQ2L 2R2EB 3RUGA 1LP9E 3L1OH 1QZ1A 4X9HA 2B5IC 1QFWH 4YGVB 1GGIL 5KSAA 4L4VB 4I0KA 2IALB 5GJSL 1SY6L 4DGYL 4FQJL 2PF6A 3HMXL 1BX2B 5EWIH 2W0KA 3JZ7A 1KTRL 1UJ3A 4LGRB 2ICES 4PRDA 4JZJA 2I9LA 4HX1B 1IM3B 3IKCB 1G7QB 1UXWA 2IMMA 3RIFK 1F13A 1JNNL 3SE3C 4XWGL 4LVNB 2Z9TA 1R3IL 4NGHL 5JUEL 1VGKB 5KVGH 43C9B 3BZEB 4IHOA 3E8UL 5E8DH 1XH3B 1L6XA 2VDNH 5JPMA 3LQZB 5F3HA 1EAPA 5IFHH 5HYQA 4U1LB 2ESVE 2FL5B 3QIBD 4X4ZA 3OJDB 1SJEA 1JYVA 1YDPB 1I85C 4IMLB 4NIKB 3HI5H 4PJDB 1QO3B 4HWEL 3EO1B 2PO6C 3AB0C 4RZCB 4PUBL 4PJ7A 3S37H 4UQ2A 5DYOB 4M9OA 3SJVA 2AP2A 4XMKL 3FFCA 1PG7X 4PB9H 4IMKA 3C09B 5GIRA 1EHAA 1JGUH 1XGUB 2BSSA 1TZHA 1HH6A 1IGML 5IMLB 4MYWB 4HEPG 3W2DH 1CDYA 5T5NF 3FFDB 2PYEB 4LCWE 2BNUB 1LO0L 4CL7A 3JV4B 5E8PA 5F1OB 2OR7A 3U4BH 4RX4A 3VDBA 1U8OB 2GK0B 1J12A 3MGTB 2CIKA 1JHTA 1BQHB 4UOJA 1NCDH 1NCAH 4O00A 4XAWL 4GBXB 3LS4L 5EZIH 4X8JA 5DHVH 4M8QB 5GSRB 2HT2C 3WFEH 1IJ9A 1MAML 3NIGF 4GSDH 4K3DH 5GS1A 5IHUL 5ALBL 2J1KA 1WZMA 2IAND 4BM7A 3GRWL 5FEBA 4L8DA 2IQ9L 5F1NB 1T04A 3WIHL 1I1YA 3VCLA 1H8OA 4OBSA 5BS0D 2CUIA 3V4VH 5JORA 4GXUM 2YUWA 1DVFD 3X11B 2OS7A 3BWAA 4P2RD 3CCHA 1ZT7A 4F7CB 4OIIL 4G9FE 4EN3A 5J6GA 4QRPE 1RJZB 5L7XH 1A6WL 3GMQA 3S35X 3VXRA 2PNDA 4ZUTB 5J6HA 3TBYB 4NQDD 1FAKT 4DGIL 4U6YB 4WHYG 1HKFA 1OGTB 3RNQA 4YDVB 4NHCL 4P2YA 1CD1B 2CRZA 2JB6B 3HKFA 3DVFA 4KQ4L 3O3EB 2MCPL 3SQOH 3WLWD 3BGFB 5D6DA 4HZLB 1NKOA 3NIFE 1BQUA 5ICZA 1CXLA 1U2HA 4PLNC 4JHAL 1NFDB 4JFEE 1X5XA 5FYJE 2AXFA 4NO5B 1U92A 3KYMB 3KPOA 1CU4L 1PGRB 1XEDA 1YMME 3DO3A 2FX7H 5T3XL 5JOFB 2V9QA 3INUH 3MV8E 5CBAB 3V6ZB 1AI1L 1CICA 3PG2A 2FWOB 3T77B 1TJGL 4YXLH 1WCBA 4PJHB 1U3HD 4M3JA 3SDCA 5GGUB 1FO0H 2KPNA 3LKPA 4R7DA 1F3JB 1RHHA 2NW3B 3ARBB 4M7LL 2FX8L 3U46B 5E2TH 1XF2A 1T1ZB 4Z6AT 4XVSL 3DTXA 1A6AA 4PGDA 4QHMB 4JQIL 4LSVL 4CN6A 3ZE0F 3RWJB 4ONHB 2WWMC 1HNFA 5EO9A 4N9GB 5GS0H 1R5VA 3L3GB 1NDGA 1Q94A 4PG9B 3TFKC 5FYJH 3SGKA 1BPVA 1V7NL 2R1WA 3LDBC 1QBAA 5D1XA 4YHZH 1X5YA 4HIHA 4JEGB 1S78C 3DXAA 1SHMA 3DGGB 4OI9A 2P1YA 1D5BB 3PL6D 5KS9B 4LSSH 5KVEL 2Y7QA 2GCYB 3D25A 4KVNL 5JQ6L 1I8LA 2XWBA 4HIXL 4NKDA 3SKUD 3QQNA 1ZLWH 1CK0H 2EYTA 1AQKH 1IKNC 2X4SA 4P3DB 4N90E 4WO4C 5JHDD 4MNHA 1G6RL 5CCKH 2XNAB 4PY7B 4WU5B 5FUCE 3KPMA 3D2UA 1OAQL 2EE6A 3O9WD 4FFZL 1HINL 1FP5A 3U1SH 3BO8A 5KBNC 3ARQA 3MJ6A 5IMMB 2E9WA 2R9HD 3B2VH 4YEFA 4Q97A 1JGVH 5T5NG 1I1FB 1WK0A 4X6CA 1A1OB 1MF2H 2L7JA 1DQJB 4JREB 1YY9D 5F89A 1I9IL 1FH5H 3MUGA 4I3GA 1FQ9C 4KTEH 3ZSSA 4JRYE 5F7LB 3ULSA 3QSKB 3BHBA 4U7KA 4BH7B 1E6OL 3CZFA 4IRSC 3HPJB 2N4IA 3QHFH 4Z78B 4PJCA 3H8NA 4FQIL 1RFDL 1UZ6E 4I9WD 2XA8L 4WHDA 5EO0A 3VXOB 4ZDHB 2H6PB 5FV1L 5I8CA 4U1IA 2GUOB 3ARVA 5IG7A 3HUJE 3OV6A 4X9IA 3QQ9C 3CX2A 1P2CB 3AREC 2E7BA 2RB8A 1JHKL 3BPLC 1P7KA 3P4NA 1QACA 5L8JB 3U2SB 2ZCHL 1KYOJ 1MHHA 4WFFE 5KSBF 4J4PA 1TQCB 3IDGA 1YEJH 4PJGA 2WQ8A 5D7JB 4KMLB 3RVVC 25C8H 1FV1B 3OXRA 4NYLA 3VXME 4N5UA 4HC1A 3H9ZA 4PV8A 4OF5A 3VXNB 4A6YB 4JKPH 1SYSA 1DN0B 5EU5B 2NY1D 5IB5A 5MERB 3M45A 4AIOA 2FHCA 4LLVA 4IS6B 4UTBL 3ZKMC 4FFWD 1TLKA 1JMZA 1NCCH 3MCLL 4AH2A 1DN2A 2CDEB 1N2RA 3GI8H 5D8JH 2ITDB 3KPNB 4M03A 4Y8AA 4OGAC 4U6HA 3QDJE 4RRPA 4HIIB 2ZSWA 1FAIH 3WKML 2OCFD 4JM2D 2FZ3A 4ZYKB 3GIZH 3VWKB 1TENA 3RY6A 3TBSA 1M05B 2YMXL 2EYRB 3DWTA 3BGMA 3RJDA 1NMAL 3MREB 5GGTH 1KJ2B 4PRHA 3FTGA 1ND0B 2X9WA 1J9CT 1BOYA 1MCIA 2NY4C 3QI9D 3DX6A 1SBSL 4FOMA 2ADIA 3MRHB 1KF9B 4TSAL 1U8JA 3EDKA 4Y4HD 3T0AA 5TH2A 4TPRL 5I66A 2EDEA 3CZJA 3MLYH 1YEGH 4GRLB 1S7WA 2FATH 4OGYH 1Z3GH 1WBYB 1IC7H 3PF2A 4TYUA 1EERB 5F3BB 3U0TB 3L7FA 4O2EB 2B7DT 1AY1H 1HHIA 2CKBB 4I0PD 4PY8J 1JZ6A 1NGPH 1GOFA 1KLGA 3V7MA 3OKDA 4LMQE 4Z7VF 1ETZB 5J4MA 3GMLB 5I15L 2FJFA 2O61A 4ALAH 3HC4L 3L3HB 2R8SH 3IFNH 1DTUA 3SE9H 1ZVSA 4KJQC 1DUYA 4PRNA 2AJSL 4H0HB 3P4OB 4XVTL 4IJ3C 1R3KA 5J11C 3HAEH 2LTQB 1QP1A 5C09A 3UZEA 2D0GA 5JMOC 3HNSL 3S36X 5TFSH 5C8JA 3ARDC 5TJWK 4KJPC 3QUXC 1NAMB 1S7VA 2XRAL 1ZGLM 4XP4L 5IBUG 1KV3A 4W4OA 3KPRA 2I26N 3K4DA 3KPTA 2I25N 3SKMA 3BAEH 4O58L 5C2BL 4V1DD 4XBPA 1TZGH 3HE6B 35C8L 3B9KC 3GGWB 4HBCH 3SDDC 2HJFA 1UM6H 4M48L 2G9HB 4FQXC 4QYOA 4M7ZB 3C5ZB 1HH9A 5TE4H 1I7RB 5JXED 5HGBA 4Y16C 5KJRH 3KXFB 1Z2KA 5DEZA 4PJXB 4Z7NF 1CL7I 5GRXG 2LVCA 4ZS7H 1AGDB 1OSPL 1FLTX 4P23A 5EZJA 2X4NB 4DEPC 2ADJA 1U8MB 4HV8A 4EDWL 1LO4L 2R69L 4MCZB 5GJTL 4JO2L 5H37G 5TE7L 3MGOA 3OF6A 5E00A 2R4SL 4MJIE 2X4RB 4DW2H 1YPZF 2XPGA 4WFEE 5TGBA 4KVCH 3FQTB 5DQJA 1SQ2N 5ALCH 4XP1H 3GMRB 2X70A 5ID1A 4M43H 3BVNB 5KSVA 1IC5H 5HD8C 1UADC 2D2OA 1FBIH 5D7SH 5DR5H 5DS8B 4JFFD 3UP1A 2H1PH 5TDPB 3SPVB 2AK1H 2YSSA 1KBGL 1T2JA 1LE9A 5LAXA 4ZFFA 2Q76A 2Y5EA 3PWJB 5BVPH 1MCOL 1U8IA 4S1QL 3TJHD 1OGAE 2AK4E 4H25A 3U9UA 4H5SB 3VRLE 3IDJB 4CVZA 1M7IB 5FKPA 3IFOA 1OAUH 4OV5A 1KPVA 2I27N 5D1QB 4YNYA 1I1AA 4JY6B 4NNYA 3L5JA 5JNYA 3MRIB 4KK6D 2QQNL 5DMYA 2OJZL 1CG9A 4UIMA 1QFOA 1A02N 3DSNA 1A4JA 2IPKB 4DOHE 1I4FB 5C08D 3ZE2F 2VDRL 5H35A 5K59E 4NBYB 2AV7B 3NPSC 3RDTA 2APXA 5BJTB 2EXWC 4OZIF 1E4KC 5DD3H 3O4OC 3KLHC 1JTOA 5K9JH 2EDRA 5T1KB 3WN5A 2YD8A 5A2FA 4MXVE 2Y5TB 1MRFL 4YE4H 2OXHA 3GSNH 4IIQB 2BNQA 4O2FA 1HI6A 1OHQA 4RQQA 1OOAA 4FQQA 3BEWA 2MHAB 3SGJC 2IMNA 3VFPB 4ZFZB 3BIKB 3RFZC 2DICA 3WFHA 3S4SA 4YK4C 3TT1H 1NBQA 1IM9A 2H32B 5L9DH 3QXUA 2EZ0D 5HHNB 1DBJH 2DM3A 5ERWA 1YJDL 1OD7A 1MLBB 4ZUSB 4YBLB 5A1AA 4GAFB 3MOBL 2G60L 3ESUF 2AEWA 1WT5A 4NWUL 2BY2A 3VXUE 1U8PA 1K4DB 4ODVL 3E6FA 1A4KB 4QCIB 3C8DA 5IHBA 1ZHNB 5KOVC 5J3HD 3GSXA 1FRGL 5BO1L 3QH3B 2IH1B 4HD9A 4HWBA 3DO7A 4FZEH 4IRZH 1OAKH 4M6AA 5CINH 1P1ZB 3AM8A 5HYJE 5ISZA 3RKDD 4LSPL 1FG2B 4QHNA 3NIDE 1S8DB 1LDPH 3GSWB 4KROB 3DIFA 3P73B 1IAOB 3MMEA 1WBXB 3JV0A 4FXKA 2HVKB 4QHKJ 2XG5A 1NMBH 4FZ8H 1U3ZA 1QFUH 1NAKL 2W65B 5CZXD 3P0GB 3O6ML 1S7QB 3QPQD 3GI9L 3E1F1 3THMH 5CUSH 2IBBA 3MV7A 4NZRH 4DWHA 2BNRB 1BVLB 4FFVC 3L5IA 1F4XL 4MWFA 4NJAH 4A2MA 3MV9E 5LWYH 4PJ5A 5I1EH 3LRSA 3LCYA 3GJFA 3L6FA 3EDDA 2SEBA 5LCVH 4JFPB 1MAKA 4H26B 5I74B 4MD5B 3RTQC 3T0DA 3BRDA 5HVWA 2DLGA 2C9AA 4JM4L 3D39D 4ZUUA 1IBGH 4JGMA 2I24N 3OR7B 1ZTXH 4OLZH 4XZUB 4RFNB 3PABA 4UT9H 5IW1B 4B50A 1CGTA 4GKNA 1DBAL 2XACC 2BHYA 2YRPA 5SWSD 1FHGA 3P2TA 1T1XB 5IB4B 1T1WA 5LBSH 2EEDA 4YEEA 5D2LA 3D87B 4MNQB 2A83A 2AJXH 1B3JA 1GPOL 4JO3L 1KFAH 1IC4L 3ROLA 3V95A 4DAGH 2FYYB 4U0RC 4Q9BA 1HSBB 3X3FL 4P4RB 4U7SA 5DSCA 1A8JH 1RSFA 6FABL 2CRYA 2MSPA 4C56A 1TTFA 3FO1B 3VE0B 1FNEA 5FYKU 2AW2A 3UDWC 1ZOXA 2D03H 4YX2L 4XAKD 3O2DA 4OCNC 3NFSH 1U6AH 5DJ0A 1SJVA 1A9EA 3QNZB 3DBXA 5E08H 1ZS8B 4LARL 3T3ME 1RJLB 4H1LH 1JHLL 1F90L 1MEXH 4GAYA 4XC1L 4XB7A 1QSEB 4HC1L 4PBVC 4HAGA 1AO7A 4MAYD 1WEJL 3W39B 1MRDL 2RFXA 5D7IF 3GO1L 3TVMD 3LMJL 2DDQH 4U0QB 3EOTH 1TETH 3S5LB 1RULL 4DN3H 3ULVL 4WVRA 2O26U 4FNLL 4I77H 2EIZA 2FEEI 4QOKE 4PJ9C 5E94B 4X7SL 5CP3H 4YIQA 3DX7B 4S1SL 1PZ5A 3BSZH 1PYWB 5MEOB 3QWOB 1MQKL 1N5YH 1WWAX 4GRMA 4XH2A 2BC4B 5CLTA 3LKOA 2VLLB 2YPLA 4LPTA 3C8HA 1J0YA 3WJJA 1I9JL 1U8LB 2EH7L 1T2QL 3SDYH 3I6LE 3ZHLA 3P4MA 3TBVB 4YHYB 4NQXB 2D9CA 3T3PE 1HCVA 1D6VL 4HPOL 2C5DC 1H3PL 4OLVH 2OR8A 5JIHA 1ZLWK 4J3VA 3L5WB 3FN0L 4YHKH 1A0QL 4XBEH 4NKOB 3DI3B 5IJVB 1N5AB 1T22A 5JW3L 4QWWD 4F8TA 3CLFH 1VB9A 5DHYB 2X05A 2YXFA 2ZJSL 3MV01 3WFDH 4X5WA 1AD9A 1F11B 3LZFH 1N4XL 4PLKD 5C3LD 1CXHA 2J6EH 4EBQH 4NDMB 3FQWB 4HFWA 1GRWA 2NY6D 3MBXL 4XCNA 2Y07L 4U2ZA 3IVKB 2R2HA 1KIPA 2B1HL 4O02L 3GNMH 5FHBL 1DQDL 5HPMA 2G5RA 5FCUL 3GM8A 4JCMA 2R2EA 4K94C 1RZFL 5MI0B 1BLNB 2DYPD 5JOPD 1OB1B 4Y4FB 1MH5B 4YGVA 5E8EB 3DUUB 2PXYC 4G3YH 2OSLA 1P4BL 4L4VA 3UTQB 2IALA 2MPAH 1BX2A 2B4CC 4CN4A 2QHRL 2EIEA 4HS3B 3TPKA 2WBJC 3D85B 4HX1A 1IM3A 3O8XD 1G7QA 2F54D 1DLHB 1ACYH 1BEYH 3EJZC 3WJLC 1P4LB 4JG0L 2ZUYA 4MQXD 3VWJC 4ODSH 4OAWA 3KJ6H 5BRZD 43C9A 4O4YL 3BZEA 1XH3A 1JGDB 2BY1A 3LQZA 2JCCB 3MGAA 4U1LA 3HC3H 1FZMB 4BSVB 4ONGL 4AQOA 2FL5A 3OJDA 4PJIF 3G9AB 1YDPA 4IMLA 3RKPA 4X6DF 4PJDA 1QO3A 1C1EL 3EO1A 1LE5B 4MA1B 4RZCA 1BZ7A 1KPUB 2VDPH 5DYOA 1RJCA 5EZLB 3UJIH 2R1XB 2EKJA 4WDIB 1ZLUH 1XGUA 5IMLA 3FFDA 2PYEA 2BNUA 3JV4A 2F53B 4KI5D 4OIBA 3C6SB 5LG1A 1AGFB 1U8OA 2GK0A 1REIA 2VLRB 3MGTA 5EC1B 3JUZA 3KGRA 4WHYH 1BQHA 4GRWB 3KDMB 3PHSA 1A1MB 3QAZC 4HT1H 5FGRA 3A67H 4G6MH 1WITA 5GSRA 2WUBH 1TQBB 4N5EC 3B9VA 4Y88A 4U7MA 4JPKH 4D0CB 1NBYB 2D7TL 5F1NA 5GS3A 4ZOCA 2XWTB 3MLUL 3DETD 1CIDA 4S1RH 3M17B 4LU5L 5IMOB 5JR1L 2E6PA 3SJVD 4OCLC 1EO8L 4JN2B 4NFBA 3KWWB 1OF2B 3FFCD 4YQXH 3X11A 3MYJB 1DL7H 5KN5B 1FPTL 1RMFH 5I73B 4F7CA 2NTSP 5BZWB 4ZS6D 3PDDA 1I7UB 1RJZA 4A2LA 4G9DA 2RJMA 4TNWF 2PTUA 4Y1AD 4ZUTA 3TBYA 3MFFB 4RX4D 1FE8L 4DQOL 3JWOC 3F58H 4X7FC 3EO9H 5E99H 1BJ8A 2B2XH 1P9MA 4YDVA 5I1JH 1WTLA 1EHLH 2JB6A 1NPUA 5F9WB 3CPLB 1ZHLB 2YD9A 1RUKH 4R4NC 4ZTOH 3T0EB 3BXNB 1RD6A 3V5DB 3O3EA 3UO1L 1P6AB 5C0ND 3CK0L 3R8QA 2ZUXA 1LILA 2AJVL 5FXCH 1N6QH 2JK5B 4HZLA 1TJIL 2P7TB 1MNUL 5E4EC 1H3GA 1NFDA 1XCTB 4KJYB 4D9LL 1PZUB 4F7PB 1XZ0B 3RQ3A 4MA3B 4NO5A 4GAJH 2EKSB 3EW3B 3KYMA 5GZOC 3VGAB 5JOFA 3RWIB 3I3BA 3TBTB 3GK8H 3NIGE 4EN3D 3QUYA 5CBAA 1HXMB 2FWOA 3VXRD 1RZGB 1CLCA 3QRGL 3T77A 4YXHL 1GGUA 1L9MA 4PJHA 1DDHB 2OL3H 3F5WB 5GGUA 4MAUH 1F3JA 3ARBA 3NFNB 5IJKC 1HHHB 3U46A 1HE7A 3R1GL 1T1ZA 5HBBA 2DS4A 4QHMA 1MFCH 3TYFB 4PFEA 2FD6L 3RNKB 1IEBB 4I2XB 1EVUA 4HWBL 4N9GA 4ODUA 1KPRB 4PG9A 2GYSA 2P46B 2ARJB 5TF0A 5JW5B 3BT2L 4R2GB 1K3IA 1YNKL 4TNVK 5I1CL 3DGGA 1F3RB 1MVUA 4HUVB 3HRZB 5KS9A 4ZSOE 2P5WB 4Z8FL 2DQEL 3FB7B 1LP9B 3IU4H 5ECJE 1XGRB 2NX5B 1ODAA 1CICD 4P3DA 4LGPB 4OCSL 4HGKC 3MLVH 4I18B 4QXUL 5IB1B 2XNAA 4PY7A 4WU5A 3VA2C 2Q3ZA 2HRPL 2CGRL 1RZJH 4OUUB 1PW3A 1OAZH 1VHPA 1T5WB 3MRDB 1X6LA 4Z7UB 5ENWB 5CJXA 5IMMA 4KRPB 2YZ8A 1WZLA 3KYNB 1A1OA 5EH1A 5SX5K 4HMDA 4GKSB 1DQJA 1DQTA 1TZIA 5F7KC 5F93C 4AIXA 3AS0A 2ZSVB 1ES0B 4DN4H 4WWID 4X99B 5HHQB 3RIAF 4BH7A 4JFQB 3HPJA 1X3DA 1KB5H 1XF4B 2ESVB 3DXAD 1ZVYA 4Z78A 5EOQL 1KELL 3IXTB 4H88H 2A9NH 3FOLB 3PQYE 1P84J 3LKNB 3VXOA 4ZDHA 2H6PA 3ZE0E 4DKFL 2V7NB 2CMRL 3L7EB 1EX0A 1NLBL 3AROA 3V8OA 3DECA 1P2CA 1DQLL 1FNLA 3D2UD 2J5LB 3U2SA 1LEIA 1QD0A 3CFKA 4QRRB 3MJ9H 4G6JL 3FAWA 1T1YB 1FVDB 5D7JA 3SHSA 1FV1A 1M1SA 2AJ3B 1YUHA 4G8IB 3TN0C 4F7TB 4KRLB 5IHZB 3WBDA 3QEGL 2ICEB 2LFGA 4A6YA 3WXWL 4XNZC 1D5IH 1DN0A 3O2DL 5DMIL 5EU5A 1BQLL 4Z5RB 2AQ2A 5GRUH 5MERA 1KCRH 2V2TB 4IS6A 5EU6A 4ZAKC 4P5TB 5JZ7C 2WWKT 5FYKE 3NCMA 2CDEA 2CR3A 3NTCL 2ITDA 3KPNA 4D9RD 3C60B 1FFPB 5CGYD 2FJGB 2V17H 3VFUB 1U91B 4TTGA 4UIKL 4ZYKA 1KEMH 4F15B 1T03H 2UZIL 2VZUA 1M05A 4UTAL 2EYRA 4WI5A 3SKNB 3MREA 1U9KA 4J4PD 1ITBB 1TCRB 3PHQB 5IVXF 4NM4L 4QRPB 4D0DB 3S88H 1X5HA 4NO2B 2J4WH 2FB4L 3T0WA 3MRHA 4DZBB 1NEZB 1QPPA 4MJ2A 5FYKH 2DL2A 2W9EH 2IAMC 3DJ9A 3P0YH 3ULVD 1E0OB 4GRLA 3ARYA 3VMPA 5DXWA 5KSBE 4Q6IA 4XHJD 5IFAH 1I3UA 2LVEA 4JHWH 5FFLA 5F3BA 1K8IB 1FIGL 4O2EA 1F6AB 3NGBB 4JFEB 2CKBA 3A6CL 1U2CA 3FRUB 5AYUL 4RBPH 5AZEL 3VH8G 4HUWB 3QIUC 2X9XA 1YMMB 5C3TA 3WO4B 4PRHD 3MV8B 5IEHB 1F4WL 2NQCA 3L3HA 1CDIA 2D7PA 4KK8D 1LO3L 3MRKB 4KH2A 4HH9A 1TTUA 4F9PA 1UCBL 1YYLL 3OGOE 3P4OA 4UV7H 1MI5E 4HGMA 3TWCL 3IDUA 5H37H 3DARA 1B0RB 2CIIB 4QY8B 4Q9RH 1NAMA 1HDMB 2DD8L 3RVUD 1H5BC 2WANA 2B0SL 3NAAL 3BKMH 4NQCE 3HE6A 5B38A 3GGWA 1R0AH 4ZXBC 2NXZC 5CLWA 5IBTL 5IM7B 3G6AB 2G9HA 1YEKH 4L8SB 3C5ZA 5DO2D 4OFPA 3TZVB 4ACPA 1I7RA 4BUGA 3KXFA 3MOAH 4H20H 1Q72H 4PJXA 2XY1A 1CDGA 4OCXH 3NZHL 3GBMH 5ITBL 2OM5A 1AGDA 1MHCB 3CFBB 1CL7H 1AE6L 2X4NA 1DQQB 1OTTD 1U8MA 4N8VA 4NJ9L 4F7MB 1EEQA 4MCZA 1KJ3L 4BSJA 5C09D 3AU1B 4NC0B 5DRNB 1CFVL 1UEYA 3KYKL 1I1RA 2VZ3A 1KB9J 2X1WL 2X4RA 5IR1B 3C2AL 4MS8C 3FQTA 4PRPE 3G08B 3GMRA 3LOWA 4Z7VE 3TESA 3BVNA 3KPRD 1BAFL 1A6UL 4GAGL 4JRYB 4OTXL 5TDPA 3SPVA 3MROA 1N26A 3ZTJG 1U42A 2JELL 1A6PA 3V52L 5KG9B 3C9NB 1VPOL 3PWJA 1O7SA 2NY2B 3EJYD 5JA9A 3IDXH 4H5SA 4EKXA 3ARGB 3MBEC 3MLWH 1I85A 1M7IA 4BQ9A 1I8MB 3ZYOA 2OP4L 4XNXH 3VRIB 5D1QA 1C5BL 3JV5A 3HUJB 5HDQL 1PG7H 4YDIL 4P23D 4Z7OF 4IBLT 4JY6A 1OARH 1LK3L 4OF8A 1KNOB 3MRIA 4LDLB 3UMTA 1MWAH 3VFTB 3C6LC 5CILL 2NZ9C 2IPKA 1I4FA 3OF6D 3MRCB 4M7KL 3VXMB 2AV7A 1FCGA 3LN4B 2DTML 5BJTA 4Z7NE 2UZXB 3EYVB 4JN1H 4EI5C 2H8PB 4XXDB 5T1KA 3AMKA 5C86A 2Y5TA 2FRGP 3ORJA 3EUUA 2IBZX 3QDME 3R0MA 1MLCB 5IB3A 1IE5A 4IIQA 2NY0D 2ZUUA 4QRSA 1PLGH 2VO5A 1MFEH 4TUOB 2MHAA 1VSCA 4UBDD 1YPZE 3VFPA 1VADB 4ZFZA 4IRJB 5FUZH 3QDJB 5IQ9B 2YD6A 1QLEH 2R0KL 3QPXH 4MXWL 4D0BB 2WBKA 3GHEH 3U7WL 2H32A 2WWKO 3OG6B 2W9LA 2QQKL 5HHNA 4DJMA 3U4EB 4LVOB 4UV4H 3U79A 2DQCH 3WSQH 4YUEL 4PJ8C 4ZUSA 5IP4A 4J23A 2O5XH 2Q8BH 1K4DA 5DQ9B 3RDTD 3WHXB 4QCIA 2X6MA 4KWUA 5IIEB 1ZHNA 2A9MH 3O6FB 4OUOA 4OM0H 1YQVH 3PWLB 5FUOL 4ENEC 4UDTB 2IH1A 1VEMA 3NA9L 4M6OL 1P1ZA 3QXWA 5I76B 1N3NB 4G8EB 1GC1L 2BNQD 1A6ZB 1ZLUK 1FG2A 2IANB 1S8DA 3ZE2E 4XI5D 5FM4A 1IGCH 3AMLA 2YK1H 5FIEA 4GMSL 4X4XB 1IAOA 4TVSa 1WBXA 3BRGC 2OLDA 4LIQE 2LAAA 2HVKA 3QUMH 4PGEB 3ZT6A 4OZIE 3QZWA 1W8NA 3RUGF 1IM9D 4KV5E 4ZTPH 5DK2B 1QBLL 3W5MA 5IVZA 2W65A 4YHIB 2BSRB 1UACL 1S7QA 5EOCJ 4WW2F 5TDOB 4P2RB 1JV5B 2BNRA 1BVLA 1FDLH 5DZNA 5T1MB 2GY5A 1F42A 1MJ8H 3PP4L 2HAZA 3T2QA 3LB6D 1RUQH 4H26A 4JFPA 4TTDC 4D8PA 2L7UA 4MD5A 4DFHA 1NBVL 1KXVC 3O2WH 5EFIA 3GMMB 2YEZB 5DD1H 5DD5L 4NN7B 1VFMA 5B39G 2QSCH 1MFDL 3OR7A 2E7LA 1YEIH 2AAVA 5ISZD 4M7JH 4XZUA 5TQ0H 5L6YL 5GISH 5IW1A 3TH3T 3W81A 3ULUF 3O6LH 1HEZB 3JSSA 2HJLB 1T1XA 5IB4A 1VFUA 3CXHK 4ODTH 1RJYB 3G6JF 1A7RL 3FN3A 1UCTA 4MNQA 3KPQB 3FO2B 4FQLH 3MV7D 4UT6H 2F8VA 4ZUVB 5I9QB 3ZDYF 4ODWB 2FYYA 5EORL 4Y4KB 3JBG7 1HSBA 4WO4A 4P4RA 5FYLD 4PJ5D 1KTKE 3ARFC 4GW5B 3FO1A 3VE0A 1RIHL 3WO3B 1MRCH 3BQUB 1XR8B 3WIIL 1DBKH 2HKHL 4MJIB 4U1GC 4I5BB 3QDGE 3IB4A 2X2YA 4M9PA 4N0CC 3NABH 1M4KA 2ZUQB 4WV1C 2R29H 1ZS8A 1UA6L 1RJLA 4B0MM 2UZYB 2XTJD 4QKXB 2HN7B 4RNRB 1F2QA 1QSEA 1IFHL 4RFOL 4X4YA 4W68A 5F72S 2VOTA 3F7VB 4A6YL 4LSRL 5C0JB 3W39A 4JFHE 1OGAB 2AK4B 2BRRL 1I1CA 3HZMB 3S5LA 2D4FA 2IQAB 3BH9B 3GSNB 1KGCD 5HVHB 4XVUC 4HEME 5E94A 1YEFH 3DX7A 5EB9A 1PYWA 5IK3B 5MEOA 2G2RB 3QWOA 1HN1A 5F6HI 4C56D 4XT1C 2BC4A 1CDUA 1YC8A 2VLLA 3PWNB 4DOHB 1U8LA 5LXGL 4GXUN 1BREA 3V5KB 2QBWA 3TBVA 2JIXB 3LVEA 2E6JA 4NQXA 4URTB 3VFOB 3UPAA 5C7XH 1KJ2L 1S9WB 3LIZH 2X4TB 1ZGLP 4MA1C 2ZCLH 1RZJC 3L5WA 4PP1C 2ID5A 4NKOA 2QSTA 1N5AA 3H9SE 5IJVA 4KZEL 3MRPB 4ODHL 3FONB 3SDXA 1WWWX 1JFQH 4N0UE 5DHYA 3BKCH 1HYSC 3H0TB 4LGSB 3LAFA 4CADB 3K2UL 1B4RA 5BMFL 1U95B 4JGJA 1CF8L 3SO3B 4RGMB 4U4BA 4YDKH 1WWBX 3VG9C 4NDMA 4DKAA 3O4LA 3FQWA 1DQMH 2RCSH 3V0AC 3SCMC 3IVKA 1ULVA 3OKKB 4E0RB 4M93B 4R7NB 1TVBB 4E41E 4KGJA 3VFGL 4MQ7B 2GAZB 4DFIA 2YPLD 2CKBL 1BLNA 2M26A 1YECL 4JQVC 1OB1A 1UT9A 4RGND 4Y4FA 1MH5A 5D7IE 5E8EA 2X7LB 3VXUB 3UYRL 4K7PL 1EZVY 4K23L 1IGFL 4JAMB 5C0CE 2VDLL 1INDH 4HS3A 4WCYH 4JGUA 5GGQL 3S3SA 1Z9SA 1J1OL 2DI9A 5GGVY 1DLHA 5HYJB 3CDYA 4GMTL 2YD4A 1P4LA 4XNUL 5JIIA 4NNPL 1A6VL 2JB5L 3FJTA 1AR1D 3OKLB 3ZHKA 3CMGA 4J3TA 4R97B 3U0WL 3QCTH 1NAML 1JGDA 2CLRB 5TE6H 4K7FB 1UM4H 4U05A 1FZMA 4BSVA 1JPST 3NMEA 5HYIA 2BXZA 4CJ0A 4L4TE 1LE5A 4DTGL 3KNBB 2OTUB 3RWEB 5F9WC 1EJOH 3V6OA 1KPUA 5EZLA 4Z9KB 4L4VD 3MV9B 4KTDH 3SOBH 4AENB 3VG0L 5I1HL 4X6CF 1QG3A 2R1XA 5EULV 5ESVA 4WDIA 2AQ1A 3VMNA 2YR3A 1MIEH 1PEWA 4OLWH 1A3RH 4PJFA 2F53A 2VH5H 5EDXA 3ZKSD 3C6SA 1AGFA 1K85A 4OD2B 3BH8B 1N7ML 5EC1A 5DUPH 1S7RA 3KDMA 1OVZA 4ZNEE 5DFVC 1F4AA 5HHVH 4G6KH 4KK5D 3AS2A 1N0XL 3REWA 4I1NB 4EXPX 4X7CC 5SX4I 4H1LB 1TCMA 4KJWC 4D0CA 1NBYA 1FORH 3DX8B 2C1PA 7FABL 1BIIB 1GH7A 3OPZH 5L88H 5C0AE 1WTGT 2XWTA 5IMOA 1EZVX 3M17A 1P69B 5F6IC 4XPFL 1RUPL 2R4RH 4JN2A 4PJGF 3LS5H 4NKIL 1OF2A 2FBJL 1OTUD 2Z31B 4RAUB 3H9HB 4NC1C 3MYJA 2VDKL 4LBEB 5KN5A 3OQ3B 3PGCB 1S3KH 3P3YA 4L4JA 4O51B 2PYED 4MD0B 1I7UA 4LAQL 4PJIE 1HKLH 4POUB 3RWFB 4IOFC 2HVJB 3MFFA 4K9EC 4X6DE 4AEIL 5C07E 4KUZH 3ULVF 3LHPL 4HUUB 4Q0XL 3OAYH 4LHUG 1Z5LB 4TRPH 4P57B 1OQXA 4H8WH 3CPLA 1ZHLA 4K71B 3T0EA 3BXNA 3V5DA 1YYMH 4NN6C 4WEUD 3ZL4H 1XF5B 5LKNA 5EA0L 1P4IH 4PYHA 2P7TA 3O45B 4OGXH 2IADB 5HI5D 3OB0H 4QOKB 4KJYA 3QFJE 4F7PA 1XZ0A 3S37X 4MA3A 1D5XB 1TNMA 1MCFA 3FHAA 3UJJH 3D69B 4JVPA 4M5YL 3RWIA 4OLYH 3TBTA 2XV6B 1A14L 1JL8A 3EO0B 5C0RH 1HXMA 3E3QC 5AAMA 1RZGA 3O3DB 1KIQB 4FRWA 2BOCB 1DDHA 3F5WA 3WFCH 3NFNA 4JFFB 2E27L 4OKVB 4OD3L 3N50A 3UC0L 3HZVB 4WFGE 3KJ4B 4YFDB 5FO7B 3CFCL 1LEGB 3TYFA 3W0WE 5GGSB 3M8OL 3RNKA 1IEBA 4AK1A 3HZYB 4I2XA 1E27B 1K3ZA 5DHXB 1KPRA 4KRMB 3DMMC 2C3XA 5DJCB 2ARJA 5I1DB 5JW5A 3UTSE 4LPYA 2AABH 4LHJB 4NN5B 5I19H 3HRZA 3WFBL 5KOMC 2P5WA 5IBLD 1RU9H 1VDGA 1B2WL 1HXYB 3FB7A 2V9TA 3PHOB 3P11L 1LP9A 4AT6B 5IGXL 1MREH 1XGRA 3QUYD 4FABH 5TPWH 3QCVL 4F37F 4I18A 5GPRA 5IB1A 3C8KB 2HT4D 3DOSA 4OUUA 1FGNH 1T5WA 1RIUH 3MRDA 4Z7UA 5ENWA 3ARBD 3OJMB 3GBNL 1QSZA 2AJYH 3KYNA 4R8WL 1XFPA 3UTPE 4Y7MA 4DUVA 3VFVB 3RL1B 3DLQR 2P49B 3OR6B 3O2VH 2ZSVA 1ES0A 5HDOA 4X99A 4WFHD 3RVWC 5HHQA 3O6KL 1CLOH 5DUBB 4JFQA 4I13B 4O5LL 2EC9U 1QYGH 4Y5XC 5F7EH 1MY5A 2ESVA 1JYXA 3V0WL 4IOIB 2IBGA 3FOLA 1NMCB 1G9NH 3WHE0 3ZTNL 3LKNA 1MJJB 3CSPA 4OZFH 1W2KT 2XWJB 2V7NA 5EU3B 5D1ZB 4LLAA 3L7EA 5MEPB 3MLRH 4KKAD 4MA8H 4P4KD 5D70H 1KXQE 5FM5M 2APTA 2ATPB 4U2YA 2NXYB 3QUZB 4UNVA 5IFJB 4R4FH 1JWMB 2HA1A 4UAOC 4WEBH 2Z4QB 3KLDA 5FV2A 1G1CA 3UAJC 1T1YA 1FVDA 2VKWA 1RVFH 2AJ3A 5GGRY 3RI5F 2BVPB 4G8IA 4W4NA 4F7TA 4LFHG 2WBWB 5IHZA 3UROR 3A6OA 2ICEA 4PG2A 2HFGL 1PSKL 2V5RA 4Z5RA 1U58B 1FZJB 3P9LB 3PWPD 2P43B 3J8F7 5DWUH 1T0PB 4I48B 3DVIA 1A9BB 2V2TA 4HJGB 4P5TA 2ED7A 3MZGB 4YDLB 1OL0A 3MJ7B 2J88H 5IOPA 3C60A 1FFPA 3QO0B 1GGIH 1N59B 2W59A 2MQCA 5BZDB 2FJGA 3VFUA 1U91A 3H3KA 1SY6H 4FQJH 5AWNL 4FQ2L 1KCSL 3HMXH 5HPOA 4HXBH 3GMPA 4NPYB 3SKNA 1Y18A 2BVQB 4K07A 4AMKH 1TCRA 3PHQA 4OFDA 1PEZA 5D7JD 4QRPA 1CE6B 4D0DA 4Q9QH 3KPPA 1EO5A 3GFUA 1YNLH 2E5EA 1R3IH 4NGHH 3BZDA 1CD0A 4NO2A 3TO4C 4NNXB 4XVJH 4DVRL 4DZBA 3G5ZB 1NEZA 3IJYB 2XZQL 2OL3B 4YJZL 1FO0A 3EYFB 4P2OA 2BOBA 2VXQL 5EU6D 1G7MA 1K6QH 4UT7H 5K9OB 3X13B 1CGYA 5TF1L 2W1NA 3WS6A 1R5IB 3MCKB 2PW2B 1AH1A 4JFEA 1CD8A 2VUOA 3FRUA 4WW1B 4XMKH 3LQAL 4O2CB 3BP5B 2QTEA 4HUWA 4C59B 4AYFA 1IGMH 1MSPA 1YMMA 4WTZG 1LO0H 3MV8A 4UINL 3DNKA 1F58L 3GHBL 3WEXB 2ZPKH 3JTSB 4NZUL 5C6WH 3MRKA 3PGFH 3RVXC 4KXZI 1Q0YL 2Y23A 1Y0LB 1IQWL 4ZPTB 1JNLL 4YXKH 3IDNA 3SE8L 2P45B 4MQTB 5IHUH 1B0RA 2CIIA 5ALBH 1OPGH 4Z18A 4GRLD 5HHOE 4NHUB 5E2VH 2AI0H 2CXGA 1HDMA 3EDJA 4AM0B 2CR6A 3TVMB 5D5MF 3WIHH 1G0XA 4RMWA 3I2CL 1L0XA 1TVDA 4BSWB 5F7UA 2J2ZA 1IAIL 5I30H 2R56L 4OZHF 4NOBA 5IM7A 3G6AA 1AGEA 1QSFE 1WIPA 2P5EE 4LEOA 4L8SA 2H2PC 2W9DL 3ZO0A 4ZSOB 1U0QA 3UBXI 3NACL 4XGZB 1KB5B 4OCYL 1AHWC 1FJ1A 1AC6A 3K2MC 5T3XE 1MHCA 3CFBA 3EYUL 4HZAA 5FKAB 3EAKA 3QIBC 1DQQA 5F9AC 3LKQA 2IGFL 2QJDA 2J8HA 4S10A 5GRVK 2EDTA 4F7MA 3AU1A 2DQUH 4P46B 5ABDE 2MJWA 3RY4A 3BDYH 3TJEH 3MR9B 4P9HH 4EJ1C 5IR1A 1EK3A 5J56B 3DGCR 5KVFL 4Y2DB 1KTLB 2BY3A 2QV2A 3PUCA 4JRYA 3CSBA 4LPVA 3IJHB 2O5YL 1J7VR 2F15A 1RURL 4MQSB 3AVEA 5HGGS 4OLUH 3HE6D 1EH9A 2CD0A 1FSKB 2IPTL 4DCQB 3OL2A 4S11A 1K5NB 2YPKB 3C9NA 5KG9A 5D4QA 5EU4B 3C5ZD 1CU4H 3MRNB 3PQYB 5T3XH 4CU8A 1GHFL 3ARGA 3KXFD 1I8MA 1H3XA 2Q20A 3UBXG 1RZKL 3BMWA 2BHZA 5FA4B 4OI7A 4NRZB 3HUJA 1Y6MR 5FGBA 1GGTA 1KNOA 1BMGA 2VE6B 4M7LH 1GL4B 2FECL 3VFTA 4P99A 3BDXA 4ETQA 3H7BB 3BKYL 1AC0A 3MRCA 4LSVH 2UWEF 3N9GH 4U31A 2DBLH 3VXMA 4I3SL 3JUYA 5GGTA 1DVFC 3LN4A 3WV0A 3BN9D 2XA3A 2AXJA 4LLYB 4QEGA 1VCAA 1EGJA 2ZKHH 4ZD3L 3EYVA 2H8PA 4XXDA 5T1LB 2E6QA 5EZOL 3JWDC 4PJAF 4HJJL 1MLCA 4UB0H 5KVEH 3AC0A 3VFRB 4KVNH 5JQ6H 5HI4D 4TUOA 4LSUL 3PWVB 5T33L 4ZO9A 4IRJA 2PO6D 5IBUB 3QDJA 5D1QD 4D0BA 2GQHA 1FC2D 1OAQH 4LLQA 4CGTA 4PP2B 2B1AL 5IHLB 3WLWC 4RAVB 4ORGA 3U4EA 2GJ6E 1WISA 4NSKB 5I71B 3K1KC 5E6YA 2I9LB 2Q6WB 1FLRL 4RGOL 1T2XA 4HMEA 2PYFB 5DQ9A 3WHXA 3L3OB 1MAJA 4TSCL 2F74B 5IIEA 3O6FA 4YC2B 3PWLA 4I3RH 3E6HB 4K7PY 4UDTA 1E6OH 4M7LT 5T1KD 4OSUH 4NQEE 5JPMB 1EAPB 5I76A 1FFRA 1N3NA 1QFWL 4PIRF 4PLOB 1U3HC 4G8EA 4UILH 2ATKB 2W07A 4FQIH 1A6ZA 2IANA 3N0PB 3UTTE 1AXTL 2ITCB 5EWIL 1RV6X 4X4XA 4XRCB 1OW0A 3BE1H 4TQEH 4PGEA 1J1XH 4PJ7B 5DUMH 2KZ1B 3BPOB 4GT7A 3K4ZA 4F57H 4WUUE 2AEIT 3NA4A 5DK2A 5CSZB 1C5CH 2VDML 4YHIA 1YN7B 3Q5YA 2BSSB 1TZHB 5KVGL 4WENB 4ETYA 5ILTL 2VLME 1JV5A 4KAQL 5I2IB 2PR4H 5E8DL 1X7QB 4QNPF 3Q6FB 1RK1A 5T1MA 2BHUA 5B4MD 5A2LH 2XIDA 1ZT4B 4GQ9H 4Y1AB 1TTGA 3DHMA 3MCG1 3PL6C 4MXQD 4Y8DC 5E8PB 3QG6B 4WU7B 5DMGD 1L7IH 1EEYA 2A6DB 4PTUB 3HI5L 5BVJB 4PLJD 3W9DB 3GMMA 1TJHH 2YEZA 4JFDE 4WUKL 2XZCH 3BIBX 3K8LA 5GS1B 2ADFL 1YY8B 3O9WC 4PB9L 4XPTH 4JR9H 2R9HC 5GS2D 4KROD 4MA7H 4NQCB 4IM8A 1I1YB 3W2DL 4EOWL 1HEZA 2AXGA 1YY9C 2HJLA 1XIWB 1MHPH 4H8WC 1EPFA 4CUCA 3U4BL 1CFTB 2F9BT 3KPQA 3OAYK 4OCRH 3CCHB 3ARTA 1NCDL 8FABB 1NCAL 3HB3D 2WK2A 2BNRD 4ZUVA 4ODWA 4Y4KA 5EZIL 2CK2A 4WTXA 3GMQB 4XPBL 3KPSE 3VXPA 4K3DL 1E4XL 4GW5A 3CDFA 1F45A 4TSAH 1MHEB 2NY5H 2BERA 1CTOA 1DFBL 3BQUA 3RUGE 1XR8A 4TPRH 5DJ8B 4MJIA 4CU6A 5HHXH 1MWAB 4MZ2A 2DOCA 3V4VL 4XMPH 3VGGA 4Z7VB 3ZKXB 5F96L 4RISH 1I9RH 4RNRA 2HN7A 5ICZB 5I18L 3F7VA 5L7XL 5C0JA 1BECA 1S78D 1R3HB 3K80A 1DUZB 1MPAH 1OGAA 2AK4A 4ZO6A 1X5KA 3QCUL 4JHBA 3HZMA 3GZKA 3KPOB 4MNQD 5HVFB 2E8ZA 2NY1C 1AD0B 2P47B 3ZE1F 3BH9A 3GSNA 2JF1A 2ICWI 1UKTA 4G8FB 1JE6A 2BRQA 4WO4D 1E28B 4MDIB 4FFWC 1MCDA 2KUTA 2G2RA 4XVTH 4EIGB 5I8KH 3ULUE 1NGZB 2DJSA 2VZOA 3LSOB 3B8SA 3SQOL 3PWNA 4RAHA 1MFAL 4YDJB 3LKRA 3V5KA 4XNMB 2XRAH 3HE7B 3KYOB 4XP4H 3U30C 4JM2C 3MACH 2JIXA 3G6JE 1BZ9A 3T65B 2DM7A 3VI3F 1S9WA 2DL9A 3EYOB 3HNTH 5HGHA 5BV7H 2X4TA 3ZDYE 1A1NB 1R5VB 1NDGB 1NGWA 4EXKA 35C8H 1KC5L 3HNVL 1QSED 1BBJB 4IRSD 2H3NB 3INUL 4M48H 5SWZE 3QDMB 3QI9C 4HG4J 3MRPA 3FONA 4YXLL 5HHPB 3H0TA 4CADA 4FQ1L 1U95A 1P5VA 1T89C 3U4AA 1YPZB 4Y4HC 4WWKB 4HS8L 1HSAA 1OSPH 4NO0B 2YD1A 3ULUH 1X5AA 5E24E 2LU3A 4TNWK 3QWQB 3D9AL 2BVUA 1UJTA 1RUAL 3QQ9D 4PGZA 1Z9MA 3OKKA 4E0RA 4EDWH 3KPMB 4R7NA 1TVBA 4HK3N 2R69H 4NBXB 5IEKB 4MQ7A 5GS0L 5HXMA 2GAZA 1MY7A 3UCRA 5FYJL 1T4KB 1G9NC 5A40E 2X7LA 4I0PC 1MCQA 3RVVD 3VXUA 4JPWH 4OB5L 1J88A 2YS4A 3LEVH 1D6EB 1KULA 3LD8C 2VYRE 4JAMA 4LSSL 2EC9T 3ULSB 1YQ2A 3IDYC 3SDAB 3WS3B 1KBGH 1AQKL 5HYJA 5T3ZE 5CCKL 4P48A 1A7QH 3ZT7A 1ROWA 2R0ZH 3U1SL 3U82B 3OKLA 5C0FB 5KS9F 2CLRA 3O4LD 5I8OH 1JGVL 3V4PH 4K7FA 4N9OB 1EV2E 1MF2L 1XGTA 3W11D 1NBZB 5FDWB 4LSTH 1MHHB 1BZQK 5D2NE 3GUTB 3KNBA 1JZ5A 2OTUA 3RWEA 4Y4FD 3FQUB 3T08A 1JPTL 1SJHB 3MV9A 4G80B 4AENA 2VR5A 3QDHA 4XC3L 2WP3T 5HDBF 5T3ZH 2APBA 4OZGF 4PV9B 5IB5B 3EJJX 4LDEB 4LEXH 3UJTH 4W6WB 3LV3A 1K9TA 3JV6B 2YKLH 4OD2A 3BH8A 1N2RB 3DUSB 1KG0B 4AIZB 5KANI 4EQ2A 2DJUA 25C8L 1V5JA 4H1LA 1NLDL 4NP4H 2DB8A 1GIGL 3BYTA 3DX8A 5SX4H 1BIIA 4XPAH 4PRHB 4R4BB 3MLTB 3RGHA 3GJEB 3AS1A 4ODVH 4HJ0D 2OXGA 3TJHC 4RAUA 2Z31A 3MA7B 4LOUD 2OYPA 2C3HA 2RR3A 4LBEA 4OQTA 1NCCL 2ADIB 5CP3A 3PGCA 2ZG2A 3GI8L 3T8XB 4O51A 4MD0A 3VD4A 1HWHB 1V7MH 5H8DA 1FFOB 5DVNA 2F53D 3RWFA 2IH3A 1KEGH 3N1GC 3QDGB 3WXVL 1Q0XH 4KK6C 4JY4B 3GIZL 1URLA 4EQ3A 3OKMB 3L5XL 4HUUA 4EUPG 4E5XB 3QJHB 4R26H 4XP9L 4XCCH 1Z5LA 4MLIA 3L7FB 5GGTL 4LQFL 4P57A 3B9KD 4X6CE 4ONFH 5KANG 1QFHA 5J1SC 1EGJL 1NAKH 5CJ8A 1KLGB 3BESR 2KH2B 1A7NH 4AEHH 5DK0B 5CEZE 4QOKA 2O61B 1ZHKB 3PNWB 3EOBB 2NCMA 2OMNA 2B8OT 3ALPA 1J1PH 4MJ5B 2XT1B 1HQ4B 1DUYB 2A0LD 2D9QB 3JWNC 3D69A 3QNYB 1R3KB 1AFVH 1IC7L 2CK0L 3RWHB 3DV6B 4JM4H 2NW2A 3EO0A 4YBHA 5DVOA 2MCG1 4C55A 3O3DA 1AY1L 1KIQA 2AVGA 2EZ0C 3TA3B 2BOCA 3X17A 1NGPL 3GSVB 2OR9H 1JZ8A 3KPRB 2DIJA 1DBAH 2I60H 4OKVA 3U9PH 4JHZA 5FO7A 3H9SB 1BWMA 1LEGA 2HJFB 4ALAL 4MMXC 3HG1D 5GGSA 2R2BB 3T0ED 3AY4C 4N0UB 3U48A 5CEZH 2R8SL 3IFNL 1HH9B 5J3HC 5HGBB 1BJ1J 1IC4H 5DJCA 1XGPB 5I1DA 2VDQL 3X3FH 4ZG1A 4XCEB 1MELA 1Z0MA 5TFSL 6FABH 2HT3D 4HAFA 5C92A 5J7CC 4P23B 5ANME 3RKDC 3V0VB 4E41B 4Z77A 2G75A 1H3WM 3BPNB 4PBXA 2ADGB 1HXYA 2VZVA 3WKNA 4G5ZL 3PHOA 3HAEG 3NFPB 4X6EA 4BFBD 4KDVA 4EVNA 1CQKA 4AT6A 2YWYA 1R24B 1IAMA 2WAHA 4YFLF 5D7IB 4WNQB 4U1HA 4HBCL 1FNAA 1UM6L 5CZXC 3WUWG 4FG6D 5C0CB 1INQB 3QPQC 4L3EE 1FGVH 5L8KB 4FA8A 5TE4L 1JHLH 1F90H 4XC1H 5KJRL 4J6RH 1IMHC 5MHSE 4HC1H 4C58B 3P40A 2P44B 4AY0A 4EDXB 5CD5D 3VW3H 1MRDH 4ZS7L 5C0BE 2YD3A 3VFVA 4KI1A 3RL1A 3OR6A 3P77A 4LKXB 1I8KB 3U9UB 5E5RB 3ULVH 3QIWB 4FNLH 5DUBA 4R2GD 2DQHL 1G7PB 1WZ1H 4S1SH 4KKCD 3NCCB 5GHWL 4BQCA 1MQKH 3S34L 4IOIA 2P5WD 5ALCL 2W0PA 3N85L 4JANB 1IC5L 1CG9B 4L4TB 1MJJA 1FBIL 1T2QH 5DR5L 2H1PL 2XWJA 1A4JB 3NCYP 5EU3A 3RIFF 5D1ZA 5H35B 3UX9B 5MEPA 4F33B 3PXJA 2ATPA 1RI8A 1RUMH 2RQ8A 1NSNL 2VUYA 2LQRA 4HPOH 3QUZA 1H3PH 5HYEA 1JWMA 2X09A 3FN0H 4KRPD 5D7KE 4P3WA 1A0QH 1B88A 5FCSH 1OAUL 3V5HA 3QFDB 2BVPA 2YBRB 3QB7C 4NWTL 2WP3O 2ZJSH 2PW1B 1V3LA 5IQ7H 4FQQB 3BEWB 3SE4C 5IMKB 2DLEA 1U58A 1FZJA 1IARB 5C71A 4NUJB 3MBXH 3ZYZA 1R3LA 1CDJA 5L0QC 1A9BA 2B1HH 4O02H 2ESVD 4HJGA 3AGVA 5FHBH 5LJYH 1BIHA 2H26B 5FCUH 4HK0B 5ERWB 1Z9OA 2R1YB 3MJ7A 4MNGE 5C0AB 1JN6B 3QO0A 3VGHA 4MAYC 1G7JA 3O41B 3BZFB 1D5MB 1V3KA 4YE4L 2QHRH 3GSNL 4NPYA 2BVQA 4YFLI 1A3QA 3GSOB 1NUDA 5KZCB 4LCWD 2X1OA 1CE6A 2YUZA 3SY0B 5BQ7B 3DHJA 3H9YA 5C07B 4NNXA 5KVMC 4R0LB 4OLXH 5E5MA 3FQXB 3G5ZA 3IJYA 2OL3A 4JO4L 3CC5B 1AIFB 3EYFA 3IRZA 1JTTA 3OJVC 2P8MB 4LCCB 4P5TD 1J5OL 4G7YH 5CSGA 5F7FA 5K9OA 3X13A 3G5XB 4F9LC 1R5IA 3MRBB 4FQHB 3MCKA 5F9JB 1TPXB 2PW2A 1A64A 3EIFA 4Y5YC 2CXKA 3MYZA 1OAKL 2XZAL 4QWWC 4WW1A 1OLLA 4PJ5B 3BP5A 3GJFB 1S7SB 5FECB 1W72H 5CGMA 4PLKC 1LDPL 4KUCF 1IGJB 4G9FD 4UUJB 4QRPD 1MOEA 2NY6C 3WEXA 3JTSA 1FL5B 1NMBL 4LVHB 4S0SD 1QFUL 1UWGH 1BD2E 4Z7QF 1Y0LA 1ITCA 3THML 4GKNB 3RZCB 4P2OD 1NANH 3W0WB 4D9QE 2VISB 4NJAL 4NHUA 1IGIH 5LWYL 4AM0A 3N06B 1FN4B 4HKJB 1NC2B 3TVMA 1U8KB 4KMQA 1CGSL 5LCVL 2EEAA 4OCWL 3DVNB 3MLUH 1ZANH 2QADD 3OKNA 1WLHA 4LU5H 4FXLA 4BSWA 2O5ZL 3O8XC 3UTSB 3ARWA 3CH8A 5GS0D 4Z0BH 1OWWA 4JFED 1FZOB 1IBGL 3U7AA 5FYJD 5DSCB 2ENSA 4MQXC 5EN2B 4ZSOA 4OLZL 2VLJE 4UT9L 1G7HB 4GKZB 4JQXC 4C56B 2CJUL 1YMMD 1EFXB 1KB5A 4XGZA 4FMKA 1LHZA 2VL4A 5CGTA 5J12B 1GSMA 3MV8D 5JMRA 5FKAA 3V6FB 1FE8H 1A9EB 5IROA 1NL0H 2YN3A 4HPYL 2C4XA 1T83A 2AJXL 4P46A 5C70A 3MR9A 2VAJA 1KFAL 5KSAC 1NFKA 5FDYA 1SJXA 1TITA 2VQ1B 4ELMF 5JHLH 3MJ9A 5I6XB 3PP3H 4Y2DA 1KTLA 3LN5B 2AJVH 2UVEA 2EO1A 1LK2B 1UJ3C 2H2SD 3IJHA 3QULA 4X9FA 1EHNA 4JZJC 4CDGC 2D03L 4KI5C 4DCQA 5J8OA 1K5NA 3MLSH 2YPKA 2DF3A 2CO6B 3NFSL 2VXTH 4PS4H 4L8CA 4CKVX 4EIZC 3HHRB 5EU4A 4M6ML 3MRNA 2EDOA 3PQYA 4B7LA 4BUHA 4XCYB 1PG7W 1C08B 2YPLB 4M3KB 5FA4A 4N90D 1MEXL 3QRGH 4NRZA 5DF0A 4YXHH 5D5ME 3EYQC 2VXUH 3I85A 2VE6A 4JZOB 2DDQL 3EOTL 4RDQG 1FNSH 4OZHE 3RAJH 1TETL 5FK9B 4DN3L 3DETC 4EI6B 3H7BA 2WBJD 3VH8B 5HVGB 1S7UB 1X44A 5B8CB 4OQTL 1CZ8L 1T22B 3EJZD 4IMKC 1HQRB 1QR4A 3BSZL 1X5FA 4LLYA 5D96B 5DEGB 4JRYD 4X5WB 3RA7H 5T1LA 5I1CH 5C1MB 3PGDB 3SDYL 1SYVB 3LN9A 3KAAA 1KIPB 2NY2D 3VFRA 1X4XA 3ARGD 3VD9A 3PWVA 1T6WA 4HUKB 4HCRA 1CVRA 4YHKL 4QXUH 3C08L 4XBEL 5GS1C 1OTSD 2OSLB 1IL1B 2CGRH 2X1XR 2BY0A 4UU9B 1QSVA 4P2CG 4PP2A 5C0NC 4L3CB 5GGVH 4RAVA 1JBJA 3LKSB 5E03A 4PY8I 4MB3A 4WFFD 12E8H 3WFDL 4TOYL 2JJSA 4NSKA 5EBMB 3G9VA 2Q6WA 2NLJB 2HH0H 1UYWL 4EBQL 3VXMD 4LRIC 2A77L 2PYFA 3L3KB 1XGQB 3L3OA 2V2WB 3DROB 2F74A 3GNML 4OAWB 1NUGA 4OZ4B 1XF1A 3E6HA 1S9KC 1T3FA 1P53A 4EN3C 4FQCH 1OT1A 4Y19E 1SM3L 1DP0A 4RWYH 4KHXL 5FGCE 4G3YL 5KSBA 1OCWH 4PD4J 1T66D 4N5ED 2ATKA 1N6VA 4OKDA 5J13C 2UWEE 2ITCA 3BW9B 2JJVA 4YHPA 1JWSB 5IW3A 4IRJD 4XRCA 3X3GL 2EIBA 3I75B 3QDJD 1NLBH 1BZ7B 1M7XA 3E2HC 1AO7E 1ERNA 2IC2A 3CGTA 1ACYL 1BEYL 3LEYH 4N0YL 5CSZA 1YN7A 4ODSL 5D6DC 3RWDB 3KJ6L 5D2NC 4MGXA 4PJAE 4G6JH 1CGUA 5I2IA 1YJDC 1X7QA 3Q6FA 3FQRB 1ZT4A 4HIEB 1FNFA 4UQ3A 4Y1AA 3QEGH 3HC3L 4XPGH 3QG6A 4MVBC 4WU7A 3WXWH 3O6FD 1MI5A 2A6DA 4PTUA 1HOCB 4L9LA 5BVJA 3W9DA 4JFOB 1CICC 3B5HA 4L29B 3ETBF 5E5UB 4AJ0A 3LY6A 5HHOB 43CAB 1YY8A 3UJIL 2BDNL 2JCCF 3SDCC 5I17B 3TPUB 2IFFL 1W8OA 4NQCA 1N6UA 2NYYD 4OF0A 1NUNB 3BMVA 4BFGA 5C9KA 2X40A 3HI6H 1XIWA 3LH2H 2B20A 4F58L 1SEQH 1CFTA 3W9EB 3SGKC 1DSFH 4ELKB 1DBML 8FABA 3CVIH 5D1XC 5I1AB 1S9XB 3A67L 4G9DB 3HR5B 2W91A 2FIKB 2WUBL 2EXYD 1DZBA 2FB4H 4APQB 1I8LC 1L7TH 1MHEA 4MD4B 2X44D 4YHMH 1YEEH 1MCNA 5DJ8A 4S1RL 1MWAA 3C5JB 4PRPA 4Z7VA 1JGEB 4FP8H 4YQXL 1DL7L 2QLVB 4QNPE 1RZ7H 1FIGH 2DQTH 3ROOA 3A6CH 4Z7WB 4Y5XA 3MOQA 1CYGA 1R3HA 1DUZA 4MJ4A 2Y9RT 1AD0A 4OJFH 3EO9L 5E99L 3QUYB 1KIRB 2B2XL 4G8FA 1TXKA 4Y4KD 2FLBT 4P2QE 3KG5A 5I1JL 1K8DB 3P0VH 1E28A 4MDIA 1B6DA 4ZTOL 1I7ZB 3TWCH 1NGZA 3OKYA 3LSOA 2ZP0T 4KGLA 3BQUD 4U3HA 1N6QL 1Q8MA 4YDJA 5CGYC 5IV2A 1NCWH 4XNMA 3HE7A 3KYOA 4MJID 2GTZB 4WFED 1UFUA 3ET9F 3T65A 2OZ4H 2B0SH 1J8HE 3EYOA 4GAJL 4ODUB 1A1NA 3GSUB 4J4PC 4LSQH 1GZPB 1H3TA 2E9JA 4U33A 4W70A 1BBJA 2H3NA 2CSPA 3QDMA 1JCKA 3BP6B 5BW7A 1MVUB 1OGAD 3H42H 2AK4D 1CXFA 4KKLD 5HHPA 1LO5B 2OL3L 3TH2T 4WJ5B 4MAUL 1YPZA 5B39B 5ITBH 3EOAB 4WWKA 4AQ1B 4NO0A 4HW6A 3ULVC 5AZ2H 4GS7C 4P4KB 1MFCL 1YMHA 5KW9L 4XHJC 2BX5A 2R0WL 4NJ9H 1OWRM 3QUMA 4QHKI 1KJ3H 4ISVB 5IEKA 1CFVH 3KYKH 4CBPA 2GJ6B 1T4KA 2JIXD 4HSQA 3WLBB 3RY6C 1TZIB 1KT2B 3ZE1E 1D6EA 1OP5H 5ELIA 1UG9A 5JW4N 2CLZA 1I3GH 3SDAA 3PWPB 3WS3A 4NQEB 5IW6A 3IU4L 5D93C 4KU1A 5HJ3B 1VPOH 1OP3H 2HMIC 4KK8C 2Y36H 4O9HL 3B9DA 4K94H 2WW8A 4GUPB 3FHQA 1FCCA 3PIQB 4DVBB 3UTTB 1OAZL 1MJ7H 4M4RA 1NCBL 5C0FA 5HDQH 4OZIA 1LNUB 4YDIH 5F1IB 2B4CH 4WUUB 3RVUC 1NBZA 3CXDH 5FDWA 4JE4B 2EO9A 3T2PA 2VLKE 2XI9A 3CJJA 1WFOA 5CILH 1S9YB 1LEIB 4KFZC 3CFKB 4DN4L 3RU8H 3GUTA 4XNYL 4Z7UF 4HXAL 3FQUA 1CXIA 2DTMH 3VXUD 1SJHA 1YUHB 4G80A 1KB5L 2CLVB 2VL5B 1UH2A 4HHAB 5DO2C 2FH6A 2KBGA 5CZVL 1EBAA 4Y5VB 2JLLA 4H88L 3PJSA 4PV9A 4XWOD 3CU1A 1T6VN 2RAMA 3QEUB 5HYJD 2IAMD 3RL2B 5EU6B 3NCBB 3QG7L 3WDHA 3JV6A 3CSGA 3VDCA 1B90A 5L2KE 4EUPH 4WI8A 3DUSA 1KG0A 4AIZA 3SGEI 2PTVA 4LCUB 2R0KH 3U7WH 3MJ9L 4G7VH 3T0XA 3I50L 1JF1B 4F37K 5D71L 2QQKH 3O3UN 2Q8AH 4W4OC 1HZHH 2YA0A 1J05B 2WQRA 2GHWB 3CFEA 1J87A 1ZLVH 2NY3D 4R4BA 3MLTA 3DYMA 3GJEA 5FO8B 3MV9D 3KPSB 1KCRL 3EJYC 4J8RA 3MLZH 3MA7A 1E4WH 4RIRA 4HGWB 3NA9H 1EA9C 4M6OH 3T8XA 4PYGA 1FFOA 4P23C 3L3DB 2V17L 4WW2B 3QDGA 4KC3B 2GITB 4Q6IB 3BPNC 1KEML 4JY4A 1OT2A 5FB8B 3Q5OA 3OKMA 5D6CB 1T0MA 4E5XA 3QJHA 1P5UA 1O7VA 5EPMB 3ARPA 3TCLB 1BM3H 4XTRD 5BV7B 5F88B 3CFDA 1QBLH 5HDBE 1WICA 5DLML 4OZGE 2J4WL 5DDHB 2CDGB 5DK0A 1L6ZA 2XN9E 4JKKA 1ZHKA 3JWOH 2W9EL 3EOBA 3PNWA 3RI5K 2NY0C 2AEQH 2Z31D 4HH9B 4MJ5A 1HQ4A 2Z91A 1NBVH 3WNPA 4HCRL 2COQA 2D31A 3QNYA 3RWHA 5B3NA 5HHME 3DV6A 4JHWL 2FEDC 4LCIL 4M61B 5DD5H 1RIVL 1I1AC 3U0PA 3IJSB 3TA3A 2DQDH 3TIEB 5DJDA 1CGXA 5L6YH 3GSVA 3IS0X 1A6TB 1L0QA 5B38B 3BPCB 4S1DD 2DI8A 3VFNB 5SWZB 3H9SA 3RDTC 2R2BA 3GDBA 3Q1SH 2UUDK 4N0UA 1HNGA 4X8XA 5I1IH 5DJZB 3QHTC 1W0VB 4UV7L 2OI9B 1XGPA 5EORH 4X7TB 3WN5C 2K1MA 3MA9H 4QOKD 4XCEA 1G9ML 2FR4B 2B5IB 2A74B 4PJBE 2H41A 3V0VA 4E41A 4N8VB 4XI5C 2ADGA 2ZZUT 3NFPA 2HKHH 1R24A 2DJ4A 2YC1B 5D7IA 3I6LD 4WNQA 1F4YH 1R0AL 4PJEE 1LQSR 5C9JB 3T0BA 5E2UH 2OK0L 5EG6C 4BKLB 5C0CA 1INQA 1ZLSL 4XMLH 3FOMB 3DRQB 2VNCA 3QXDB 3UTOA 5SWQB 2C26A 2N56A 3MROB 1IFHH 4RFOH 4GG6E 4Z0XB 4A6YH 4LSRH 3GBML 3WNMA 4EDXA 1XAUA 1CL7L 4LKXA 1I8KA 2CKNA 2V9RA 2X1PA 4JG1L 3QIWA 1T21B 5J0BA 2PO6B 3AB0B 1G7PA 3SBWA 1YNTB 3AM8C 4YFEA 1WQVT 4C4KT 3TC9A 1FYTE 1T80A 4JANA 5AYQA 2ZUVA 4L4TA 2DWDA 4P5KB 5HGAA 1C7SA 2BJMH 4GXVL 2XICA 4F33A 2DRUA 4JFXB 1KJ2H 4KKNA 3D0LA 4KRNA 3IDXL 2VSCA 2AEPH 4ENED 1OSZA 4XHQA 1TPXC 1PBYA 3DURB 1H15B 4XNXL 4KZEH 3QFDA 2YBRA 1F8TH 2XYCA 5I8EB 4ZNCD 5IB3B 1PG7L 5ADPH 1OARL 2PW1A 3K2UH 4QRSB 4HUMB 5IMKA 2WM0A 3D3VE 4JFZH 1MWAL 3TH4T 3CVHH 4NUJA 5E6IA 4LCYB 3RWCA 5DFWH 2H26A 3BRFA 3NBNA 4HK0A 1OAXH 2CKBH 2R1YA 3ELAT 5C0AA 2XTJC 5I75C 4TULH 1JN6A 4JN1L 2XOTA 1A7BA 5A16A 5HSFA 5D1ZD 3UYRH 3QWRA 4KTYA 5M95B 3O41A 5F7WC 3BZFA 1D5MA 1IGFH 2XTLA 2NXYD 3QUZD 3ZHDA 4TTDD 3IXAB 1JZ7A 1MFEL 3GSOA 5GGQH 2ERJC 2IJ0C 3DI2B 4TVPE 5FUZL 5LGHL 3L95B 2JE8A 4XNUH 3QPXL 3KR3H 3SY0A 5BQ7A 4X6DA 3I6KB 5C07A 4R0LA 1CIUA 3FQXA 3IETB 1J8KA 4UV4L 1EJ6A 2DQCL 2EDJA 3WSQL 3CC5A 1AIFA 3S35L 4NCC2 2O5XL 3QZWB 5BXFB 2P8MA 4LCCA 5EUOF 2IG2L 2Q8BL 2MFNA 3LPFA 4WY7L 5IVZB 5E1AB 3IKKA 1YA5A 4FTVE 3G5XA 2A9ML 3B8YA 3F7YB 4OM0L 3MRBA 4FQHA 5F9JA 2J8UF 2KQMA 4ZFGL 2IWGA 3FMGH 3VG0H 3RVTD 3JVGA 4LP4A 3QFJA 5I1HH 5K9QI 5GGSY 1S7SA 3ARFD 4TVPH 1JP5A 5FECA 3VFSB 4D8PB 1G7LB 4OFVA 2APFA 1IGJA 4UUJA 5EFIB 1C5DB 2CPCA 3ECBB 4MCYB 3QUML 4OD1H 1VGEL 1FL5A 1TIUA 4ZTPL 2JJTA 1LWRA 2VDOH 4LDOB 3QEQE 3WJJC 3G5YB 4RGNC 5DA4A 1N0XH 4ZFOB 1QRKA 3LDBB 3RZCA 2BCKB 1V3MA 5FM8A 1FDLL 1FIEA 3W0WA 4K3JL 2VISA 4K8RL 3QR2A 1MJ8L 1X6NA 1FN4A 4HKJA 1NC2A 5K93A 1U8KA 1RUQL 5MENE 3DVNA 4XPFH 3GM0A 3UTSA 3TNNB 4XVUD 1KN2L 5A43C 1NFIB 5JO5B 1FZOA 2FBJH 4WO4B 3CDGA 3K1DA 1NCNA 1Q9LB 5LGJB 5ANMB 5EN2A 2VDKH 1YEIL 3FB6B 4M7JL 3KYAA 1G7HA 4GKZA 4LIQL 1AR1C 5K9QG 1EFXA 4U6TA 2Q86B 2XQYG 2VC2H 3PV7A 1J86A 1MCWW 3ZYIA 3V6FA 4AEIH 3ZKND 2EDLA 2A6JB 1QBML 3K3QA 2I5YL 4L3EB 1WF5A 1IKFH 5TDNB 3G5VB 4JJ5B 4FQLL 2YZ1A 3GKWL 3TM6A 4TNVF 4IRSB 5IB2B 4X4YB 5C0BB 2VQ1A 5EA0H 3L9RA 3LN5A 2DLFL 1LK2A 4WHCA 4XCFH 3V7AG 1S7TB 1BGXL 5DMKB 4M8VA 1DBKL 4N0FA 1CFBA 4LVNC 4JLRB 4Z7QE 1INEL 3A6BH 3AREB 3RJQB 1ONQB 3BPLB 2ICCA 4M5YH 3UTZB 5BCAA 3NABL 1A7PL 4XCYA 1A14H 1T7WA 2R29L 1PVHA 1C08A 4KMTH 5EBLB 4KK5C 1WFTA 3HMWH 3ME0A 4JKLA 3TT3H 4ERSH 5D7LE 4HWUA 1JZ3A 1MCWM 1Y6KR 4C4KO 4CW1B 2XKNB 2IFGA 3VA6A 4UOW1 2E27H 4JZOA 5GRVL 4OM1L 5FK9A 4EI6A 4P46D 3HMXA 3KVQA 4QGYA 3VH8A 5ITFB 1S7UA 5B8CA 5INCB 4BZ2H 1YEFL 3C09C 2HTLD 1HQRA 2XG4A 3SDXB 4Y2DD 5DEGA 3VDAA 5T1DH 2FEEL 2NNAB 1UXSB 5CZKA 3O4LB 4GJTB 3PGDA 2AKRB 1SYVA 3EYSH 5J06A 5JOEA 3WFBH 3MODL 2Y6SD 1DLFL 1B2WH 2WLZA 3PQYD 4GW1B 3LIZL 4GBXC 4MNGB 4LHQB 4DGVH 4ELME 1IL1A 4UU9A 2NY4B 4L3CA 1JFQL 5B22A 3LKSA 3GBNH 1WAAE 1D5ZA 3MRLB 5EBMA 4HKBB 5HI5C 1TVHB 4YDKL 2NLJA 1Q9WA 1W72B 4M1CC 1DQML 2Q87A 2RCSL 3L3KA 5D9SB 1XGQA 4F3FB 2V2WA 3DROA 4KPHH 1S5HB 1IQDA 4G6AD 4IEFB 4X98B 4OZ4A 1WJ3A 3CLEH 2F8OA 5T1LD 1H0DB 5DFVD 3HZKB 1BFTA 3QUKA 3V0WH 5J1AB 4DUWA 3DYOA 1XGYL 1QRNE 2A6KB 1ZSDB 4W6YB 3D1MC 3ZTNH 5FYKD 5HI3D 1Q9OB 3BW9A 1INDL 1JWSA 1P9MC 3B5TA 3WIFB 3I75A 3WMSA 3MJGX 4QGTA 4N1HB 4TSBH 1ADQH 2X4OA 3GBLA 2W0LA 3BGFC 5ESVB 2K7QA 3HLAB 3RWDA 1R5WB 4IJ3B 4NCDA 4P3CL 5J11B 1C8PA 4GOSA 2DMBA 1JVKA 4PJFB 5TE6L 2MTPA 3FQRA 4HIEA 1UM4L 3FRPG 3QUXB 3UBXB 2HFGH 3GB7B 5IBLC 1BD2B 1HOCA 3NH7H 1A47A 1S7RB 1ZLVK 3QUYC 3CDCA 4XX1G 4JFOA 3B9KB 4NO3B 4L29A 3REWB 1VFBA 5HHOA 2HT4C 3SDDB 43CAA 4KTDL 3SOBL 1UWXH 1QA9B 3DV4A 3TPUA 5I17A 4FQXB 3AY4A 2HWZH 1T5XB 3ARBC 1GC1C 1YEHH 2C1PB 4JM2F 2P24B 4Y16B 1MIEL 3S36L 4OLWL 2ARJQ 4X4ME 1ZV5A 1A3RL 4W6XB 1KCSH 1QSFA 2VH5L 4YWGL 4DEPB 3FZUD 3W9EA 5IWLA 4Z95H 2NTFB 1X5IA 4ELKA 5DUPL 4KY1H 5I1AA 1S9XA 4B5EA 1MJUH 3T2NH 1D9KA 4G6KL 5HHVL 3HR5A 2FIKA 1KCUL 3BZ4B 3RGVA 4APQA 3B83A 4IDJH 4MD4A 1MI5D 4DVRH 1ZVHA 1FORL 2X1QA 1VESA 4KKAC 3L5HA 2VXQH 3C5JA 3MXVH 3HG1B 5SV3A 1JGEA 4U1KA 3LS5L 1A21A 3OHXB 5TF1H 5CJXC 2VXSL 4NQCD 2RIKA 3OKEB 1MCPL 1S3KL 4AL8L 5DC9B 1PKOA 4BZ1H 3LQAH 4Z7WA 2YUXA 4JREC 3AFLA 3R0NA 1XIWD 5H94B 4OFIA 3ARXA 4KUZL 4YBQD 1F58H 3GHBH 2D7MA 1IEHA 1KIRA 5DT1L 2JCCE 4TRPL 3FO0L 5DRXB 4NZUH 5D5MB 1K8DA 1EUUA 2FBOJ 3LEXA 1I7ZA 2C4FT 3NPSB 2YPVL 1YYML 2FO1A 3ZL4L 5DJAB 3EGSA 2ZUSA 5L8LB 3O4OB 2YD2A 1P4IL 1JNLH 4OZHB 2K3TA 1UB5B 3SE8H 3QQ4B 3VFWB 3B2UC 5JTWA 3V6OE 1HHJA 2GTZA 5DRZB 1KACB 4PRPD 1UQSB 2DMCA 2NY7H 5C0DB 3QHZH 1GAFH 3GSUA 3FCTB 1P7QA 1TQCC 1GZPA 5JXAH 5BOPA 3F7PC 5D7JC 4HKZB 4OLYL 3WHE1 2R56H 1G1YA 5D72H 2DTSA 4UZGA 4YK4B 2ZCKL 2VWEC 3TYGH 3BP6A 5CJBA 4GW4B 4LF3B 1LO5A 2VLRE 5E70A 3MXWH 3TIDB 4WJ5A 5B39A 1IT9H 3WFCL 4NZJA 3VXSE 3EOAA 3EYUH 1HK6A 2FGWH 3IAPA 4P4KA 4OGZA 1VEOA 3KHOA 2UYLA 4ISVA 1XF3B 2GJ6A 5F8QC 4N1EA 5FYLL 1GGBH 5IT2H 3HE7D 1N8ZB 1ZT1B 5EU7C 3VWKC 3WLBA 5KVFH 1KT2A 3IFLH 2AABL 1RURH 5I19L 1A5FH 1U3YA 1RU9L 4ZUWB 5GZND 2IPTH 3PWPA 4NQEA 4Y19B 1KN4H 1MREL 5HJ3A 5TPWL 5E2JA 3QDMD 4JB9H 2YA1A 4NZTL 4P5MA 3MLXL 2GK2A 5KVDH 4GUPA 1LEKB 3PIQA 1GHFH 5DHVB 4DVBA 3UTTA 2UWEB 1GGYA 1FGNL 1RZKH 1BBDH 1RIUL 4S2SB 4WWKD 4NO0D 1LNUA 2ZOLB 5DVKA 2AJYL 5F7DB 4G42A 4GRLC 5F1IA 2VZTA 4CU7A 4WUUA 4XXCA 2DIBA 3K74B 4B7IA 4PRAA 5E7FA 3O2VL 1S9YA 4PJAB 1PY9A 5FAAA 3RTQB 5CD3B 1MCEA 4LCWB 4I3SH 1CLOL 4PGJA 5CKAA 2VL5A 1NC4A 2CLVA 4HHAA 3QDAA 4Y5VA 3R4DA 4K8RD 2BMKB 3F6IA 3SDAD 1JWUB 2E7MA 4JFDA 3QEUA 1ORSB 1QEWB 3RL2A 4NM8L 5D70L 3GSRB 4JPVH 2QQQA 4F9PC 1QLFB 3EFDH 2LTQC 4JDVA 5DGRA 4R4FL 4OZFG 4WEBL 5AG8A 3EBAA 4LCUA 5IOPB 5DVMA 4NFCA 1JF1A 4U0RB 3CU7A 1RVFL 3SGEH 1B0WA 2QR0A 4BQ8A 2B1AH 4HUXB 2Y06H 4Q9CA 1LDSA 1UENA 1J05A 3GMPB 1CTNA 3Q0HA 4NC1E 5CHNB 1Y18B 3HE6C 1NGQH 4G9FB 1FLRH 3H3PH 3ZYJA 4MDJA 2BFVH 3MX0A 5DWUL 3KPPB 5FO8A 3KPSA 4TSCH 4TUJB 4M7ZC 3C5ZC 4YHOL 5JW4R 3RVXD 4HGWA 5DD6B 1HCFX 4DKEH 1ZAGA 2ICWB 2J88L 2NX5E 4BQ6A 2VIRB 4WI2A 1FO0B 3DSFH 4P2OB 3L3DA 4WW2A 5E9DE 2BOBB 1J10A 2GITA 2F19L 1G7MB 3AXLB 2HLAB 5FB8A 3OKOB 1AXTH 4C83B 1OP9A 4WEMB 4HXBL 1ED3B 5KSUB 5D6CA 4Z7UE 3FT2B 5EPMA 4AMKL 2QADB 3TCLA 2ZNXA 5F88A 4G8GE 4Q9QL 1U3JA 4PJ9B 2DMKA 1YNLL 3BN9C 2VDMH 3KPLB 3L3JB 2H2PD 1WWCA 5DDHA 2HKFH 5ILTH 2CDGA 4KAQH 3C5SB 1WZKA 4YZFF 1ZHBB 4XVJL 4K9EH 4JVUA 4ZOBA 4P2QB 4HK3J 4PRIE 5L2JA 3E3QE 4LLDB 5C2UB 1HIMH 3S8WA 5HI4C 4LASL 4PTTB 1VA9A 5DD0H 1K6QL 4L5FL 4UT7L 2JJWA 5D1QC 3B9AA 4WUKH 4M61A 3IDNB 3G6JA 3IJSA 2ADFH 2Y25A 3O0RL 3SO5A 3QDGD 3TIEA 1J8HB 1A6TA 1CT8B 1CFNB 1CLZL 1TFHA 4EOWH 4QRRE 3BPCA 4F8QA 3P30H 4L1HA 1MVFA 3OJ2C 1OAYH 3VFNA 5SWZA 2M2DA 1I8IB 1BFVH 4JFHD 2MWCA 1AGEB 2ZPKL 4LEOB 4M1GH 3PGFL 4YHLH 5DJZA 1CE1L 1W0YT 1W0VA 3NCJH 2GI7A 4X7TA 1FJ1B 4XPBH 4YXKL 2FR4A 4P9MH 1VENA 1JPGA 2A74A 1E4XH 4IIQC 2PXYB 1OPGL 3LKQB 1Z6JT 5E2VL 2F5AL 1KYOK 2AI0L 4QRQB 1DFBH 3K81A 1S5IH 1I7TB 1OM3L 2YC1A 2WBJB 5GGRB 3IDIB 3SKJL 1EFQA 5I30L 5C9JA 4LRIA 3TA3D 3Q5TA 5F96H 4KDTC 5JDSB 3SE3A 1EAJA 4BKLA 1L9NA 3VWJB 4N8CH 5HYSG 3FOMA 3DRQA 4YBLC 4HS6B 3QXDA 2YWZA 5SWQA 2EH8L 3VD3A 2DQJL 5I18H 4Z0XA 4ESKA 3DVGB 4HF5H 5B4MC 5GRZA 3H9SD 1JF5A 4MXQC 3QCUH 5DMGC 4J2XA 4X6FB 1T21A 2DM2A 4PLJC 4OF7A 2PO6A 2DQUL 2Y1VA 2NMSA 1YNTA 3BDYL 3TJEL 4P9HL 4EUPB 4LHUA 1CBVH 2BVEA 5CJQH 4QT5B 4E41D 2VLKB 4KROC 1G84A 2BVOA 5IKCB 5D2NA 1MFAH 1UZ8B 4ETQB 4P5KA 4OLUL 1PQZB 4JFXA 4KK9D 5C0CD 1KC5H 4YAQB 1WIUA 5DRWA 1WGOA 4K2UH 1V3JA 4TUKH 3HB3C 3HNVH 3ILPB 3DURA 3F12A 1H15A 3QAZB 1M71A 5I8EA 1VKXB 4FQ1H 4HFUH 2PKDA 4D3CH 5I74C 4NQSB 5L2KB 3QIWD 1S9VB 4HS8H 5IUSA 1BHGA 3D9AH 5FA3B 1RUAH 2GIYA 3N9GL 2E7LC 2DBLL 3KLAB 4LLQB 4RFNC 4LCYA 4OT1L 4ZODA 4ORGB 1NEUA 3S97C 4OF3A 3HI1B 4L4TD 2ZKHL 1U8NB 1UKQA 1RZIA 3D18B 4OB5H 4UB0L 1BWWA 3OWEA 4CMHB 3IXAA 3BKJH 5F9DC 3L95A 2DQGL 1KUMA 1ORQB 3HAEB 3I6KA 3U7YL 3RP1A 4CJ1A 4RMTA 9CGTA 3IETA 5DA0B 4QXGH 3P9MB 2R0LH 3CH1B 4QTIL 3WUWB 2HLFD 5LQBL 1CXKA 5CP7B 5E4EB 1Z0NA 5BXFA 5E6ID 2NR6D 1JIBA 4OZGB 4OFKA 5E1AA 3F7YA 2CUHA 2DLHA 2JTDA 5C0AD 4I3RL 2GKIA 1JPTH 4OSUL 2XN9B 1NQBA 1RK1B 3QWRD 3HRPA 4JRXE 4XC3H 4MX7B 4L1DA 1UWXK 4P59H 3T2OA 3V7AE 1M7DB 4UILL 1DEDA 3VFSA 3BYYA 1EEYB 3QQ3A 4KI5F 1G7LA 5HHMB 3UXFA 2QEJA 5KZCD 1C5DA 3ECBA 4MCYA 1K4CA 5GRJH 3BE1L 4TQEL 1DANT 4YR6A 1J1XL 5DUML 4F57L 3NCFB 5C07D 1FNGB 1C5CL 1KCLA 5EIVA 3FQNB 4G43B 1C16A 3G5YA 4FHBD 4ZFOA 1FFNB 2A6IB 3EZJB 5FF6B 2PR4L 3IAQA 4KHTH 2BCKA 4YHYC 3OAUL 1B6UA 2AXGB 1NLDH 3VXQB 4FFYH 4GQ9L 1GIGH 4PJ7F 3NZ8B 3MUHL 1L7IL 1ZE3C 1QLRB 4Q6YA 3TNNA 1IKNA 1NFIA 1TJHL 3LPWA 2C1OB 1EMTH 4HIJB 3QFJD 3TV3H 5JO5A 2XZCL 1Q9LA 5ACMA 5LGJA 4PJBB 5ANMA 3VXPB 2XQBH 3FB6A 3LQAC 1IAIM 3VI4F 1IGYB 1J0JA 2VXVL 4XPTL 4JR9L 5J1TC 2Q86A 3Q6GH 4MA7L 5EUOE 5E2WH 4PJEB 5GRYA 3W11C 2Q3AA 3WXVH 3MNWB 3SKOB 1JTPA 2A6JA 3BI9X 3L5XH 1MHPL 4L3EA 2J8UE 4XP9H 5MI0C 1IILE 5TDNA 4BZYA 4LQFH 3BUYB 3G5VA 1SMOA 4JJ5A 4OCRL 4QXTB 15C8H 4Y4FC 4GG6B 4WFGD 4XP5H 3RZCD 1EGJH 4IRSA 5IB2A 1KJMA 5C0BA 3W0WD 2GTWB 2FDBP 1NC2D 2Z93A 3BP7B 2NY5L 1ZWIB 4NQTA 1S7TA 3T4AB 3UTSD 5DMKA 1B4JH 1MCBA 5H2BB 2DKMA 5HHXL 4JLRA 1NJ9B 1FYTB 3CVHB 4XMPL 3AREA 2VN4A 1ONQA 2CK0H 1GVIA 2IANE 4M62H 4RISL 1EFXD 1I9RL 3UTZA 1X5LA 5EBLA 3V6BR 5DGQA 1UH3A 1CLYH 3LKRB 1A7OH 5BS0E 4UI2A 1KSRA 1KLFA 1BZ9B 2R39A 4CW1A 2XKNA 3RHWF 3NN8A 1DEEA 3TN0B 1MPAL 5HGHB 1L0YA 4KZDL 1KENL 1NGWB 4P2RE 4XNZB 4LNRB 5FHAL 3V6OC 2FHBA 1JPSH 5ITFA 1PKQE