4Z7WA

T316 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
181
structure length
181
Chain Sequence
IVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
pubmed doi rcsb
molecule keywords MHC class II HLA-DQ-alpha chain
molecule tags Immune system
source organism Homo sapiens
total genus 34
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7wA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4z7wA01
2UZXB 3CLEH 5LCVL 3NH7H 1J8HD 2BXZA 1KLUA 3TH3T 3SY0B 5KG9A 1J7VR 4ZS7L 5CHNA 2B5IC 1HSBA 1E4KA 4H1LG 4OLXL 2DLGA 5K93A 2W60B 2GI7A 5GZOC 3P4OB 1VGEH 5DD6A 3G9AB 2JB5L 5KVEH 2PR4L 1MVFA 2XNAB 2ADGB 4NQSA 4Z18A 2EDDA 3ARGC 1KCKA 1FFQA 3B8YA 3PDOA 3DXAD 4HIJB 4WHYG 1BIIA 4R8WL 5INDB 5IT2L 4NN6C 1KG0B 1OT1A 3BH8B 1Z9OA 3QCVL 4KHTL 5EIQA 2GJJA 4ZYKB 1YQ2A 1JYVA 1DQTA 2C3VB 1ITBB 3RWDA 3LCYA 4F15C 1RUAH 4MCYA 1RZKL 2X1QA 4N1EA 5DO2D 1NEZG 4GXUN 3VD7A 2VDRH 4F9PC 4P4KA 4U1MB 5MERA 2OS7A 1P9MC 4R2GB 5A2FA 5D5MA 5TGBB 1UQSA 3EYQD 5C71A 3TBVA 3MRBA 5FYKU 1ZVSA 3OZ9L 3BP6A 5GS1A 5CSZA 2OYPA 5E8NB 5BRZE 3N1QC 4NM4H 4CJ1A 4IRSD 2YK1L 1CD0A 4Z7OE 3RVUD 4N5ED 1SEBA 4X98B 3BKJL 2WWMD 5CUSL 3GI9H 4YGVA 2R4RL 2P49B 2PETA 3TYGH 3CPLA 4MQXD 1IFHL 3DMMA 2KPNA 1G0XA 3VCLA 4DOHE 5ABDE 3SJVA 2NX5A 4LLMB 4HIEB 3RRQA 3MV11 1P4IH 5C70A 1E28B 1YY8B 1N3NB 4P9ML 4MXWL 1IZJA 4S1SH 3OKEB 2GY7B 4LHQB 4PGBB 5DRNB 5F89A 4QTHB 2BVTA 4M1DL 3DUHA 5SV4A 2BNQB 1T1ZA 2PXYD 3G6JA 2V7HB 4UINL 3B3IA 2QR0B 4JFHE 4NCDA 1DBML 2I60L 4OJFL 1L4IA 4PRHD 1IL1A 1L7TL 4M7JL 5FKPB 4YHKH 4F7PA 5JOEA 5EC2A 2PW1B 4IRZL 1CDIA 4Y4FD 2XTJD 3IKKA 3OKNB 2MQ0A 2A74A 3T1FA 1A7RH 2RIKA 3X11B 4Y2DA 1A7QL 3T3ME 2QADB 5CEZL 2DI7A 4N8VG 4JDTL 4KI5C 4Z7VE 3VI4F 1IKNC 3VD9A 2CXKA 4C58B 5IESH 4H0GA 1LO5B 1WCBA 4OGZA 2VL5B 3HKFA 1QBMH 3C60B 1BJ1J 4HQQH 3MBEB 5IB5B 2QSCH 3EOAA 1KTDA 4UQ3B 4U6YB 1T5WA 2DKSA 3QQNA 4XCYA 4RMQA 1OWWA 1NMBL 1Q8MA 5HHOB 3C5ZD 1D5MB 4LCCC 4P23D 3O3BB 5FYKL 5E2WL 2O5XL 1VACA 5EULV 2P44B 4NQCA 1LO2H 1MI5B 1EHLH 3ZSTA 4N8CL 3SOBH 3ZYOA 1P4BH 2AJYL 4JFFB 1OGAD 3BQUC 4CVXA 3O9WD 4X7EC 1J9CT 3QUXC 1V7MH 4BH7A 2CGRL 3LKNA 3BMVA 1HHGA 2FJFB 2WIIA 3H9SA 1D5BB 2RFXB 3QUYB 1NCNA 1MHCB 1WC7B 1NGPL 1WWBX 3P9MA 2DIJA 1IRAY 4XBGB 2MKLC 4ODWA 1S9KC 1J86A 1UWEL 3OKKB 1HZHL 1G6RB 5IROC 4WEMB 2P5EA 5JNYA 4ZPTB 4EIZC 1BJMA 5J11B 3ZDZE 5JHDD 3G6AB 4NO3B 1IM9A 1YPZE 4DKEL 5IOPA 3F7VA 1I85C 1NFIA 2BCKB 2ICCA 3QJFA 1VFAB 4IHOB 3PHOB 5CLWA 2VLMD 5IB3B 4PV9A 4TRPL 3BP4B 5C0GA 2XQYK 2AJ3B 3TM6A 1NMAH 1L0YA 4PP2B 4PB0H 1KIQB 1NC4A 2V9TA 1TTFA 1XR9A 5A43C 1R3KA 3U0TB 3QXAA 1OF2A 2AJUL 4ZFGL 1JNLL 1U3ZA 1LEGB 3A6OA 3PWJA 3RGVB 5KSBB 4FNLL 5IQ9B 3PWLB 2VXUH 4OLZH 4KRMB 1AIFB 1BD2A 1UWXH 3SGKA 3QDMD 4Y5YB 5KSAD 5SWSE 4F7MA 3UTTB 1LGVA 2F74A 3E8UL 1VSCA 4U1NA 1GOHA 4MA7L 4DJMA 2AV7A 2GAZB 1X5ZA 2JJVA 1LO0H 2DQIH 4PV8A 1A4KA 3TBTA 5AD0A 1IC4H 4GSDL 4M9PA 2YHGA 3GO1H 4PUBL 1UVQB 3MROA 1MLBB 1S7XA 5IMLB 4KMTL 5D71L 5F7DB 1S7WA 1W0WB 3X14B 5DMKA 4OT1L 2A6JB 4QXTB 4HUNB 1FFPA 1CXIA 4Y8AA 2OZ4L 1CG9A 4KWUA 3CX5J 1AD0A 1A4JB 5B22A 4EZMA 1RUPL 4IMLA 3RY6C 2H26B 2XWTB 4OM0L 4R0LC 5B39G 3GIZL 2W1NA 5TQ0H 1F11B 2X89D 4ZPVA 5T5FH 3H9HB 4OI7A 4P59L 2LTQC 4LLYB 5DJYB 1IGTB 3MRHB 3OKLB 1QSFA 4Y4KD 5DMGC 2NYYD 5IW6A 3QEGH 1BFVH 3EGSB 4OF5A 3VXMD 4HFUH 3SDYH 1YN7A 4MHHG 4XPAH 3DX9B 3OF6D 3NPSB 2QV2A 3T0XA 1OQOA 2X6MA 5F88B 1P5UA 3JWDC 3WIIH 5CBAB 1JZ8A 3GBMH 2F53A 2YSSA 3AU1B 4I18C 1ROWA 3QO0B 2BX5A 5I17A 4GG8B 3C5SA 3QI9B 2JCCE 1U8NA 1GH7A 1DE4A 4JREB 3ARYA 4XNYH 1OTTD 5DMJB 1MELA 4ZUSA 4QRUA 2DI9A 2V6HA 3EYSL 5E1AB 5EU7E 5LGHL 2WW8A 4U33A 3BH9B 3UJTH 4EI5A 1KB9J 3KLDA 1LO4H 1ND0A 1K8DA 1KJVA 1A3LL 4TULL 4JGJA 5B3JF 2QSTA 5GRWA 2CPCA 1TTGA 4EUPH 3NAAH 5HYJD 5AUMA 3IFLL 3RUGE 5I8EB 1J8HE 1JHTB 5B21A 3HI1A 4JRWA 3T0EA 5DJAA 4IOIA 2FYYA 3PDGA 4JQVC 1BVLA 4ODSH 4XMKH 4Y8DC 1AHWC 1C08A 2IG2H 4QXWA 3LKQB 5IUSA 1ZSDA 2NY1B 1I7UA 1JRHL 2Z8RA 1JWMB 4YX2H 3RNKA 4M5ZH 4PGCB 3INUL 3DXAE 3PWPD 3QXDB 4PJXF 2IPTH 4J1UB 4PRPB 3CIQA 2NZ9D 4E42A 4AY0A 2VLKA 3QZWB 3VWJB 2B4CL 4APQD 1T0MA 4Y1AD 5A2IH 5J89A 5JXEA 1DZBA 4LSUL 3WNLA 3DVGA 3PL6D 3TESA 4N1CA 5TE6L 3KPQB 1E6JH 3IS0X 2BY3A 2A6IB 3C5JB 1S5IH 2V2WA 1RJYB 8FABB 4NWUH 3D85B 5B3NA 3MMEB 5EUOF 5I8OL 3GRWH 2DLFL 2CDEA 1YMHA 1IEBB 3LIZH 5T33H 3OTTA 1OP5K 5F6IC 2R8SL 2DQUH 3DVNB 5CP3A 5LXGL 3VXUD 1KTKE 2NW2B 1INEL 4OLUL 4TUJB 2J8UF 3IAQA 4X0KB 3HZKA 1EFXA 3MGOA 4OGAC 5I73C 4AMKL 5MEQA 1RMFL 1NBZB 1OAYL 3DI3B 4IDJL 1PD6A 4R4BB 5GGSY 4XP6H 5CSGA 5ERWB 3IKCB 3N06B 5ADPH 4PPTA 4BFEA 2Y07L 4AYFA 1HH6B 1B0GB 1SY6L 3ARBB 1FVDA 3TCLB 1YJDL 3SDCD 3BW9B 2NY3D 1NUGA 3F7RA 4QTIH 4UTAL 1KIPA 1WAAA 4PY7B 4YFLI 4FFYL 4YR6B 5EB9A 1J0HA 2K3TA 4LFHG 4K71B 4PRHE 3RNQA 2ZG1A 4YDJB 1D9KA 3P77A 2XACC 1ZK9A 3AS0A 3MCLL 2XTJE 4EBQL 1PW3A 1GAFL 3ARDC 4PJHE 3RWEB 5FGCE 1U8LB 1MY5A 1BWMA 3S35H 3PWUA 1FDLL 2CDGA 4R96A 2Z92B 4OZHE 2PTVA 4CN1A 4JANB 4LBEB 4E5XA 4FOMA 2V2TB 5DA4A 5HDQH 4LCUB 4KJQC 2NXYC 2R56L 2ADFH 5H2BA 1AH1A 4UOW1 4H8WC 1AGDB 1ORSA 4WHDA 1PKOA 4D3CH 2HRPH 1QO3B 1MF2L 3L3IB 2NY5C 4FQQB 2FHCA 4UILH 2XQBH 3FB6A 1MNUL 3EO0B 4FXGA 5FDWA 1N0LA 5C0CD 4U6HB 4ELMA 3THML 2EC9T 1MAKA 1PG7W 2LABA 5I6XC 3RI5K 3UTOA 3TLRA 2DWEB 1OGAE 3HE7A 5GRYA 4XGZA 2FLRT 4OBRA 2FX7L 1XF2B 2R2HA 3UTQA 3BVNA 5FGRA 4M5YL 2VLJA 3FZUD 4H26A 4POYA 1BJ1H 5DR5L 4DN3H 5JPNB 1N5AA 3CD4A 4JRYB 1DN0A 3DUSA 3W0WA 5MI0B 2CQVA 43CAB 5DEFA 2P8LA 3O45B 3GKWL 4KAQL 1KF9B 3KJ4B 5DQ9B 5LWYH 4K9EH 1TITA 43C9A 1AGCA 4P46D 5JHDE 2ESVB 4MXQD 2QQKL 5C0DA 5HGBA 1JWSB 1EEYA 1Z9LA 3UTSD 4OGYH 5KANG 1XF3A 4TTGA 1HOCB 1HINL 2V5SA 4JFPB 5CBEA 3HUJF 2VLME 1T83A 4FXKA 4WWKA 1S9WB 4MHHI 1YEDB 2OLDA 4Y0GA 5FHBL 5EOQH 1WBYB 5CILH 3K0WA 4D8PB 1FZJA 4JFEA 3VE0B 4ELKA 5CJ5A 3SBWC 2J1KA 4BUGA 3QDME 1DLHA 1RZJH 1X3DA 3ETBF 3HPJB 2DN7A 2OQJB 1MCFA 1YNLH 4JPWL 5HHXH 4LLAA 4I1NB 2FDBP 2HFGH 4K8RL 4YHML 4HEME 4NUJA 4G6MH 3EJZD 1KLFA 2X4TA 3HZVB 3F5WB 3DO7A 1QHOA 3S37H 4M6NH 2XY2A 4G8FB 4TVPL 1RSFA 1XF4A 3UO1H 1DVFC 1KELL 2QHRL 4WHYH 4QGYA 3S5LB 4NHCH 5F1SA 4IS6B 3OR7B 1CDHA 2EC9U 1CXLA 3QO1B 4FP8L 5GZOD 5IB4B 3RVTC 1GGBL 3KPOB 4XMPH 2BDNH 2NCMA 2CMRH 2NPLX 3MNZA 3BKCL 2D03L 3ARGD 2H32H 1AD9B 2DQFA 5F9AC 2I24N 1K4CB 4H1LB 1U3HA 4M61B 4XNQB 2VE6B 3GNMH 1WFNA 3TN0A 2XYCA 3EFDH 1HK6A 4NNXA 4UOW0 2VITA 2HJKA 4LPUA 3LQZB 5IMOA 3VXSB 1JMZA 3DURA 3MGTB 5AYUH 1VERA 1LE9B 4ZFZB 4EDXB 3OBAA 2ADJB 1K2DA 5J13B 3VXME 2VISB 4GXVL 4PTUA 4EQ3A 1T03L 2XZAH 4NZDA 4Q6IC 3GSNL 3Q6GL 3OKYA 1F6AA 3QNZB 4NO5A 1Q9KA 1XGTA 1NEZB 1IILE 3NACL 4RMSA 4NKQB 4U4BA 5E8PA 3T04D 2YOCA 1UCTA 4O5LL 5BO1L 4CMHB 3VRIB 4YDIH 5HPMA 4WNQB 4M1GH 3WIFA 2YXFA 3UXFA 4L3ED 1U58A 5C86A 4N5UA 4GKNA 5IKCA 2F9BT 4H88L 2Q6WB 5IB2B 1JPFB 4WTZG 5F9OH 4QYOB 3MJ6A 4YQXH 3PGFH 12E8H 4GS7C 1ADQH 2AJZB 1LMKA 1GZPB 1VEPA 5HYJE 1BGXH 5F1IA 4QRPA 3P9LB 1EX0A 3TIEA 3C8DA 4PY8J 1QLRA 4MB4A 5DJDB 5M94B 1JYWA 1MAJA 1KNOB 3OJ2C 2VIRA 5FA3A 1VFMA 2HMIC 3LSOA 1RZFH 4NSKB 5LAXB 4P2YA 1H15B 1DANU 2XG5A 5FHAL 1ZLSH 3VFNB 2EECA 4PRIA 2OMNA 1MH5A 2KQMA 3PWPE 4L8DA 1XGQB 4P9HL 5C2BH 1M7IB 1Y0LB 3TH2T 3WE6B 5E03A 4Y1AE 2YN3A 1REIA 2FZ3A 1OB1B 2ZUSA 5EN2B 4J7RA 2UV3A 4HK0B 3T0DA 2PYEB 5GGSB 1H8OA 4Y16A 5C8JB 4Z78A 4I3GA 4O00A 4HJ0C 1Q0YL 1TETL 2J8OA 4N8VB 1JPSH 1T1WB 5IHZB 2EC8A 1Y6NR 1QPXA 2GT9B 1INDL 3BKML 5TF1H 2VTFA 1TJHH 1U91B 1QFWL 4GRLB 3MLXL 4KQ3H 4JM2C 2E9BA 3Q3GA 4QOKB 4LHUD 3MA7A 4IRJB 3VXUE 5HYSA 3HE6A 4ZSOA 1HXYB 4G43A 1MJUH 4M43L 1ACYH 1QEWB 2DM2A 4QHKI 4JLRA 2R29L 4RZCA 1L0QA 2OI9B 3FOLB 2XXCB 4PBVC 3V6ZB 3V0WL 4PY8I 1CICA 4BFIB 3BQUD 4IDLA 3D25B 3SKUD 1MCWM 1LDPL 3VGEA 4GOSA 1FORH 3QIBA 1MFCL 2E6JA 3OL2A 2UZYB 1W72H 1GC1H 4PJIB 4CU7A 1KV3A 3WLBB 1S9VA 1H3PH 4XX1G 4D9QD 5A3ID 3KPRA 1A7OL 1DQQB 4RSVA 4LPVA 4DZ8A 3KPMB 4HT1L 3MV9B 4WTXA 3QULA 4UIKH 1V3MA 2D3VA 4UT6H 2W9EH 4OCRL 5GGRA 4JRXA 1OLLA 3MJ8B 3F7YA 1LO3L 2XWJA 3TT1L 3SKOA 2XKNA 4PLJC 3BZ4B 3S3SA 5A16A 4PRNA 4ALAL 2WINB 3RPIA 4RBPH 3LN4A 1SMAA 3I50H 3L7FA 4OD2B 3ESUF 3O6FC 3GMNB 1XCTB 4KTEH 5CJQH 4BZ1H 4OFVA 1FFNB 4WY7L 3MLSL 3DV6B 1RK0A 1KBGH 2VDPH 1KEGL 4OZFH 4M6AA 3L6FA 4KHXH 2IH3B 4PJFA 3HZMA 1NGXB 1R3LA 1RY7B 5GRJL 5JW5A 5ICXA 1QRNB 4RMRA 1Z5LA 1JGLH 1QHPA 2DQDH 3LEVH 4G8IB 1U0QA 5KBNC 2GSIB 2FX8H 1R0AH 2ZJSH 2MMXA 3FQNB 1NBYA 5E8OA 4K7FB 3MLTA 1ZEAH 1XGUA 2EIZA 3F6LA 4WRLA 5F70A 3CVHH 3EJYD 1I1AA 4D9RE 1PG7X 3MOAH 5DJ0B 1NAMA 2R0ZH 1C5DB 4YXLL 5C0CE 5CEYB 1WF5A 4PR5B 1T7ZA 1I3GH 1P2CA 3RAJH 3UC0L 3BKYL 4FQHB 5DD0L 4QHLA 1AP2A 2F19H 1RQ5A 4UZGA 1IGIH 1NPUA 3OMZA 5KAQF 1NC2D 3S36X 5IF0B 3SE9H 4KVCH 3STLB 3VH8B 2IQAA 3MFFB 1LHZA 2I5YL 4GBXD 3O3UN 4EN3B 3DV4A 5I30H 5J3HC 1JGUH 1YDPA 5BS0D 5C2UB 2R2EA 4G9FA 1EO5A 5B39B 4XMLH 3MV7B 3UTSE 4S2SB 5F7FA 4AENB 3CFDB 2EXWC 2YC1B 4X6DF 3RIFF 4LPCA 3SY0A 3FFCB 5FYLL 3QH3B 4I5BA 2NMSA 1ZA3B 3CX5K 1KLGB 3X3FL 3D9AL 2AJSH 2N4IA 2NY2D 4Q58C 2W60A 4U1IB 1KIRB 1P7HL 4WEBH 3HI5H 1QVOA 2OTUA 1U8MB 4PJ5A 1EDQA 2AJXL 3ULUL 2ADGA 4LRNH 3GIVB 4U3CA 2P8MB 1G6RL 4N8PA 3AFLA 4Q9QH 1F8TH 2P7TB 3GHBH 4HIJA 2FJGA 3D0LB 3S4SG 1KG0A 2LFGA 3TPKA 4H20L 3BOVA 3ES6B 2P45B 4UUJB 4ZYKA 1B3JA 1S3KL 1MQKL 2C3VA 1T1XB 5C9JA 2EYRA 1D5IH 4IIQC 1F4WH 4M7LH 1M71B 3TZVA 3U9PL 5DZOA 2W59A 1N5YL 4U1MA 4HV8A 1RULH 1ZHNB 3AGVA 5TGBA 4PLNC 1RUQL 4KDTC 4YXHL 1JMXA 5D1XB 2FGWL 2IFFH 5E8NA 3LY6A 4MS8C 1IGCL 5F7EL 5DD5H 1JTTA 4ONFH 4AG4H 4X9GA 5CWSB 4Z6AT 4LHJB 4X98A 5J8OA 1KB9K 4GMTH 4OD3L 1CDJA 1IAKB 1CFSB 3KXFD 1T7VA 2V2XB 4YJZL 1KIUA 1E4XI 1YQVH 3CXDH 3HMWL 3U1SH 3MLRL 4LLMA 4TSCL 3K1DA 1E4KC 4HIEA 1AKJD 5JIHA 1E28A 1YY8A 1N3NA 1ZV5A 1A5FH 1WZMA 2VZUA 5EUOE 3GSWA 3OKEA 3DTXB 4Z7WE 4QRSB 4UT9L 3CMOL 2BNQA 1FNAA 3B2UC 2QR0A 4QXGH 3ECBB 1DQJB 3BEWA 3ISWA 2J8UE 1OY3B 2E9JA 2ZOKB 4LSSL 4Y2OA 2F54D 5ID1B 5FKPA 2AEPL 2XN9A 4PLKC 1I4FB 3I3BA 1AE6H 2WSKA 2PW1A 3AM8C 4OGAD 4NJ9L 3OKNA 1FNEB 2PNDA 2F5BL 4L3EE 1LEKB 4P4KC 4XC1L 3VFRA 2VLLB 1XR8B 2AXGB 5KN5B 2UWEF 4AEHH 1MCOL 4F7EB 1LO5A 4I2XB 5GS1C 4KUZH 2VL5A 1F4YL 1BAFL 25C8H 4DWHA 1IBGL 1X7QA 5E9DB 4HK3J 7FABH 3U7AA 3MBEA 2CO7B 4KY1H 1V7NH 2GCYB 4UQ3A 4F7TB 1OP3K 3C8HA 4U6YA 1FZMB 4G7YH 5IVXF 4LRIC 4HH9B 2IAND 3V6OA 3DMMC 3VWKB 4GG6F 1BFTA 5HHOA 5DEGB 4YE4H 3GMOB 1D5MA 2OMBA 4F3FA 1SYVB 3TPUB 1I7ZB 3O3BA 4D9LH 1SEQL 3FRPG 1YEFL 2C1OB 1I8IA 3QPQC 1Z9SA 2RCSH 3ARDD 4H0HB 4N0YH 1KB5H 4N9OB 1MI5A 3HNTL 4XCFL 3GGWA 5DJCB 4G6AC 1WWAX 4JFFA 2YD4A 1J0KA 1CU4L 4X80L 3PF2A 1NGQH 2BSED 4FQLL 2FJFA 5JXAH 5E6ZA 4CADB 2VXTH 4HC1H 3V7AE 4LLUB 4XBGA 2J5LC 5GXBB 4OAWA 3OR6B 3OKKA 3MJGX 2G75A 4DGYL 3QXTA 4F2MA 2UZIL 1BQHG 4ZPTA 4Q9RH 3RL2A 2VL4A 3M1BB 4X7SH 4Y2DC 4DOHB 2BCKA 2Q8BL 1XGRB 1BZ7A 1VFAA 1A7PH 5ALBL 3PHOA 3IFNL 5IB3A 1A8JH 3BP4A 2AJ3A 4GRWF 5DT1H 5DJZB 2DMBA 4PP2A 3ROLA 1KIQA 2VKWA 1OM3H 2DLIA 3U0TA 2VDKL 4N0FB 4ZFOL 4O51A 4DKDC 5KSBA 1MFDH 4MQSB 4RFOH 1N6QL 2BRRL 2X4NB 1AIFA 4Y5YA 4U0RB 1M4KA 4BZYA 3UTTA 5IJKC 4D9QE 4JQXA 4PJ7F 2F5AL 3GUTB 2DQCL 1KPUB 1FCCA 2GAZA 3IJHB 3O0RH 5GRVK 2DKMA 3SDAD 1CDCA 5F3HB 3RPKA 3T08A 3JWDH 3DRTB 3O3AB 2BVQB 5CIPB 4JVWA 1A6VH 1MHHB 4OZIE 3A67H 1NBQA 2H9GB 5I1DB 1F6LL 1KFAH 2MNUA 5F7DA 4MZ2A 3VI3F 5JW4Q 1W0WA 3X14A 3HG1B 2A6JA 4PG9A 4QXTA 4RFNB 3TFKC 1Q9WB 1F13A 5FAAA 4I8DA 1YEGH 2NY0B 3BD4A 3FO1B 1F2XK 3O4LD 5JDJA 3UYOD 3U4BH 4XPHH 3QA3B 2H26A 4WHTB 4AL8L 1ZHLB 4LLVB 4Y7MA 1BFOA 2APWA 1F11A 4MJIB 3ZKMC 4TOYH 4MQ7B 4EOWH 2HJFA 3P4LA 3H9HA 3T3PF 1GSMA 2G60L 2QBWA 5IVNA 4LLYA 1IGTA 3MRHA 1RZKC 4LAQH 3OKLA 4PFEA 1RZIB 3VW3L 3UYRL 3ARRA 3OKOB 1ED3B 3BGFB 3DNKA 5M95B 3FB5B 4P5TC 4O02L 3SDXB 4Z95L 3EGSA 3VG9B 4AEIH 2I9TA 1NAKH 1DVFD 5F88A 1MWAH 2VNCA 3SCMB 3SGKC 3FAXA 4LVEA 2RHEA 1NBVL 4PJBB 4HPOL 3AVEA 1JPTH 3AU1A 1IAMA 3QO0A 1OAXL 4GG8A 1WFUA 3QI9A 5IG7A 5C09A 1UACL 4XNMB 1UM5L 2O93L 35C8L 1QR4A 3HAEH 2D7NA 3VXTA 3BN9C 1XFPA 5GGTH 32C2A 1HQ4B 3U4AA 3G08B 3TVMB 5E1AA 3LS4L 1X9QA 1OAUH 3B9VA 1UFUA 4NN5B 3CSGA 3NCBB 1W0YT 3W82A 2VDQH 2XV6B 3FN9A 1F4HA 5C0BB 1P4LB 4EVNB 1KTLB 4J3VA 5BS0E 4B7LA 1HWHB 1QR1B 3ZHKA 4I0PB 3RVWC 2JJSA 1EO8H 3EO9L 4UI2A 5D4QA 5D7IF 3PXHA 3V4PH 3VFMB 2VAAB 3MX0A 4QRRB 2G5RA 4ZTPL 1RHFA 4CAGA 1FN4B 4DN4H 3CCHB 4JY5H 2F58H 3CFKB 2BOBB 1BEYH 1ZHBB 5CZXC 4KK6C 4HWEL 3GJEB 4L4VD 1JWMA 2V9QA 4LQFH 1N7MH 3VRLF 1I3UA 4JO1L 3RWJB 1EHAA 1MEXL 3MJ7B 2B8OT 3QXDA 4J1UA 4PRPA 1QNZL 3I9GL 5EH1A 1EJ6A 3QZWA 3VWJA 4EUPA 4ZOBA 3N9GH 3RZCB 3KR3H 1N2RB 4KDVA 3KPQA 2A6IA 1F90L 3C5JA 1DQLL 1YMMB 1A1MB 3C08H 3GEWB 4LCYB 3PG2A 1RJYA 5D7KD 1E4XH 5M7QA 3RU8H 4XAWH 4HPYH 2QJDA 3MMEA 1YN6B 2FWOB 2ZOLB 5MENB 2ZSVB 3S9DB 1A1OA 4JO3L 2J7LA 5FGSA 3KYKL 5ID0B 1D5XA 4PS4L 3GMRB 2OK0H 2HMID 3V4UL 2OJZL 5JHLL 3TO4A 3QT2A 3VFGH 2NW2A 3ZE1F 1H8NA 4DTGL 4JO2L 3BHBB 3GM0A 3PHQB 1KENL 2ZNXA 3WO3B 3KXFE 1ZLVK 3RWGB 1E27A 1UB6B 4HEPG 1NBZA 3MLVH 4R4BA 4UT7H 4ODVL 3IKCA 4H8WH 4XPBL 1A7NH 3B2VL 1HH6A 1B0GA 3ARBA 2CLVA 1CZ8L 3TCLA 4HJ0D 2NY5H 1FVEA 5E56A 2OM5A 3RL1B 1DBBL 4UOJA 1IGFH 4PREB 2R0WL 3ARFA 5GS0L 4TNVK 2A77L 3LZFH 3SGEI 4PY7A 1BOYA 5C0JB 4W4NA 1LP9E 4YR6A 2FD6H 3UPRB 3U7YH 5DTFB 3RHWK 4B5EA 5EC1B 2F54E 4YDJA 2AGJH 4FQXD 2FATL 3GBNL 1FZOB 4KKNA 1I3RB 5F8RC 4QXUH 2BSSB 4KMLB 5SV3A 3RWEA 5IBTL 1J8HB 1A6UH 1HDMB 2N7AA 3QWRA 1P84J 4I13B 3ZTNL 5EU6D 3QUKB 4X7CC 1SJEB 1TJIL 4GW1B 4MA3A 3D3VB 4OCXH 1UCBH 2Z92A 4NJAL 5DQJB 3DROB 1QACA 4LCWD 2FH6A 2OJEB 4JANA 4LBEA 5CINH 2V2TA 4LCUA 5D7JA 1BF8A 4U1GC 1E4WH 1OW0A 4M6OL 4JVPA 2DLEA 2UUDK 2YRLA 4YO0B 5ACZA 1QO3A 3SQOH 3QNXB 2IANE 3QJHB 4FQQA 3MRQB 5JZ7C 5IV2B 3HCVB 1WCQA 4ZUWB 4PLJD 3DSFH 4U6HA 2X4SB 1PVHA 1VKXA 1S9YB 3B9AA 2Q76B 4MDIB 1BQUA 3LPFA 2LU3A 1UA6L 1XF2A 1MRCH 5CKAA 3FT3B 1ZT7A 4KK9C 1P7KB 4JKPL 3GBLA 2FRGP 4IRSB 8CGTA 4NQED 4PJAB 5E2VL 2AABL 2VSDA 4YDVA 5JPNA 3MLWH 4JRYA 3HA0A 2L7JA 3HNSH 43CAA 3O45A 5J6HA 5DQ9A 1CXKA 3O3EB 2A6DB 4YZFE 2E7MA 2V5YA 3W9DB 1KJMA 4LMQI 3L3OA 5HGDB 1JWSA 3HI6H 3NGBB 1RFDH 2YA1A 3OKMB 3RI5F 4QLRA 4U1KB 4L9LB 1ZLUK 1Z3GL 1EK3A 2YD9A 4LVNB 5IFAH 1WBYA 4A6YL 2Y9RT 3HMXH 4D8PA 1IGMH 4KKAD 3VE0A 5K9KB 2FCBA 3KJ6H 1U93B 1NCCH 5JIKA 4XVSL 4QHMB 4FFZL 1RJLB 2DYPD 2E7HA 3CK0L 2QKIB 1C5CH 2HFFA 1BBDL 1KPRA 4X5WB 1B90A 5FO8B 2WUCL 2YD2A 4XP5H 5I75C 3PJSB 5J3HD 3IGAB 3F5WA 2CJUL 4X6DE 4YXKH 1LK3L 5DURD 1P1ZB 4YBHA 1JFQH 3V79C 5IBUG 5T5NF 2EXWD 3HE7C 5GZND 5I18H 4QY8B 1MCQA 4LEOA 3S5LA 3BJ91 4X4ME 5IQ7L 1MHPH 2FEEL 2MCPH 4UTBL 5FUCC 3OR7A 1AGFA 1DQMH 3QO1A 4W81A 5IB4A 4LHUG 1ZAGA 1KJ3L 3VXRD 5D7LB 1S5HB 3KPOA 5SWZB 4OLVH 2WWKO 3PP3H 2I9LB 4WHCA 4G7VH 2BVPA 1K4CA 4H1LA 3C5ZB 4M61A 4U49A 4XNQA 1QFOA 4MA1C 4B7IA 2VE6A 4Z8FL 2B4CC 3ZE2F 3WKNA 1T83C 4MNQD 4WWKC 4KRLB 4WIQA 4YAQB 1CI5A 3MJ9L 3FOMA 3MGTA 2RAMA 1GGCH 2EEBA 1HI6B 4X5LA 2GEEA 4ZFZA 3O9WB 2ADJA 2Y06L 3NFNB 3S4SB 3W2DH 3P4MB 2A9NH 2VISA 6FABL 4KQ4L 2A1WL 4PJCA 1YECL 5ISZD 4LPXA 4P3WA 4J12A 1EPFA 4OZGE 2VERN 2Q87A 1XH3B 3GMQB 3BFOA 3I6LE 4WFGD 5FGBC 1NEZA 2HTKC 3LHPH 4AK1A 4G6KL 2VZTA 5ANMB 3QIUA 3WFEL 5DFVC 4YFDB 4O58L 3VRIA 3EFFA 5I1AB 3QDGD 4TQEH 4WNQA 5ICYB 5BZDA 2VO5A 2C3HA 1CDGA 3OG4B 4QNPF 5ACMA 3T2OA 4ZD3L 5HY9A 5L88H 4BFGA 2QL1A 1I8KB 4M7ZC 3WD5L 1TJGL 5BV7B 2AJZA 1DBKL 2YMXL 1GZPA 5E2UH 3IFOB 3M8OH 3P9LA 3ZT7A 3OHXA 3QQ4B 3OXSB 1U8IA 5AZ2L 3UJIL 1GL4B 4R3SA 1GPOL 3S8WA 3B2UD 3ULSA 2NTFB 5ITBL 3KLAB 4UNTA 1KNOA 3TN0C 2YKLH 2N56A 1I1CA 1GOFA 1Z9MA 4L4VE 4F8TA 3WFCH 1NUDA 1H15A 4OGXL 4PLKD 4OB5H 3PE9A 2CO6B 2HTLC 1MFAH 4JB9L 2UWEE 4KKLC 5ADOL 1WUNT 4FQ2H 1XGQA 3L3DB 4P4KD 2Y5EA 2OL3H 4WCYH 3RA7H 1N4XH 4YK4B 3PGCB 1M7IA 4U1LB 2DTMH 1ADQA 3IAPA 1CD9B 3L3HB 1OB1A 5EN2A 4AQOA 4BSVB 1WBXB 4UAOC 1A0QL 4KH2A 4HK0A 4JHAH 3B9DA 2GW5A 5F3BB 5C8JA 5IVXE 3T2NL 4KUCF 1NCAL 4TNWF 5D7KE 1CBVH 1OPGL 2ZWLT 2YD5A 1WEJH 4N0UB 4N8VA 1IC5H 2CIIA 1T1WA 4LDLB 3BWUC 1TZHB 3O6LL 2VQ1B 3DMMD 1A6ZB 5DC0A 2F8XC 1FHGA 1U91A 3QUMH 3GI8L 3MODL 1QQDA 4DVRH 3O2DL 2XY1A 3SJVD 1F4AA 1FL5B 1HXYA 2LE9A 2NX5D 5D2LF 5GRVL 1QEWA 3QPQD 4HBCL 3VXMB 1CFQB 2EH8L 3OB8A 2ZCHL 3FOLA 3V6ZA 3VFSB 5DRWB 4KVNL 5BZWA 4C4KT 3D25A 3QQ3B 4P2QA 5KJRL 1JV5B 2X41A 4RQQA 5J1SC 3QEUB 4MD4B 2ICWJ 1MREH 5KVGH 4HX1A 2DQHH 5K59E 2X7LA 1DQQA 4XPGL 4NFCA 3HNVH 2G2RB 3C6SB 1TQCB 3KPMA 3MV9A 2FBJH 5H8DA 3RBSA 3B4NA 3DX7B 1A22B 2PO6A 4Y2DD 5DC4B 4XTRC 5DVKA 5TE4L 3GB7B 3I3DA 3TJHC 1H0DB 4L8BB 1FYTA 3MJ8A 2FEDD 1RVFH 1K5NB 3BZ4A 4Y5XB 4KRPC 1AY1H 1BQHB 3LN5B 1N59B 2GTZB 4OD2A 3GMNA 3FHAA 1XCTA 3RDTB 1W72A 2AV1A 1KYOK 5EU6E 2IAMB 1Q72H 2J6EL 1UH2A 3DV6A 3OJVC 3U4EB 1OWRM 2FB4H 1R3HB 4W6YB 4PJ7E 3WHE1 2I07B 5I1CL 4EI6B 1BZ9B 2IH3A 4LCWE 4MD5B 5TFSH 3QWOA 1NGXA 2VXVH 4IJ3B 5C9KA 5I8KL 4K8RC 2DLHA 4U3HA 4G8IA 3CMGA 4FG6D 5HHVH 5DWUH 2GSIA 2XA3A 3PWPB 4NHUB 3FQNA 4K7FA 4NQCD 5CKGA 3MGAA 5HTSA 3Q48A 5DI8B 4APQB 4Y1AB 3VXOB 5K9QI 1CICC 1JZ7A 2JELH 2X1XR 4U05A 3VI3E 3BIBX 3WKMH 5DJ0A 1MJ8H 4ONGL 3H9SD 3UPCA 5CEYA 3AS1A 4PR5A 2BK8A 3TFKD 2KUTA 1JF1B 5CSBA 1T20A 5EOCL 1A64A 4DUWA 4WDIB 5L8KB 4FQHA 2E6QA 4JPVH 3V2AR 5K9OB 2P5ED 1QBAA 3SKJL 3HPLB 5F7NC 1IM9D 3DVIA 1MJ7L 4NQEE 4Q6YA 5IF0A 2WIMA 4ZFFA 3STLA 5GRXG 3MFFA 3ZKMD 5KSVB 2CKBB 3E1F1 3EOTL 3N1FC 3U30B 3V5DB 3MV8B 4RNRA 1Q1JH 4EN3A 5E7FA 1NC4D 5ENWB 7CGTA 3MACL 5B39A 1CN4A 4ZQKA 4X6EB 1L9MA 4YGAB 4NZUL 4AENA 3CFDA 5JOPD 1J88A 3QHZL 1XGPB 2H3NB 1FNLA 4W4OA 5ELIA 1BD2D 2I25N 2ZKHL 5DHVB 3QH3A 1PX4A 1ZA3A 3IXTB 1KLGA 2WK2A 3QFJB 4C56B 1V05A 3IT8D 4R6UA 4U1IA 3SDCB 1KIRA 1LWRA 2CK0L 1U8MA 5I2IB 2VRAA 1KCRH 1J0ZA 5ETUB 3O11A 3BN9D 4Z0BL 3LKSB 2AK4B 3IDGA 2P8MA 5BVJA 1CE6B 2ID5A 5D1QB 3D0LA 4MAYB 1I1AC 3WEXB 1O7VA 5KOVC 2IBGA 5IB1B 3AREC 1IAIM 3ES6A 1CFNB 4UUJA 2B2XH 2ZUWA 3CC5B 5HDBF 2ERJB 1T1XA 1IGJA 5D93B 4PJDE 4RISL 3RVWD 5CEXB 1KCUH 4LGSB 4M93B 5IHLB 4JKKA 3FQWB 1TLKA 1ZHNA 3FO2B 4XVTL 3HS0B 3CDFA 4YWGL 5DS8B 4Q0XL 2YPVH 5D1XA 1W0VB 4WW2C 1J1XH 3VRLE 1HHIB 2CSPA 1BOGB 3VXRE 5CD3B 2CRYA 4KTDL 4UBDD 1G7PA 1ZMYA 2BY1A 1QSFD 5CWSA 2BOCB 1VGEL 2D4DA 3FJTA 3MRPB 4WW1A 4P9HC 3WHE0 5B8CB 1KJ2B 5KAQG 1GGTA 2VXSH 1IAKA 3TV3L 4JN1H 3V4VH 3CXHJ 1X4XA 4PBWD 4MNQE 4BQBA 4ZNEA 4DGIL 1GIGL 3BPLB 4KUCD 2F53D 5IVZB 3KPTA 1X5YA 4M8QB 4V1DD 3VFPB 1RUAL 4HS3A 3U0WH 1OT2A 3H3BC 2J3SA 5L9DH 4LSTH 2AK1H 2KKQA 3NFSH 3LKOB 4XAKD 4WFGE 1RUKL 1BBJB 3BT2H 4F58L 4G8EB 1AQDB 3ECBA 1DQJA 2X70A 3MRNB 2R1YB 4K3GA 4EI5D 1FO0B 3MRFB 1WBZA 2ZOKA 4UV4H 2HKHL 1I4FA 3QDGE 3RX8A 3RWFA 3STZB 1FNEA 1PJ9A 2HN7B 3WUZA 1LEKA 3O6KH 1HH9B 2VLLA 1XR8A 1TZGH 3L95B 1SM3L 3GI9L 5TPWH 4R2GC 1I1RA 2XWBB 3EAKA 3T0ED 3TYGL 1HKLH 5BJTB 3UBXB 1VHPA 4F7EA 2R1XB 4I2XA 4YHIA 1A21A 4W6XB 5E9DA 5DUML 4Z5RA 5E4EB 1L7IL 2EE6A 2GCYA 4F7TA 3WLWD 1FZMA 4XPFL 4LOUC 1CCZA 5AZEL 4JJHA 1RZ7L 4XXDB 3BIKB 3VWKA 3QUXA 4HDIB 4RAVB 2PKDA 4OKVB 3GMOA 2VLKD 1SYVA 1YYMH 4ESKA 1I7ZA 3H3PL 3KNBA 5BOZG 5JXED 3D6GA 5A40E 3CVIH 1A6WL 2C1OA 4GAJH 4YHKL 2IGFH 5FYJL 5EU5B 5T1MA 5GJSH 5D2NB 5D5ME 3WCYA 5C7XH 4FQIL 3K8MA 1QBBA 5C0NC 5I66B 4CADA 4PRBB 2XIDA 2EEAA 2AQ2A 4LLUA 4KJWC 4PJXB 3FQRB 5E5RB 3OR6A 2JE8A 3UTPD 1QBML 3JV6A 1CLZH 4Z7UF 1EFXD 3CDGB 3VU2A 4FZ8H 4BH8B 2QSCL 5I74B 3BPOB 2Y36H 5DYOB 1VCAA 3KPPB 1XGRA 2QADC 3L5IA 1KB5A 2LAGB 3SJVE 3C6LB 1YYLL 2NX5E 5EUOB 1ZTXL 2DQGL 1EXUB 4Z7WB 4R8WH 3WJJA 2H6PB 5IT2H 3C60C 5FO9B 3QPXL 4U0QB 3MBEC 3ZKQD 4Z9KB 1EHLL 3S98A 2QHLA 4KK9D 5I71B 2X4NA 1FG2B 5D8JH 1P4BL 3C2AL 3G6JE 1FBIH 1S78C 2J8UB 3I6GA 1RZKH 2FL5A 3V6OC 4O2EA 1LDSA 1JRHI 4X4YB 2D9CA 4KZDH 1D9KD 3GUTA 1KPUA 5EBWA 5FM5M 1R5IB 3IJHA 4L3EB 4Y5VB 3OZ9H 3F12B 5EWIL 5J9PB 4EJ1C 1NLBL 2BVQA 3FCTB 3O3AA 1UH4A 4ZOCA 1MHHA 4XWGL 2WMPA 5F9JB 2H9GA 4LPYA 1NANI 3BKJH 4FQPA 5FKAB 4HHAA 5CUSH 1QYGH 3HG1A 3QUYC 1U92B 2R4RH 5C08B 3RVVC 5EZLB 1IFHH 5F7HA 2V17L 5HYIA 3VGHA 3ULUC 4OFYA 3G5ZB 4I4WB 3IF1B 3P9WB 1XGYH 1A3RL 1FPTL 1UENA 3ILQD 3QA3A 1S7SB 4CVZB 5DFTA 5J11C 2JKXA 3TBYB 4WHTA 4D94A 3FRUB 4M7KH 4OLZL 1ZHLA 2WUBH 4PGJA 3I6KB 4G9DA 4J4PA 4MJIA 4MXWH 3S37X 1RZIA 4NQCE 1FQ9C 4I18A 2X42A 4MD0A 5IW3A 1B88A 3FB5A 1NFDF 3SDXA 2JLLA 3B6SA 4ONOA 3HE7D 3RGVC 1LO0L 2I60H 2D0HA 5KS9E 4MMZC 1L7TH 2QEJA 2VLJD 3K46A 3H9SE 3SCMA 4IRZH 4PJBA 4Y5YC 3GO1L 4JN2B 2VR5A 1JHLH 3WO4B 1CWVA 3T77B 2ICWB 5IBUB 1KPVB 1UT9A 1A7QH 2E5EA 4JQXC 3W0WD 1V3JA 3IDMA 5ICZA 4EXPX 2EYSB 5I0DA 3LRHA 3FT4B 5AAWA 1I7RB 1PG7H 1QUNA 4XNMA 3U36B 5CEZH 2P5EE 3MUY1 3NIGF 4CJ0A 4O2CB 5KTEH 4JDTH 2ZCKL 3ZE2E 4XZUB 1HQ4A 4X6CF 3H0TA 3G08A 4H0IA 3HLAB 3FAWA 4LHUB 3VGGA 1FLRH 2J12B 4HUXB 4WWKD 5EOTB 2W9LA 4JQVA 4C59B 3LKRA 5B38G 4UMGA 3WNOA 1AR2A 5C0BA 5T5FL 5J56B 1MRFH 2JJTA 3UMTA 3FHQA 1KTLA 1QR1A 2ICEA 1MWAA 4I0PA 3U9UA 1NMBH 4NN7B 1CLYL 3UYPA 4JFED 2VAAA 3D39D 5FYKH 5FF6B 4QRRA 1BD2E 4M4RA 5C6TL 5L0QB 1FN4A 4HFUL 2O5XH 4EQ2A 4PJEF 3CCHA 3DECA 2HTKD 3CFKA 2BOBA 1FFOB 1ZHBA 3PWVA 4TTDC 4N8CH 3WIIL 5GGTA 4PJFF 5AG8A 3R0MA 3HUJB 3D69B 5DFVD 2CGRH 4J23A 3T4YB 3KLHD 3I85A 5JQ6L 4L4TB 5BQ7B 3RWJA 3EW3B 4XRCA 1NGPH 4XNYL 3IU3A 4TUOA 3F65A 5DVNA 1TVBA 5GRUH 3WN5B 5CFHA 3NPSC 1K9TA 1GYAA 2X4UA 4WTWA 2FX9L 1N8ZB 1CT8A 1A1NA 1S7VB 2NXZD 5CS7A 4O2FB 4DKEH 1A1MA 4LCYA 3DYMA 3QI9C 4JREC 1VDGA 4J3XA 4WTZA 3NAAL 1YN6A 2FWOA 2ZOLA 1U3HD 5MENA 2ZSVA 3DGGA 3DGCR 4DGVH 1U8QB 3TN0D 5ID0A 5C0RH 2WV3A 3GMRA 1JNLH 2NNAB 3MNWB 2ITDB 2DM3A 1FH5L 5EO0A 3R8QA 1QSFE 1RHHA 2IG2L 3TF7C 1E0OB 2MPAH 1TPXB 4KKLD 3BHBA 2AXHA 1U8KB 5D1ZB 3RWGA 3E8UH 1UB6A 4GKZA 3VMNA 4MA7H 2OR9H 4HIIA 4S1QL 2IPTL 4Z7OF 1L9NA 3S3JA 1T7WA 2F53E 4NT6B 1R3IL 1CGVA 1J05B 2BC4B 4GSDH 4N9GA 2NY1C 4PUBH 1NC2B 5EBGA 3RL1A 1E6JL 3MTRA 4NQVB 4PREA 1D3CA 3QUZB 4KMTH 2C4FU 2WBJB 4XAKE 3IJSB 1TCRB 5C0JA 4OT1H 4GBXB 1AGEB 4NWUL 2Z93B 3UPRA 1QRKA 2OZ4H 5DTFA 3L3GA 1EGJL 3H42L 2W0PA 3VWJC 4L8SB 3GRWL 5EC1A 1PX3A 3D2UB 4XHQA 5T33L 1I3RA 2CR3A 5I0ZA 1KT2B 1RUPH 2BSSA 1HHHB 2M26A 4PJ8B 5JW4M 2Z0BA 3GIZH 1HDMA 3PIQB 4QRPD 5T3ZD 4LKCB 2Z31B 5HGAB 4P59H 1OSZB 3T0EE 2NY2B 4ONHB 1SJEA 3B43A 5I1JH 1T6WA 3D3VA 5DQJA 3JUYA 3DROA 2OJEA 1OCWL 2IPKB 2EO1A 3B9KB 5D72H 1C5BL 5ADPL 3NIDF 4XCCL 3PWNB 3T3MF 4DEPB 4NDMB 5J57B 4PRID 3CFJB 3T2PA 4RIRB 3OB0H 4YO0A 3BJLA 4ZODA 4Z7VF 3DPBA 3UX9B 4FFVD 4XTRD 4LSVL 4P49A 4XWOD 1T6VN 4LP4A 5H37G 5IV2A 2VLKE 3HCVA 4ZUWA 4YHYB 4WU5A 4KRPD 4E41B 4BKLB 3LRGA 2YZ8A 4KGLA 4Y16D 1S9YA 3GK8H 2Q76A 3IDIB 3EYSH 1UYWH 3ARBC 1MLCB 5GHWL 3H3KA 5I16B 5HHMD 4AT6B 2DQEL 3MREA 4YHZL 1NGYB 4OCSL 3FT3A 4MDJB 4FN0A 3AB0B 4TULH 2PTTB 3S35L 4P2OB 5D6CB 4UDUA 1G0YR 4S11A 4K71C 2YWYA 3HE6D 3UTPE 3MLZL 1EAPB 2CUHA 5HI4C 3O3EA 2A6DA 4POZD 2ADFL 3W9DA 2H41A 4NKMB 4PJGA 2KQNA 1CICD 3VRJB 3MLUH 3ZTJH 2GJZB 4NGHH 1M1SA 1JRHH 4U1KA 4L9LA 3OQ3B 5IIEB 3QIBD 3QFDA 3RY5A 2X10A 3INUH 2VLRB 2XQBL 3DWTA 5GRZA 1OVZA 4KK5C 4AZ8A 5E24E 5A2LH 3ZDZF 4JZNB 1SYSB 1YPZF 3WJLA 3KPRD 1OW0C 3P3YA 2B4CH 5K9KA 4P5KA 4XT1C 2CDFB 1WAAE 1PEWA 3LKPA 4ZDHB 2HFEB 4KTYA 1U93A 1NANH 2F54B 3QDJA 4JRXD 3DHMA 2QKIA 4HUMB 1UEYA 4OTXL 4DN3L 5FO8A 1FNGA 3EYFA 3IGAA 3W9EB 5I8OH 1FVCB 2OTPA 4FABH 4LKXB 3F62A 3QIWD 3T0WA 4K9EL 5LWYL 3GSVB 1IM3A 1CGUA 1EEZB 2R8SH 3HRZA 2NY4D 4QY8A 4OGYL 2EICA 1NCDH 3DVFA 4QWWD 3W81A 3DIFB 4F7CB 5L2KB 4FQ1H 1FJ1A 2DTSA 1RMFH 2L4OA 5D7LA 1OAYH 2KZWA 5EOQL 1S5HA 5MI0C 4P2RA 3CGTA 5SWZA 3QEQA 4MAUL 2V7NB 3ROOB 3KJ4C 3NCEB 4YNYA 2VUOA 4XVUC 3VGFA 4KZEL 4FQCL 4CW1B 2XZZA 1I1AD 1QFWI 3LH2H 1T22B 5ITFB 5L7XH 1RZJL 1U2HA 2R2BB 1QZ1A 4ELME 5DQDL 1MSPA 2X4QA 3AUVA 4Z0XA 1HI6A 2HFGL 5FV2A 3NFNA 5EA0H 3P4NB 3S4SA 4G6ML 4BYHA 1CLOL 1SJHB 4DZBB 4LEXL 1XH3A 5JA9A 5DVLA 2GITA 3MCLH 4EBQH 3UO1L 3EDKA 2HAZA 3IXAA 3HC0A 3UPAA 1G84A 3W0WE 3VD4A 4NHCL 5TDPB 5ANMA 1A14L 2XPGA 3N50A 9CGTA 3MRDB 3V6FA 5IMKB 5HGHB 4G80A 4G9FD 4S1DC 3JTTB 2CMRL 4X7TA 2HLFC 2Y7QB 2R56H 2I26N 1YEHH 2JCCF 3EFDL 3TIDB 4U2YA 1UXWB 2HWZL 1LNUB 2AXFB 2OX5A 3IFOA 5AYUL 2J88H 3OX8B 3MBXH 4JFEE 4PJ5D 5T5NG 1JUFB 3QQ4A 4UU9B 3OXSA 4PP1C 1MNUH 5GSVB 1LK2A 5ILTL 2NR6C 2IBZX 2MCG1 3P30L 1A6TA 5E99L 3E6HB 4KROB 4RGMB 4ERSL 1Q0XL 1EIBA 2H1PL 4OLWL 5BMFH 1K3ZA 4Y88A 5E6ID 2FSEA 3BISA 4WUUA 3SDAB 4X6DB 2FX7H 3F58L 5T3ZH 1B6UA 3N1PC 3RUGF 3CXHK 4XI5C 2AEQH 3DI2B 1URLA 1XCQB 3TZVD 4MLIA 5J13C 4YDIL 3L3DA 1PQZA 2MSPA 1X5AA 2ADIB 4M1GL 4U1LA 4R2GD 3GKWH 4KAQH 1J8KA 4C57C 3L3HA 1CD1B 5TF0A 1BVZA 5SX4H 5HYQB 2QQKH 3O4LB 3FB8A 5F3BA 1GGIH 2IC2A 4JM2A 3KHOA 4YQXL 1IQDB 1HINH 1CYGA 2VWEC 3PGFL 5E0QA 5T1DH 3OAYK 4BZ2L 2RQ8A 4CMHC 4MNGB 3FKUS 4LOUD 1TZHA 2Z8VC 4X6BB 2B1AH 1FP5A 1A6ZA 2Q20A 3HB3C 1R5VB 5E4IA 1EUTA 2C7UB 3L3JB 3NZHL 1FL5A 1MCEA 4HCRL 1IJ9A 1MHEA 4R7DA 1P69B 2AP2A 1CFQA 1F4XL 2IPUG 5KVFH 3VFSA 5DRWA 2VB5A 3ZKSD 1VGKB 1OAQL 2DMKA 2XI9A 4V2CB 4K8RH 4YHMH 1JV5A 3FRPA 4J3UA 5C0IB 2BNQD 5C0ND 1A6PA 4MD4A 3BD5A 2BMKB 4KJWD 4KPHH 1CGWA 2WZPD 1DUZA 5HBBA 5AYQA 5JIPA 2XN9D 1KELH 2G2RA 4NKIL 3QUMA 3AROA 1JZ6A 1JPSL 4AIZB 1IMHC 5GIRA 4OZ4A 4FP8H 1KJ2L 5DSCA 4XHJC 5E2JA 1H0DA 3AXLB 1GGBH 4L8BA 5I15H 4FXLA 4YBQC 1K5NA 3BKCH 4Y5XA 3LN5A 1PSKH 2JK5B 4NUGL 1T3FB 2RBLA 4GAYB 1NCWL 1FCGA 1OAKL 1N59A 4HWBL 2VZVA 2HT4C 2ILLA 1ACYL 3ARTA 1TDQA 3R06B 4QRPE 3RDTA 5T3ZE 3MBED 2O61B 5DLML 2IAMA 3ZT5A 3U4EA 1QLFB 1R3HA 1I7TB 1S78D 4EI6A 1BZ9A 4MD5A 1C16B 4L4VB 5HSFA 3NZ8B 1ZLWK 1T1YA 3MRMB 5HHOD 1FORL 2ITCB 3LN9A 4M03A 4PJHF 3ZSSA 2EDKA 4GRLC 5TJWK 3W39B 2WANA 2VDOH 1JGVH 2UWEB 4IRJC 4LASL 3BYYA 4PRIE 3CLFL 4NHUA 3CU1A 1JHKL 1RZ8B 1DUYB 1MI5D 2OI9C 1G7IB 5DI8A 3WFDL 3ZKNC 4OZHF 3VXOA 2Z35B 4JFFD 5CZKA 4UIKL 5GGQL 1ZS8A 5BO1H 4O5LH 1JZ2A 2W9EL 1YUHB 4NO0B 4BUHA 2B1HH 1RJCA 3V52H 4FFWC 2ZNWA 2IADB 3U82B 5IVXB 2JJUA 3P0GB 3RVVD 1LQSR 3TWCL 5BCAA 5E00A 1EV2E 4GG6B 1MIML 4WDIA 5HHME 1JCKA 4K3EH 2PCPB 5K9OA 2DQJL 4NQUA 1UKQA 1IEHA 5HHPB 2K1MA 4KTEL 3HPLA 4HGWB 4BZ1L 1U9KA 4I48A 1WIPA 2Z4QB 1JP5A 4FTVA 3GSNB 2HJLA 1ZOXA 1KBGL 5FK9B 4GMSH 4KHXL 4OCNC 2CKBA 1INQB 3KPNB 1LEIB 4M62L 2H2SC 3MV8A 4ZSOE 3RX7A 1JGLL 5ENWA 3QQ9C 1O7SA 2AKRB 3MYJB 2FX8L 2BSTB 5FECB 2ZJSL 3FONB 5E1HB 1ITCA 4OCYH 1GC1C 1ETZB 1XGPA 3KYOB 1U36A 2VJXA 1JWUB 3L5HA 3CVHL 5I1HH 2HVJB 1GHFH 5E5UB 5DHVA 3O8XB 3LRSB 1JYXA 3IXTA 2D7OA 3MOAL 3QFJA 4C56A 4QHNB 3UTTD 1HYSC 2ZSWB 2O5ZL 4P9HH 4W6WB 2X09A 2E9WA 3KPRE 5I2IA 1FSKB 2PW2B 3BO8A 2GFBB 1HSAB 2YPKB 4GRWB 3LKSA 2AK4A 3IDXH 3RIFK 3VFVB 3QDHA 3T2QA 4O9HL 2NY7L 2F19L 4MAYA 5D1QA 4NKDB 4FQXB 4JRXE 4NQDB 3WEXA 1U8PB 3I02B 5IB1A 1Q0YH 1TETH 3M17B 5EBMB 1IARB 1HQRB 3MOBH 3CC5A 5EU3A 3OGCB 3MRJB 1MIEL 1MRDL 3BKMH 3G5VA 1RU9L 3IB4A 1EHXA 5CEXA 1QFWH 2XA8H 4PJ7B 5I30L 3MLXH 4LCWB 4OI8A 3FO2A 5B38B 3GM8A 4M43H 1CGYA 3HS0A 4ZO7A 5DS8A 2R29H 3CH8A 4NNPL 3REVB 1W0VA 3V0WH 1HHIA 1OD9A 1BOGA 5FCUH 2P5WB 1LE5B 1LDPH 1XIWB 4HK3N 2BSRB 4EN3C 3HI5L 2BOCA 2O5YL 4TPRL 5B8CA 5T1LB 1MCDA 3LS5L 1K8IB 3QG6B 2CXGA 4J2XA 4JEGB 2A9MH 4Q9QL 4ETQB 4W4OC 1A7OH 2NLJB 2V5RA 2BP3A 1WT5A 2VQTA 1U3JA 4HT1H 4CMMB 5IVZA 4JR9L 5IFJB 4G6FB 4OCRH 4M8QA 3MUGA 2X4OB 5I1LB 1U2CA 5C09D 1ODAA 3NMEA 3L5XH 2VR9A 1F4WL 1LO3H 4M1CC 4HMDA 3AM8A 4ODUB 2GKIA 3LKOA 5J1AB 4LVHB 1RULL 1BBJA 5GJTL 1EZVX 3MRNA 2R1YA 5IWLC 3MRFA 1FO0A 4UB0H 3MLSH 3K8LA 1QLEH 2IFFL 1AI1H 1KEGH 4LSDA 1RIHH 4G9FE 4ONFL 2Z8WC 2Y6SC 4HJJH 1JK8B 4U7MA 1F00I 1HH9A 4GMTL 1YEEH 3L95A 4I77L 5JDSB 2WAHA 4JKMA 2XWBA 1I9IL 4AM0B 4LRIA 2Q7NA 1CXFA 1YQVL 1U8OA 5D1XC 4OF7A 4XXCA 4IEFB 2NY1D 3RP1A 4PJ5E 3RWCB 3VGBA 5EUKA 1ZT1A 4IBLT 2LVEA 4FMFA 4NWTL 1WVZA 4JDVB 2EDEA 3BIKA 4PRPD 1M6OA 5D7IB 3VWJD 3UC0H 4C54A 4QXGL 3S34H 5DD0H 5DD1H 5DURB 4X5XB 3EYVB 3QRGL 1DQDH 4RGOH 1ZT4B 2GTWB 3W11C 1B2WL 1UC6A 1XZ0A 3LEXA 4NKOB 1XMWA 1AE6L 4KJYB 4EIGB 5IM7B 4UQ2B 5D2NA 1SVZA 3BESR 1JNNH 4LNRB 5HJ3A 3NIDE 4PJCF 5LBSH 1VEOA 5H37H 3VXRB 4L3AA 1PKQB 1AXTL 4PJXA 3FQRA 1NCBL 1J0YA 3HZYB 4KUZL 3BZEB 1K6QL 3TO4D 1BVKB 7FABL 2Q8AL 3DARA 5FYLH 1W8OA 4HLZG 3CDGA 4BH8A 2A83B 3E6FA 4MNQB 1MCPL 1V7NL 1G9ML 4HXBH 4NP4H 2H2PC 5DYOA 3KPPA 4G7YL 1VFOA 3CZFA 5J12B 4MQTB 3O2VL 3QCUL 4OI9A 3C6LA 3ULUH 3PQYB 3H6JA 5IJKA 1G6RH 4XP1L 4GJTB 4HMCA 4D9LL 1EXUA 5ISZB 3ARBD 2MOVA 4OQTA 3I75A 3REWB 3DBXB 4H20H 5FO9A 2RCSL 1OP5H 1NUFA 3G9VA 4HUWA 2UVEA 1S3KH 1IT9L 3ARFD 1MQKH 2EH7H 3EZ8A 3L3KB 2BNQE 1FG2A 1SBSL 3BD3A 1NGQL 3U9PH 3VWKC 1D5ZB 1N5YH 5KS9A 4EXKA 1EO7A 1KCVH 3UZVB 2XN9E 4HC1L 1IAOB 1YC7A 3LD8B 1R5IA 4YXHH 4Y5VA 5DK3A 1NSNH 5DMYA 1BX2A 1CFTA 1KLUB 5J9PA 2FGWH 2E6PA 3QWRD 5KG9B 3FCTA 4MNHB 5CHNB 2Z8SA 4OUOA 3WBDA 5F9JA 1UKSA 4EEEA 4HUVB 2B0SH 5FKAA 3O41B 3QSKB 1U92A 3FN0H 5C08A 3EDEA 5EZLA 5DT1L 1A9BA 5D7JD 3PDOB 4I4WA 4OSUH 3IF1A 1F42A 2IALA 3MLRH 4P5TA 4TUKH 3G5XB 4M00A 4RFOL 3TBYA 3V6OE 4HZLA 3ABZA 5HHOE 1YZZA 3I6KA 4PB9L 2YS4A 1HYRC 4HWUA 4MCYB 1T66C 5F21B 2C26A 1WTLA 4UT9H 1VFBA 1UJ3B 1YEKL 2EDRA 3LPWA 1MI5E 5C07B 3WJJC 4MJ6B 4F33B 1B0RB 1SHMA 2P43B 1UQSB 4JFFE 3O0RL 3MRBB 3GSRB 2CR6A 3S97C 3BP6B 3K4ZA 5CSZB 4LSSH 3ULVC 1P5VA 2BHYA 1A6VL 2MHAB 4R97B 2APFA 4U0RC 3T77A 2F5BH 5HI3D 4JRYD 4PGEB 3DETC 4XC1H 4GUPB 5DK0B 1G7MB 2EYSA 2CKNA 1CFBA 2R0LL 3TA3B 4RGNB 4IOFD 4YGVB 3SDDB 4U1JB 4X9HA 4XVUD 2DI8A 1WICA 3VH8G 4WUKL 5F96H 3U4BL 3HLAA 5ESAB 2FECL 4LHUA 4NBXB 1IBGH 5GGVY 4XPHL 4HW6A 4HUXA 2KZ1B 5EOTA 2DKUA 3OJDB 3EIFA 3UTZA 4XH2B 4TOYL 2VSCA 2EE9A 4HWZB 4YFLF 4RFNC 4AIOA 5F89B 1CTOA 1MFEL 1GXEA 3HC3L 4LAQL 5KSBE 3M07A 2NY0C 1T1ZB 3G6JB 5F6HJ 4PBXA 2ZPKH 5FF6A 3OAUL 1SEQH 1G7JB 5I1EH 4AEIL 1NAKL 1FGVL 4HH8A 3UTTE 1FFOA 4X4XB 4XCFH 5MP6H 4ZTOL 4J4PC 5JLZB 2A74B 1ES0B 3D69A 3HUJA 1JPTL 4RMWA 3IYLW 2MFNA 4FQLH 3V0VB 5HVGB 1Q9OB 4L4TA 3WUWG 4Y4HB 1PZUB 4S1DD 3BGFC 2HLFD 5L8LB 3KS0H 3RKDC 3VG9C 2YPLB 3SGJA 3WN5A 5DJ6A 3WDIA 2MWCA 2K7QA 3H7LA 4DGYH 3SCMC 1N8ZA 1KACB 1OAUL 1S7VA 4HIXL 2R23B 5I9QB 4J6RH 1KTDB 3B5TA 4JG0L 3GMMA 2Q8BH 2Q86B 4NM8L 5ALBH 4PP1D 4XCYB 3IFNH 3G5YB 3O4OB 1VADB 3BDBA 1EO8L 1DBJH 4G42A 1OSPH 3V4PL 4ODBD 3QHTC 2E8ZA 1U8QA 3TVMC 2VDKH 5EU4A 4NN5C 4NQCB 3MNWA 5BW7C 2F58L 4NZRL 3PNWB 3UJJH 4R4NC 5F6HI 2JJTC 1HILB 3DX6B 2ZUYA 1HHGB 4LQFL 5JOFB 4U3XA 5D1ZA 4I0PC 3DYOA 4JG1L 4LPTA 4P5MA 2APVA 3KPLB 2W92A 5IFHH 4RMVA 1CE1L 3RVXC 4ODWB 4LCIH 4L1HA 5IW1B 3MR9A 4K7PX 4GQ9L 4NT6A 4XCEB 5I1IL 3N9GL 4WENB 1J05A 3QIUD 5C09E 3QB7C 5EG6C 4YPJA 5F9DC 2H8PB 4ZFOB 3QUZA 3QJFB 3ZE0E 4FQJL 2WBJA 1WFOA 3C08L 5C0GB 4XAWL 4HPYL 2Z93A 2YUXA 3MA9L 4K2UH 1QA9B 1XR9B 1R3KB 2APXA 3RZCC 3D2UA 3MYZA 4Z7WF 2OK0L 2P48B 3QWQB 1KT2A 1HHHA 2ARWA 4PJ8A 3EYUL 2G5BB 2GK2A 1JZ3A 4AL8H 4WI2A 3K3QA 3PIQA 4LKCA 2Z31A 4OIIL 4WI8A 1JPGB 4B41A 2DDQL 1AC6A 2FEEI 2F74B 4HS6B 5FM8A 5C0AB 4JPIB 4LGPB 3UYRH 2ENYA 1N6VA 3B9KA 1OP9A 4H8WL 2BY0A 2LU4A 1A4KB 2HP4A 1M7XA 2OZ4A 5IEHB 1WLHA 3CFJA 1OLZA 3DRQB 4RIRA 3VG0H 1NBVH 3CZJA 4DKFL 4HPOH 1IGFL 5EFIA 4PRPE 5D70L 1S7XB 3LZFL 5K9JH 4NCC1 4YBQD 5DMKB 4JHBA 15C8H 1UM5H 1PY9A 5FB8B 2FD6L 1FFPB 3U7YL 4E41A 4BKLA 4Q7DA 1TXKA 3IDIA 1NUNB 1MLCA 3LS4H 5I16A 4IMLB 5BVPH 4AT6A 2XZCL 3QRFM 3VD5A 4MDJA 3NPZB 1RV6X 4OLEA 1HEZA 1N64L 3CSYB 4ZO6A 5C3TA 2PTTA 1P7QB 4P2OA 3IAGC 5GSRA 1UCBL 3U7WH 4LU5H 1YY9C 2C4XA 5CINL 2BVOB 1DDHA 1HIMH 1C12B 4KI5F 5DZLA 4MA8L 3ZKND 4OUUB 2GJZA 1G7HA 4P2QD 5GISL 3SQOL 1ZWIA 2F53B 1VPOL 4UDTB 4U7KA 5IIEA 4FFWD 4V1DB 1JYNA 2VLRA 3BSZL 4D9RD 1MEXH 2FHFA 1V3KA 2K7PA 3VD3A 3DSFL 4JZNA 4Y19B 3I9GH 3CFCH 3D1MC 2NQCA 4YUEL 3MV9D 5D2LB 3VFUB 4ZDHA 2HFEA 1T4KB 4EI5B 2PO6D 5LQBH 1RJZB 1MRCL 1NLDH 5JR1H 1F90H 1K8DB 1ACZA 1DQLH 5DUBA 3VFWB 1FYTD 1TMCB 3D0VB 3QQ9D 4WI9A 2WLYA 1FVCA 4JO3H 5ESQB 3P0VL 3KYKH 1MPAH 3T0EB 4PS4H 4Q9BA 5DJAB 4IOIB 5D96B 3EYQC 1EEZA 2OJZH 1BVLB 1KGCD 2KDGA 1C08B 4NBYB 4JO2H 5KVDL 3LVEA 1I7UB 4IRSC 1E6OL 2EEDA 1Q38A 3DIFA 3RNKB 4CKVX 3GMLB 5L2KA 2QLVB 5IMMA 1YA5A 5DDHB 2V7NA 4L4JA 4JY4A 4OZIF 4H25A 5IR1A 4MQXC 4ODVH 5A2JH 3ARQA 4XPBH 4XP9H 3B2VH 4ZXBB 3N85L 3MCKA 3NGBC 4WEUD 1BQLH 1T22A 3KJ6L 1CZ8H 4PYGA 1NCCL 4K55A 3IRZA 1DBBH 4L9LC 2E27H 3CH1B 5FGBA 4C4KO 2R0WH 3V9FA 4KI1A 5GS0H 4LVNC 3RWHB 3VXNB 4R90L 2EKJA 2VN4A 3P40A 4H1LH 1HHJA 3EYOA 3WJLC 4DZBA 1WIUA 4YXKL 3ZKXB 4M3JA 4XNXH 4RFEB 2GJ6B 3GBNH 4JZOB 4ODTH 4ZMAT 4XPTL 5IBTH 1WZ1H 2RGSA 4JRYE 1MHPL 2MCPL 3ZTNH 5TDPA 4ODHH 1RIVL 3HZKB 4P3CH 1NEUA 1DQML 1MCNA 5EOCJ 4EN3D 1SY6A 3IJYA 1FNFA 5MEQB 2YEZB 1KCLA 3WIHL 1J0JA 3BDXA 4QCIB 5HGHA 2BHUA 4DFHA 2CUMA 4OLVL 2R15A 1U42A 1DANT 1H5BB 5FCSH 2Y7QA 4RRPG 3ALWA 5EZJB 3SE8L 3S7GA 4S0SD 4JO4L 4M6OH 2BJMH 1FVDB 3TIDA 1SMOA 3KYMA 4PG2A 1UXWA 4X7DC 4Z76B 1KCSH 2IPUK 4KXZI 3OX8A 4YHOL 4KV5E 4M1CD 4UU9A 5GSVA 1J1OH 3W2DL 4LPWA 2JTDA 2A9NL 3NN8B 3C5ZC 3E6HA 1D9KB 3P77B 2W9DL 3QYCA 2XXMB 1NMCB 3GSQB 1T21B 4YDLB 4JKPH 1GZQA 2AI0L 2Y6SD 4HXAH 2JIXA 1XCQA 1IAIL 3O9WC 3PWUB 5E2VH 2AABH 1UGNA 4PJ9B 2LAAA 4TQEL 1F6FB 4ZUUB 3IDJA 2ADIA 4R96B 3P2TA 1UM6L 3RIAF 4HG4J 3SGDI 1R5WB 3WDJA 3TYFA 1OAZH 2QSQA 1ZA6B 1K4DA 3BRGC 1ORSB 1KN2H 5L88L 3KHQA 5F1KC 5GGRY 3AS3A 1WZKA 4WFFD 4MNGA 3U83A 1HHKB 3DX8B 3MXWL 1Z3GH 5FDWB 1QBLL 4X6BA 3PP4L 2AJVL 2EDOA 2IMMA 3G6DL 5EBLA 3SKMB 5DJ8B 2DIBA 1H3TA 2C7UA 3L3JA 3TNMB 2YKLL 4TNWK 1W2KT 1JN6B 1DTUA 5BV7C 4XB7A 1XF1A 3U79A 4FFZH 3BVNB 1CVSC 2VLJB 4PJCE 5FUOH 4H26B 5LGKA 3IETB 4HLZH 1BBDH 1G9NL 1RZGA 3MO1B 4FQ2L 1K3IA 1N5AB 2OL3L 2WUCH 3RA7L 1N4XL 1Y18B 1CK0L 4Y89A 3BP7B 3W0WB 2CJUH 4NRZB 2P8LB 3Q0HA 1DP0A 1B4RA 2VWEE 4KI5D 1PFCA 3NFPB 1FZKA 3P11L 4JHAL 2AEWA 4A6YB 3F7QA 1DL7H 4GW4B 5E5MB 2F8VA 5FA4B 2VDLH 4G3YL 1CF8L 4M02A 3OAZK 1A2YB 1CBVL 1WEJL 2H2PD 1TQBB 5GQBA 4WV1B 4YK4C 3AXLA 4JJ5B 2HYMA 3GKZA 4WO4B 5F7UA 1T89C 2BNRA 4OV5B 1G1YA 1FZJB 1S7QA 4JFEB 5LG1A 4DVRL 3D39B 5E9DD 4Z8FH 5FM4A 1DLHB 2AXJA 1LP9F 3JVGA 2O61A 1DLFH 3ZYZA 1QSEA 5CGMA 1QLFA 4R9HA 5DGQA 1I7TA 2X05A 4L8CA 2JF1A 3BUYB 3NZ8A 3RBGA 2Y06H 3VWKD 3QUXD 5CMAA 3LV3A 3MRMA 2ITCA 3BPNB 2X4TB 3LQAC 6FABH 4YEEA 3DO3A 3W39A 1YECH 2DAVA 1B4JL 3DO7B 4GRMA 1ZHKB 4LDOB 5KVGL 2Y4SA 1XF4B 3QXVA 3TJEL 1DUYA 5KSUA 1WV7T 3WL9A 1G7IA 3DUUB 4OLYL 3HNVL 4LFHD 4G6KH 2J2ZA 3KPSB 1O0VA 3IU4L 2NXZB 3PGDB 1OP3H 4O58H 4NO0A 4X9IA 2P24A 3ARPA 2IADA 4HFWA 1RVFL 2OXHA 1AY1L 2D7MA 4UV7L 5KANI 4GG6A 1PBYA 1U3HB 3H2WA 2PCPA 4LIQH 1TQCC 5HHPA 4HGWA 4NNXB 4U6VH 3MC0A 2Z4QA 1Q72L 3DYPA 3WD5H 3GSNA 1DBKH 5AWNL 5IMOB 5FK9A 1T66D 4G8GA 2EKSB 2VXVL 1INQA 3KPNA 2FBOJ 1K2DB 3SO3B 3Q1SL 4Y5XC 3UJIH 4JVUA 4PTUB 2DB8A 1GPOH 3JV5A 3MYJA 4ZAKB 5ITBH 4QT5B 2BSTA 5FECA 1F6AB 3WS6A 4ACPA 3I3EA 3RDTC 3TO2B 5D9SB 4P2QE 1ETZA 1Q9KB 2IAMC 4NQXA 3KYOA 3ULVD 4OGXH 1NKOA 1JWUA 5HVWA 3V5HA 4E0RB 4DAGL 2JELL 3O8XA 1KN4L 2WBWB 3LRSA 4Z7UB 3WKML 5SWQB 4QHNA 2BY2A 4YZFF 4QRQB 3AREA 1EBAA 2IEPA 2ZSWA 4IJ3C 5ADOH 3NCYP 3X17A 5BXFB 2L7UA 5I19H 2J4WL 3K7UA 5T1KB 2PW2A 1AO7B 5E2TH 3BGMA 4JDZB 1S7RB 2GFBA 1HSAA 1N0XL 3MV9E 3MUZ1 5IKCB 3JZ7A 2YD8A 2NZ9C 3VFVA 4JPVL 4APQC 5KW9L 4NKDA 4NQDA 3WSQL 1FYTE 1U8PA 3I02A 3KWWB 3T2NH 1NCAH 4HLJA 1YEJL 1OPGH 5KZCB 5EBMA 4JCLA 4TSBL 1IGYA 2PF6A 3OGCA 3MRJA 4WW2A 3PV7A 1EVUA 3HG1D 3MXVH 3TIEB 4B50A 4DCQB 1PLGL 1Q1JL 1BFSA 3NBNA 3WXWL 2FO4A 4OFYD 2LQRA 3GI8H 3G04B 3MODH 5BOPA 5DMGD 3FTGB 1Z0MA 1KGCE 2CLRA 3O2DH 2AERT 5B38A 2VIRB 5E8DL 5FA3B 3EHBC 4JFZL 4HBCH 3C8KA 4P2CG 3T4AB 3LSOB 2EH8H 4D0DB 4ETYA 2AQ1A 1OQXA 3QDAA 3REVA 4J4PD 4KVNH 5FFLA 4JGMA 2P5WA 3U30C 1XIWA 4L8DB 4M48H 4K3DL 4OF8A 1FNSL 5GS2D 3UEZA 3A6BH 1WZLA 3P4OA 5T1LA 1KCRL 3QG6A 4LIQE 1UADC 2ZCLL 2XNAA 4ETQA 4PJGF 4Y16B 3MLYH 2NLJA 3SCMD 2DQTL 2NY6B 3WUWB 5INDA 4CMMA 1JJUA 5IFJA 2B2XL 3BH8A 4HKZB 4CVWA 4MWFB 3SDCC 4JZJB 2X4OA 2HG5B 2IQ9L 5I1LA 2EXYC 2CH8A 4OFIA 4XNUL 4ODUA 1KCUL 1MCHA 3STBA 5CLTA 5J1AA 5JTWA 3QNYB 5D1QC 4MAYC 1NFDB 3HE6B 1HKFA 2EDNA 4RZCB 2YPVL 1ZANL 4KXZH 1J1XL 2ERJC 4R4ND 5C0BD 4OZGF 3BAEH 5I1CH 5D93C 1IC7L 4NC1C 2A2QT 3MV7E 4I0PD 3QIBB 1TVHB 4M93C 4QRRD 3MQIA 5F93C 3FFCE 2VXSL 5JDSA 1QKZL 1S9VB 5SX5K 3J8F7 1AGBB 2ATPB 2IF7A 4X6CB 2ED9A 2FH8A 2CD0A 4DZ8B 5LJYH 1CD8A 4JFDB 2NW3B 1DN2A 3RWCA 3QULB 1WGOA 3QCTH 4X8JB 2EDYA 5GGRB 4QO1A 5JA8B 3U0WL 5B8CC 5CZVH 4AJ0A 5L9DL 1X5IA 3SKOB 2XKNB 1H9VA 2AK1L 5DRNA 3NFSL 4PGBA 4NBZB 5EOCH 1MAML 2GK0B 3RTQB 4QTHA 3K80A 3RPIB 3H9YA 3LN4B 4RX4A 5C1MB 1WT5C 2HT2C 2V7HA 4X5XA 3SKJH 3VGAB 3QIWB 1F3JB 3BPLC 4PJEB 1ZT4A 2GTWA 1GGYA 1UKTA 4UV4L 3SE4A 1X5XA 4JGUA 2HH0L 2NY4B 4KJYA 3L6FB 5DFWH 4PJFB 4LQ1A 3EOTH 1R3LB 4NZTL 5JW5B 2VR4A 4LNRA 5MEND 3X11A 1TZGL 3MACH 5DK2B 4M3KB 5EORH 3W5MA 2DD8H 1PKQA 4N0CC 4LSRL 4NZUH 3MLTB 2VZOA 4WFHE 3AS2A 3QHZH 3HZYA 3BZEA 3OG6B 4MXQC 4WFFE 1BVKA 1Q9LB 3C60A 1NAMB 2Y5TB 1FRGH 1IEAB 2A83A 3GSUB 3PUCA 5IB5A 1AQKH 4ZNEE 3RY4A 1TNMA 3ZHLA 5IEKB 4BSWB 3PQYA 5FUZH 4LF3B 1YYML 3QAZB 1J12A 1AP2B 3BUTA 3CVIL 4XXCC 3DBXA 5E4EC 1JZ4A 1JTOA 4RISH 1ZLVH 1D5ZA 4KI5E 3EJZC 2OP4L 5BRZB 1CIDA 4GT7A 1D5BA 2RFXA 1KYOJ 3QUYA 4XVTH 1MHCA 1WC7A 4O4YL 4YWGH 4KJQD 3ULVH 2NXYD 1CFVH 4Q0XH 5HD8C 4OCWH 1CLZL 4I5BB 3OPZH 4MNHA 3GJFB 1G6RA 4KTDH 5D2NC 4FZ8L 4NRXB 4HUVA 2Y36L 5K59F 3G6AA 4NO3A 3D3VD 4M4PA 4OM1L 2XZQH 4I2XE 1EH9A 1QVOB 2OTUB 3SPVB 4PJ5B 3O41A 3S96B 3WFBH 2F15A 4IHOA 3TV3H 3T0VA 4EDWL 4MCZB 5E9DE 1IQWH 3QHFH 5GS3A 1TIUA 2W07A 5FDYA 5CIPH 1AC0A 2FJGB 2YD3A 4JM2F 2FNBA 4DGIH 4WFED 3OSKA 1GIGH 3G5XA 5E6IB 1KSRA 1LEGA 5I74C 3RGVA 3BPOC 5IQ9A 3PWLA 5D8JL 4JFXB 1FBIL 5C9JB 3WV0A 3IDUA 2EYRB 4F9LC 5L8JB 3TZVB 2VDNL 3C6LC 1UJ3A 1M05B 2CRIA 4KZDL 4HV8B 1RUKH 4P99A 4F58H 5C07A 3X3GH 4MJ6A 4F33A 1B0RA 1T0NB 4S10A 3GSRA 4WI6A 4U6XB 2HKHH 5I71C 2EDXA 2UUDH 3O6MH 2MHAA 4Z7VB 4YLQT 5C6PB 1EHNA 3LDBB 5GS2H 4JHWH 1UVQA 4PGEA 3CFIC 1X6NA 5DK0A 4GUPA 1MLBA 1G7MA 2QTEA 3ZL4H 5IMLA 1QYGL 3TA3A 1SM3H 3SDDA 4XVJL 5F7MC 4OFKA 4U1JA 1KXVC 1WITA 4LSPL 4Y5VC 4YFEA 4IOSD 1X5FA 1XGYL 4MZ3A 5ESAA 2FR4B 1A4JA 5DUMH 5EDXA 3NVQA 5FV1L 4M7KL 3OJDA 1L7IH 5FOBB 2WUBL 4MGXA 2XWTA 4XH2A 2K9UA 3GHEL 3MPCA 3GSWB 3MUJA 3CSPA 4XPFH 5AZEH 4HWZA 1CL7L 1RZ7H 3M45A 4XNZB 2GHWB 5HPOA 2BVEA 4JFYB 5DD3H 3NCJL 5DJYA 1DBAL 3LMJL 1MY7A 3ULVE 2ZUTA 3H3PH 1G7JA 3BEWB 3ZYIA 5I1KL 1A6WH 3EDJA 4NPYB 3QDJD 2XN9B 4X4XA 4LK4A 5T3XL 4DQOL 3DX9A 1X5GA 5FYJH 2GUOB 1FAIH 2DBLH 3EDFA 2WBKA 5DMIL 5JLZA 3S88H 1JHLL 4I3SH 1ES0A 5CBAA 3I6LD 2X4PB 1ZLUH 2BXYA 4K23L 3FT2B 3VFRB 3V0VA 1Q9OA 1IKFH 4FQIH 4MJ2A 4Y4HA 3RVTD 5IHBA 4B53A 1PG7L 1MFNA 1S8DB 2HT3C 2YBRB 4RWHA 5E08L 5TQ2H 5KTEL 2YPLA 1YPZB 2R4SH 1I9RH 1F97A 4QEGA 1FLRL 3WYRA 1X7QB 2VZ1A 1NCTA 3HG1E 3BH9A 2R23A 3WO4C 1G7LB 5D7LD 4P2RD 2Q86A 1MRFL 5SWZD 3QEQD 3G5YA 1VADA 2VC2H 1YYLH 2W0FB 4W70A 1TFHA 2X1OA 3S36L 4F3FB 3V6BR 1ZTXH 2DQGH 1R3JB 4XP4H 3T1WA 5I8EA 4PJDF 4MJIE 1JHTA 2DMCA 3NOIA 5SWSB 1I8IB 3QPXH 3R8BB 2ZUQB 4BQ8A 3GGWB 3FO0L 3PNWA 3JWOL 4LVOB 3C2AH 1HILA 3DX6A 3LKQA 2X1PA 3SDXE 1PEZA 5JOFA 1HE7A 4LARH 3OGOE 4NN7C 1JI1A 4DFIA 1CQYA 3KPLA 4LLQB 5GPRA 4PGCA 2R39A 5L0QC 4PJBE 4OAWB 5A3IC 5GRUL 5IW1A 4XCEA 5EWIH 2G75B 4DW2H 3AMKA 4F2MB 1EJOH 1NLBH 3RL2B 4XWGH 3VMOA 2H8PA 2VAJA 4ZFOA 2BFVL 1F02I 2XICA 1BZ7B 3O81A 1G9MC 4IMKC 1ORQB 4G6JH 8FABA 2V17H 3ROLB 3CFBB 3D85A 5J6GB 2LU7A 4DGVL 1QA9A 3SGJC 3WN5C 3GJFK 1A3RH 1FPTH 4O51B 5C0BE 5TE7L 5C0RL 5GGVL 3U48A 4HG4K 5FYJE 1IEBA 1KXQE 4F80A 2G5BA 3R1GL 1D6VH 4K94L 2MPAL 3DVNA 4QRRE 3UBXG 4GAGH 1JPGA 4TUJA 4PIRF 1T2QL 4S1RH 4X0KA 1I9EA 4HS6A 5IP4A 5C0AA 4JPIA 2V9RA 2OR9L 3GSXB 2VH5L 4UIMB 4WUUD 5DVOA 5EZOL 1CGTA 4CDGC 5ERWA 2ORBL 4CU6A 2JCCB 4QRTB 5IEHA 3DRQA 3EJYC 4OZFG 3TBWB 1TPXC 3T8XB 5D1ZC 4JM4L 4YHPB 1UM4L 1UB5B 5I1GH 3BW9A 1BMGA 4PG9B 5FB8A 2ZCKH 4NZJA 3ZDXE 4JM2D 1YMME 1KULA 3NABL 3WFHB 1ZGLM 2P8PB 2ED7A 1BFOB 3QUZC 3RUGB 5MENE 2WBJC 3CSYA 1J87A 2HJFB 4DVBB 1P7QA 1U8LA 4GBXC 5I1JL 3RKPA 1CLYH 1J1PL 4L8SC 2BVOA 5D72L 5C6TH 2XOTA 1C12A 5D5MF 1DSFH 2I9TB 2IBBA 4PJ8C 4OUUA 4U1SB 5D7SL 2V5TA 4V2BA 3DXAB 2Z31C 5DJ2B 3TT3L 1AGDA 3ARXA 5F7KC 4UDTA 1Z2KA 2NY2C 5TDNB 4V1DA 3L3IA 2XFXB 5JQ6H 3MRKB 3L1OH 2VDML 3UAJC 5IG7B 5C09B 2X4RB 1IC1A 2P4AB 2C3WA 3B9KC 3VXTB 3EO0A 4Y19A 5F44A 4KDWA 32C2B 3GK8L 1TCMA 4DEPC 1UYWL 4JFOB 4XC3H 1MUJB 2YUZA 2FX9H 1JGDB 3O6FD 5D2LA 3VFUA 1MVUB 3KAAA 1T4KA 2DWEA 2Q7YB 1RJZA 2KBGA 2GY5A 3VFWA 3WXVL 4YBLB 4YHYC 3T09A 3MCG1 3D0VA 2MQCA 4CBPA 4MJ4A 3JWNC 5ESQA 3G6JF 1BHGA 3RDTD 2IAMD 1G0DA 4R4FH 1FH5H 1RIUL 1AR1C 2QQLH 1NGZB 2ESVA 3MLUL 3D3VE 1WIOA 4NGHL 5AAMA 3AY4A 1JL8A 3AB0C 1HOCA 5I76B 4P2OC 4JFPA 1OHQA 1JNHB 1R24B 1HXMB 3GMLA 1X5HA 5DUPH 4BQCA 1S9WA 1YEDA 5DDHA 2VUYA 1ZXQA 4WFEE 4S1QH 2A38A 4J8RB 1CXHA 4ZXBA 1R3IH 1J11A 4HUUB 4EUPB 4XX1E 3OV6A 2PXYB 1X6LA 3IVKB 2AQ3A 1HNGA 5HVHB 3DSNA 1FE8H 3CH1A 4PRHB 3HPJA 4OCMC 2OQJA 4OFPA 3MNVB 3RWHA 3VXNA 1FFRA 4LSQL 4Y4FB 2XTJB 3ARUA 4PJHB 1EGJH 1A1OB 3H42H 5FGCB 3V7AG 5FEBA 5H35B 4FABL 3HZVA 5IHUL 1U6AH 4RFEA 2GJ6A 2RR3A 1D5XB 3MRIB 3EHBD 4JZOA 4FTVD 4PJAE 4J3OC 4G8FA 3TO4B 4L5FL 4OZHB 1QFUL 3GDBA 2OR8A 1NCDL 4G5ZH 4NYLB 3MV8D 2CIKB 1P53A 5CJXA 3CNKA 4FQ1L 4IS6A 1PDKA 2YEZA 5KS9F 1E27B 1HN1A 4QCIA 4PJGE 1OCWH 4ZOAA 1S9XB 1H5BA 5EZJA 1C5BH 2VXQL 3IDYB 2X9WA 4XCCH 3FO9B 1AD9A 5EIIB 3LH2L 4P23B