4ZFCA

Crystal structure of akr1c3 complexed with glicazide
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
315
structure length
315
Chain Sequence
b'QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title In vitro inhibition of AKR1Cs by sulphonylureas and the structural basis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 118
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2015-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4zfcA00
4QXIA 2ALRA 2PDJA 2PDPA 3LNMA 4HMNA 4R9OA 3H4GA 2PD9A 4WDWA 2HE8A 5C7HA 2FZBA 3V0UA 3RX3A 2PDCA 1QWKA 1PZ0A 2F2KA 4IGSA 2HEJA 2PDIA 3R8GA 3D3FA 3BV7A 3UYIA 3UZWA 3BURA 3V36A 4XZLX 3CV6A 2NVDA 5LIXX 4GQGA 4LBRA 1ZUAX 1AFSA 1MI3A 3Q65A 3LUTA 3CMFA 3GHUA 1OG6A 1YNQA 4ICCX 4OTKA 1YE6A 2PDHA 3C3UA 3G5EA 3R43A 4I5XA 3ERPA 1YNPA 3MB9A 1PWMA 4PUWA 5KETA 3ONCA 3EB4A 4JTRA 4GCAA 4QR6A 4MHBA 4LB4A 4JQ2A 3UG8A 1C9WA 4XZNX 4IJCA 1HW6A 5HA7A 1ZGDA 4QX4A 2IKJA 4F40A 2I17A 1X96A 1X98A 2ACUA 2PDFA 1LQAA 2PD5A 3GHSA 1S2AA 3U2CA 1EF3A 4YU1A 3LQLA 4GABA 5HNTA 4GQ0A 3LZ3A 2I16A 4DBWA 2DUXA 4GACA 4WEVX 5AZ0A 4JTCA 3Q67A 1IEIA 1VP5A 2BGSA 1ADSA 4PRRA 3H7RA 3H7UA 1Q13A 1QRQA 2AGTA 1GVEA 2PF8A 3WBYA 1MRQA 4YVXA 3B3DA 3O0KA 2R9RA 1RALA 1Z9AA 1EXBA 2IPGA 1PYFA 3UGRA 2IKGA 4HBKA 2PDNA 4JQAA 1AH3A 1XGDA 1EKOA 2HVNA 4EXAA 4L1WA 4XZHA 3R94A 4PMJA 3UWEA 2IPFA 2IKHA 3LZ5A 3CASA 4JTDA 2PDGA 3CAVA 4ASTA 4IJRA 2FZDA 2FZ8A 2QXWA 3UFYA 2IKIA 5JH2A 4RPQA 2INEA 2PDXA 1ZSXA 4Q7BA 1S1PA 4G5DA 3GHTA 3UZYA 2FZ9A 3LQGA 5HNUA 4DBUA 1VBJA 3LEPA 1AH0A 2ACQA 4XVEA 3O3RA 4JTQA 4WRHA 3VXGA 1MZRA 3BUVA 4XO6A 1US0A 1R38A 3CAQA 2PDBA 4PRTA 2PDYA 4LAUA 1SM9A 4XO7A 1Z8AA 2PZNA 3QKZA 2R24A 2PDQA 4PR4A 2ACRA 3G1RA 4FALA 4JQ3A 3COTA 3LD5A 4LAZA 5LIUX 3DN5A 3M64A 5DANA 4H8NA 3V35A 2PDWA 3M0IA 2INZA 4WDUA 4XAPA 1AZ2A 1ZQ5A 3WG6A 3CV7A 4YVVA 4XZIA 3ONBA 4JIHA 3MC5A 4JQ1A 5M2FX 1M9HA 1EL3A 4WDTA 4XVDA 3UP8A 5AZ1A 2NVCA 2IS7A 4FZIA 3EAUA 3T42A 2IPWA 4XZMX 2WZTA 4NKCA 2BP1A 2IPJA 3P2VA 1K8CA 1FRBA 1AZ1A 1A80A 1LWIA 5LIKX 4XK2A 3EB3A 3RX4A 3RX2A 2VDGA 2DUZA 3NTYA 3WBWA 4LBSA 2FVLA 4WGHA 2WZMA 3R7MA 2HE5A 3GHRA 1YE4A 1PWLA 1JEZA 3LENA 1J96A 3N6QA 4FA3A 2F38A 2J8TA 3KRBA 3R58A 4H7CA 2PDMA 4ZFCA 3LN3A 4Q3MA 2HVOA 2PDUA 5LIWX 1HQTA 2ISFA 3DOPA 1S1RA 3R6IA 1X97A 3GUGA 2P5NA 2PFHA 3FJNA 1RY8A 3F7JA 1AH4A 1S2CA 4GIEA 2PEVA 4LB3A 1XJBA 1Z3NA 3WCZA 5JH1A 2IQDA 4YS1A 2ACSA 4QBXA 1RY0A 3S3GA 4GA8A 2CLPA 4JIRA 3V0TA 4AUBA 5LIYX 1IHIA 2HDJA 3BCJA 2BGQA 2DV0A 1T41A 3FX4A 3R8HA 4DBSA 1Z89A 2PDKA 3V0SA 3N2TA 3UZZA 2A79A 2C91A 4FAMA 4WDXA 3LBOA 1UR3M 1PZ1A 1Q5MA 4JIIX 1XF0A 4JTAA 4L1XA 4PUUA 2PDLA 3UZXA 2IQ0A 4DZ5A 3WBXA 2FGBA 1T40A 2HV5A 4JQ4A 4YVPA 4EXBA 3M4HA
chains in the Genus database with same CATH superfamily
5GJMA 1VEMA 5C2GA 1E1CA 4POCA 1UZ4A 3EMCA 3TROA 2ZWYA 3G1FA 2DT1A 2VFHA 4YMZA 4JY8A 5C7HA 3W70A 1XPYA 1NP2A 3M0MA 1CECA 1XYBA 2F61A 4Q8QA 3E2QA 3RNDA 1TV8A 4IGSA 4MDOA 4LY8A 1I60A 1W3JA 5ABFA 3RO6A 3LERA 3LRLA 4Y9AA 4AMCA 4ZOCA 3CEUA 2UV8G 3TKFA 2ISVA 2V81A 2ZUTA 1UUMA 3GW0A 3WD2A 4TUFA 2PWGA 1O5XA 2JQXA 3CMFA 4Y9NA 1AQFA 1XIHA 3SUVA 4TX8A 1KC7A 1DXFA 5HNNA 4ZGYA 1UWUA 4QQUA 3DGRA 3AUJA 4J27A 2GQ9A 2PDHA 4AMAA 3PZNA 2GVGA 3CNYA 2GOKA 3T09A 5F1VA 4M24A 2WW5A 4LNYA 4HPGA 3SUSA 1W32A 2Q8LA 3MW7A 2QR6A 3PANA 4HZ7A 2ESCA 1LP6A 3RITA 3ZVHA 5EBUA 4CU8A 1L2UA 3SZ8A 2QPSA 1REQA 4JYEA 3IIOA 4AVFA 4N9CA 4M6UA 4CNUA 1GHSA 3U2CA 4GIAA 3IVUA 4IX2A 3WUFA 3AJXA 3BGJA 3K2GA 4PSRA 4DPQA 3W4RA 4RCXA 2G4JA 3MV01 4OGZA 1GZJA 1Q6RA 2E6YA 1DTNA 2VRJA 2DUXA 1XIMA 1UZHA 4JTUA 4MZ1A 3WDRA 4O17A 1PDZA 3AROA 3E3HA 4UMAA 1IEIA 3N34A 2JIWA 5A2BA 2JK2A 4GVFA 4H9YA 3UVIA 2YZRA 5XIAA 4B9ZA 4HCDA 4U5IA 3WBYA 4UMCA 3U4FA 1JVNA 4G56A 1JDFA 3POHA 1PX8A 4ATLA 4GLEA 2V0TA 3UZJA 1A4LA 4A21A 4HNCA 3TC6A 3S42A 2QAFA 3F4DA 3UBPC 2XISA 3VD5A 1UHVA 1AH3A 1ZP3A 1XGDA 1FWIC 4RNIA 4FPSA 1L2QA 2QPXA 2Q3OA 1EJUC 4XZHA 3EXTA 5KITA 4PMYA 1F76A 2IPFA 2QJHA 1LF1A 1CTNA 4LANA 3HPFA 3KS5A 5CSSA 2HJPA 5D04C 3S1VA 2D2JA 3SUWA 4WJ8A 1NELA 4KEVA 5JBDA 1TJ2A 4PUDA 5FAJA 4UWMA 5ABHA 4QSHA 1BYAA 3PSWA 4XV0A 4AY8A 1X8CA 1RCOB 4QQ3A 3UZYA 3KTSA 3BCFA 3UEQA 4DBUA 5CAKA 3T08A 2XFWA 3AIRA 2V9DA 4DUOA 4IHCA 3CL8A 1JFHA 5C8BB 3DIPA 1MZRA 2I56A 3QZAA 1DWGM 1ITCA 1US0A 4DJEA 1OFBA 3NPWA 1YADA 3L0GA 4O28A 3UCQA 3TNBA 2OOGA 1Z8AA 2VZUA 1D7FA 4Q8TA 3SCTA 4JX4A 3OPSA 3ZWSA 1HJWA 3KOWA 4PMVA 1OYCA 2INZA 4PFMA 1M7OA 4RZ6A 1OCBA 1ZQ5A 1J8VA 4HNOA 1VR6A 1UH4A 1EFZA 3MKKA 1UUOA 3C0SA 4O0KA 3GTXA 1M9HA 3RCNA 2FB3A 3PJUA 4YN5A 1GQJA 5EGRA 3UT0A 4QLLA 3TNOA 4BKNA 2F2HA 1ZJAA 3DYPA 3ZT5A 3VDBA 1JJKA 4BS0A 3IS4A 3EDKA 4GGBA 3DFTA 4S3JA 1RP9A 1NJJA 1WX0A 3U5UA 3TAOA 3TJLA 2VDGA 3HGRA 1LTDA 4KCUA 2Z0IA 2GPTA 1ZPTA 4I9MA 1L6WA 4GG9A 5IFTA 2O4QA 3VX0A 3C2YA 2V82A 3THDA 3ZSTA 4DZHA 3QR1A 4F79A 1Q6LA 4FXRA 3FA4A 1XUZA 1YQ2A 4CNPA 3DHPA 2HVOA 2GUUA 3OA5A 1U1JA 1BRLA 3H2MA 4GCXA 4MYAA 5AC6A 3ARZA 5FACA 1BPLB 4WY0A 1TZ7A 1JYXA 1ZL1A 2CLFA 4Z08A 3WX7A 5C9XA 3TLLA 1PSCA 3LB0A 4XD6A 3F7JA 5DMMA 4DWSB 3OA3A 1J79A 2QW5A 4F48A 3SW6A 5DN1A 1OK6A 2WQPA 4C65A 1MEWA 3EWXA 3MANA 2HS8A 2VCCA 4FIQA 4NJKA 5JU6A 1Y7VA 2GSEA 4WUIA 1EBHA 4C5ZA 4B3ZA 4BY3A 3BPWA 2Y8UA 4AWUA 1FKWA 3PZQA 1B3WA 4GC4A 3V5CA 4QISA 4HQVA 3H26A 2Y2WA 4RDYA 1MFVA 4O12A 2A79A 1Q5MA 4LU0A 3F2BA 2DT0A 3C2RA 4F9DA 2HROA 1KTCA 2ABAA 4P8XA 1Q6FA 1OY0A 3Q94A 3EWBX 3APGA 1WDPA 1OFAA 1J0KA 4OOUA 3R8RA 3AO0A 4HU4A 3S6DA 4GQRA 2E1DA 3OZOA 4GI4A 1B3ZA 4ZA0A 4B16A 1SPQA 4JR5A 1XH1A 1A53A 3CIVA 3W26A 3ZO9A 3NUKA 5C5YA 2PSNA 4CQBA 1QPQA 2NT0A 1KR1A 3SQMA 4HCHA 3BANA 5A6TC 1Q7MA 2VMFA 1AL7A 1POKA 3ARSA 4H9ZA 2X2YA 4GE8A 3AHYA 3SN0A 1U83A 4NYUA 2R6OA 3CUIA 1HX0A 6REQA 2WSPA 1R9YA 1R8LA 4U2YA 3AI0A 4A29A 4AYSA 1IXNA 4DI8A 3R5EA 3TIMA 1JZ2A 3UZWA 3KEHA 2VEKA 1JDDA 3VDAA 4D8ZA 4NZCA 4EOUA 3I6EA 3UD6A 4ZO6A 3NO1A 4ICMA 5G2IA 4MZ8A 3B0VC 2Z2BA 1SO3A 3EOUA 1EP1A 3NYZA 1TTIA 1LOSA 4UTHA 1ADOA 4Q33A 2BBFA 1FWHC 3LM3A 1DQWA 3BW2A 3T55A 3FFSA 1PWMA 3GR8A 2ADAA 2QUNA 5H1WA 4I5RA 2XH7A 2WXDM 3IJQA 1K6AA 1LUCB 2UBPC 2OFJA 3SBFA 1VJIA 2X0YA 1NFGA 4M51A 2Y7FA 4PB4A 3MP5A 4YIWA 3F1QA 4EKJA 3GXNA 3K4WA 3LHYA 1C92A 3W2LA 4U3AA 3O9NA 3PBWA 4F2UA 2TRSA 3S46A 3LXAA 3CQKA 2VI0A 1X6LA 2ZX8A 1SZEA 1UKQA 1Q7QA 1OB0A 2XDFA 2C14A 4LTSA 2E8YA 5FEWA 3BLDA 3CZKA 3VIFA 2OQLA 4FNPA 1M7PA 1Z7AA 1OX4A 3QTGA 4P7RA 2I16A 4IPJA 5AZ0A 1X7FA 5HR7A 3E0WA 3ZLGA 4S3GA 5A5WA 2A2IA 1TV5A 3PBYA 3UA3A 4UB9A 3N73A 3T9PA 4QITA 1TPWA 2QUVA 4GC3A 1YDVA 3UJFA 1R5YA 2Q6ZA 3MKCA 3TSBA 2EPOA 1NU5A 4QE5A 1V3MA 1W5MA 2W3ZA 2G0WA 2Z28A 2EJ1A 1XICA 2Y1HA 2YCIX 5CGQA 3MSGA 1EKOA 4XAYA 1TWZA 3S9YA 3PJWA 1RJPA 3MS8A 3RLGA 4PN2A 3LZ5A 4HN4A 3LGGA 2PDGA 2J7GA 4A22A 4LS1A 3C5QA 3SCOA 3SUUA 2FB2A 4IUGA 4YJ5A 3EDFA 4B9YA 5JH2A 1KM0A 4XAZA 3NQAA 2EG8A 1W0MA 4G5DA 4PMZA 1DHPA 3M0VA 1LRNA 2XIMA 4OU1A 3VD9A 3GS6A 4AWSA 2TAAA 4FEZA 3XIMA 2RH9A 5I6SA 1T7LA 1RPKA 3W53A 4H6QA 1BF2A 2OEMA 3LXCA 2CZ5A 3W1XA 2VP8A 3NFUA 4IF2A 4N2YA 2PDYA 1UWTA 1ZP4A 2E6AA 4IG2A 4D6GA 1KNWA 3G1AA 4CEUC 4C6NA 4OBRA 4AC1X 3EZ4A 3GXPA 3PBUA 5FJUA 3SIMA 1H7PA 4QG6A 1DHKA 3G0XA 4CD4A 1UJQA 3BW3A 5AHIA 3CH9A 1R47A 2CHRA 3H8AA 1XV8A 4KCTA 3EXRA 4J9JA 3ARYA 4PTDA 3ARPA 4B5TA 3DI1A 3AS0A 1PKMA 5HPOA 4MUZA 2FKPA 4A3UA 2OLSA 2YOCA 3O0FA 3GNRA 3W22A 1BXBA 4BF9A 2A3EA 2Y8KA 3WFLA 4J2MA 2X05A 2XINA 2DH3A 1WZMA 1TV3A 2IUZA 4PTNA 2OYKA 1JYNA 2XN1A 4LPCA 3K46A 4L56A 2OQHA 5EA9A 3QXBA 5LIKX 3W27A 2PBOA 3T81A 4BWLC 1RHCA 1MXGA 2DVUA 3BCDA 1UR0A 2O9RA 3ZQ9A 8XIAA 1ZAHA 1DE6A 2PTZA 1MEHA 4MY9A 3B8IA 1GNXA 2ZX9A 3MZNA 4CU7A 2J8TA 1YTEA 3JZEA 5LNRA 4CCCA 3OVQA 3C2EA 4XIAA 1X8FA 3T05A 4DLMA 4DHGA 5BCAA 3E2SA 3THQA 2VXNA 3DOPA 3SGUA 4UQEA 1W3IA 1X97A 2ZE3A 2OQYA 1OZQA 1P6BA 1IIGA 5G1TA 1IEWA 2ZWZA 3S6TA 3OODA 4HYRA 4L61A 1GGOA 3EX4A 3W7EA 1B1YA 1TWIA 2ZOXA 4FLSA 2A3BA 2DZUA 4QBXA 1GEHA 1MNSA 1V0MA 3M43A 3W85A 5CBIA 4UQCA 3VFCA 4I6VA 1EYWA 5LIYX 4AAJA 1XRSA 3V5OA 4W86A 2W61A 4UQDA 2Z24A 3BMWA 4HN8A 2EPLX 1V0NA 2NQZA 1YDOA 2JEPA 1AK5A 3KOXA 1Z89A 2BODX 4Q8PA 3IRSA 5DCDA 3V0SA 1HKJA 3MCOA 3RUBL 3N2TA 1OD8A 3CV1A 2CU0A 4MJMA 6PTDA 1LORA 3P82A 2WZHA 3IAPA 4GFSA 1F8MA 1QI5A 1T40A 2Z7KA 3IVSA 3W1TA 4YVPA 5A6BA 4CKQA 4CN4A 3PC0A 3R4IA 2C13A 1N82A 2V3FA 3U7BA 4UOQA 3VILA 4UXDA 4KEUA 3GTFA 1XYMA 3VDCA 3WMSA 4M6VA 1KCLA 1EO5A 4ZOBA 3TE9A 5IOBA 1FXPA 3W7RA 3P80A 2RFGA 1QWKA 2F2KA 4AY1A 3GWQA 2HEJA 1UZDA 4C7DA 1U33A 1QW9A 3PN8A 1LDCA 3UYIA 5CSRA 3V36A 1CB2A 4WKHA 3E2RA 1HJVA 4DAFA 1YDNA 5BU9A 3UXAA 2RGMA 3L4ZA 1Y8BA 2WAGA 3VD7A 4BQ3A 3LUTA 1US3A 1F05A 5AYIA 3P5ZA 1O1HA 4HJWA 3V1PA 2HMCA 3G0SA 3TTQA 3BMXA 4NRSA 2E4TA 5A95A 3MA8A 2A0NA 5E0FA 1SZFA 2ZZ6A 3VE9A 1XP3A 5FAGA 4CD5A 3CH0A 3OW1A 2YB1A 4GCAA 1JPHA 2B0MA 3E5PA 3QTPA 5FL0A 2X1RA 1SSDA 1GQIA 3DENA 2DP3A 3TCEA 3RN6A 4TMCA 1CEOA 1KB3A 7A3HA 2QT3A 5AECA 2ZRZA 4GUHA 2ACUA 1V0LA 3NM3A 3WD4A 2VZOA 4GO9A 2J9XA 3HIJA 3N14A 3IJ8A 3LQLA 1YPFA 2OR2A 5FJJA 2BFGA 3KRZA 3BH4A 5HJXA 4FLRA 3TW7A 1J12A 3GAYA 4IT1A 2ZXQA 1G7UA 1IF2A 1QASA 4KWWA 4L9YA 3H7UA 3EX2A 3L9CA 3UJSA 1QI2A 2G95A 3GZAA 4D6EA 2DZVA 2PWFA 3B06A 1E71M 2VVNA 3OVGA 2BV9A 4B5WA 3NSMA 2Q8XA 5EFFA 2X1SA 4P8UA 1GT8A 3BOFA 4A3QA 3PTMA 2R91A 4XSMA 3QMRA 4QHRA 5G2WA 3PWIA 3STFA 1TJRA 1BTMA 3B0PA 5IM51 1CXFA 1BLIA 1ODZA 4A35A 3R94A 4JFUA 1H61A 3K4AA 5BNKA 2Q01A 3MWAA 2PC8A 2EPKX 1VD6A 3C3NA 3TJXA 4KWVA 1QO5A 4BK9A 3JW7A 1UC5A 1SFSA 1EJSC 1EWDA 1KLZA 3CV2A 3QZ6A 1U5JA 2PDXA 4WY0F 4Q7BA 1UP3A 1ONEA 1DIOA 3UZ5A 4GBDA 2V2DA 4H9VA 3PZOA 3DKLA 2PTYA 3G1HA 3I3EA 1I2QA 5LA1A 2WMIB 3R89A 3ZLHA 3CAQA 4PB3A 3WF1A 3AS2A 3S2MA 1PZ3A 1JZ3A 4HHLA 3D5HA 4UR8A 3KE0A 4HMCA 5D2TA 5DY3A 3ITYA 3KBMA 4ZTYA 4NT0A 3WLPA 1DKWA 3KCLA 2ACRA 3G1RA 3KHDA 4Y96A 1EB3A 4P5UA 3WLKX 4GY1A 4F66A 2NLYA 1IV8A 3V35A 2ZUWA 3Q4DA 1FCBA 1AJ2A 2YLAA 1TJPA 2HCVA 4RDVA 5FI8A 1G9HA 1P48A 1GOMA 1FFRA 5FOOA 5M5DA 3W87A 3WZ0E 1XX1A 3GG8A 4INFA 3VCRA 3H55A 3W7CA 1V7YA 5GVJA 4ROPA 2HK1A 3CLMA 1EC9A 3BE7A 3VIGA 1QMLA 1PIGA 3WQEA 4B5NA 1IWAA 3FSTA 2ABBA 2PRLA 2WNNA 4A2SA 1RCXB 3LCGA 3ANUA 4BEUA 3HMCA 4QEHA 3GIYA 2XM2A 3T0TA 3RX4A 3ABZA 3RX2A 1DIEA 4C1NA 5CZKA 2BY0A 3PZIA 2W67A 4RK8A 3HQOA 4HVXA 1XINA 4O50A 1W3TA 4CUCA 4RXFA 5EMLA 4LYKA 1P43A 2NVAA 4WKAA 2NXHA 5EYWA 1UIOA 2P8CA 1OD0A 2WVSA 1HQTA 3M5YA 2WNWA 1VB9A 2ISFA 3PG9A 4PUMA 1M04A 2GWGA 3A21A 2GGGA 3WMBA 1ZFJA 1DJHA 1A5MC 2PP1A 1ZCOA 5F4SA 1MSSA 1E9YB 1UKSA 1RY8A 2OO0A 4QCFA 2PEVA 4DWDA 2X2GA 1UYQA 4QDMA 5JH1A 3PTQA 2YYTA 4AIEA 3T40A 5CXPA 3QGAC 3RDKA 5KSWA 3SY8A 3P14A 1FCVA 3I7RA 3GNOA 4Y6GA 5AVNA 2BGQA 1BHGA 3W7PA 5DT5A 3ECQA 4UZUA 2V5DA 1EDQA 4EANA 1E0VA 5DRCA 4U3CA 3NJ3A 1DJNA 1QI4A 3OYXA 5G1MA 2D1ZA 4RW3A 3GAKA 3U2OA 3MHFA 4UTWA 3OLGA 4GINA 4RW5A 1TPB1 5CKSA 2A21A 4W7VA 5HINA 2NV2A 3B4UA 1NDVA 1BG9A 2DSKA 2WZEA 1SO5A 1MVYA 2GJNA 3IGHX 2FZNA 5A69A 3KM8A 4GNVA 4CD6A 4X0VA 1I2RA 1E4NA 4IP5A 3EEZA 3O6AA 3TWBA 2V5JA 1KW1A 2DIJA 4RX0A 1B0IA 3ABXA 3NGJA 5DBTA 1ZJHA 3VOHA 1EDTA 1XD1A 3MYOA 3EPMA 4GXWA 4Z2LA 1VBUA 2OLHA 4EK7A 4IPNB 3RK8A 1J4EA 5HULA 3RPDA 4HSHA 4Q7IA 2VEGA 3W1QA 1W8GA 3NQ7A 4BJHA 4C90A 4ZMGA 3HPSA 1GJWA 4IIBA 1F6PA 3BAJA 3UXIA 3CV6A 3UXDA 4KS0A 4M7SA 5FF4A 7CGTA 4AZHA 2Z29A 2NW0A 4N6EA 3Q65A 1R30A 2GZXA 3HV8A 3LV6A 4A3HA 3CO8A 4NG3A 3WNOA 4O16A 2B81A 1CXKA 3C3UA 2RDXA 3DFSA 4W5UA 1A5AA 4TO8A 3F5JA 4H2HA 4XTDA 1Y5WA 1J6OA 2AQVA 2HISA 2Z00A 1QPRA 4MGGA 4BWLA 1GOWA 2PAJA 2XM1A 2PBGA 2YL6A 5FF0A 4XZBA 1GPFA 1NH6A 4LAMA 6XIAA 3E0LA 1H63A 1EJTC 2PDFA 3L5LA 2YGYA 1TUXA 3DESA 3EWUA 3FJ6A 5AN7A 1TX0A 4HPJA 1W5PA 3DG6A 3WDHA 1HUVA 3LOTA 5HNTA 2CXGA 2DIKA 4A05A 2BLEA 3AHTA 2C0HA 2ZA1A 3KCOA 1WCGA 4EIVA 3QV6A 1BYDA 2WC7A 1Q6CA 5EL1A 3W6MA 3P74A 5HUPA 1ZJBA 3C52A 4H83A 4XD3A 3GD6A 1R3YA 3M0XA 4O19A 2OYMA 3M9YA 1ZZMA 5I77A 1WKFA 1EX5A 4X3ZA 1XBVA 2VELA 1H7NA 1C91A 2R1KA 3WMCA 4O8AA 2HTMA 4JN7A 1K8YA 4GWEA 5CPOA 2HPIA 3L21A 3KLLA 3DERA 1B3YA 1G01A 1XGEA 4C7FA 1VFUA 2F6UA 1RD6A 1NWRA 3CT2A 4OV4A 3GO2A 2PCQA 3YPIA 3ZR6A 1EP2A 3PPFA 1C7SA 1LQ0A 4QLKA 1BF6A 3VC5A 4HK5A 4US6A 1Y0EA 2VYOA 1OG0A 4DZIA 4HNLA 4JYFA 3TOYA 4WSKA 1UROA 4BQ2A 3SY5A 3SAZA 3M41A 1W5QA 3MUXA 3WUGA 2CLHA 2OT0A 5JBFA 3ITTA 1W9UA 4WCJA 3I3BA 5HNUA 1QW7A 2A3AA 1JNDA 1H09A 4LUTB 3O3RA 2ZZ4A 5K7JA 3W02A 5EB8A 1TPFA 3T0DA 1TKKA 4ML4A 2TPSA 3USBA 3VKDA 3ZJKA 2Y24A 3OHIA 2PDQA 2ZA2A 1DPMA 3KVLA 4OHQA 3WNPA 4F0SA 3UESA 5LIUX 3RR4A 2HVMA 3UWVA 1C90A 3VI2A 3B0UX 1DJIA 4ZO8A 3LSBA 3NQDA 3EMZA 4GGHA 3ITXA 4ZO9A 1S2WA 3BOLA 5AYBA 1QNQA 3I4EA 3I10A 3T1GA 5D9PA 1HL8A 1W3KA 2BSLA 2PLCA 3MPGA 1RXOB 3ABRA 4EPBC 4DYEA 1EA0A 1E6PA 5HWJA 3W2MA 1H7RA 1IWPA 3NL6A 2H3DA 1JGIA 3FHQA 1W91A 3UP8A 2ZIDA 3RU8X 2PZ0A 4NZJA 3EPOA 3G1DA 4FF7A 5I0DA 4F2BA 2WCAA 3ITCA 1OGGA 2PCEA 4HZMA 5T9CE 3TYCA 5D9NA 4HYVA 5JMUA 3IK2A 3NTYA 1F3WA 1GEQA 2YDAA 4Q6JA 3ATZA 1KXVA 1WDDA 3WLQA 3TLQA 2F38A 2WJFA 2VGFA 3CTLA 2OGJA 3WFAA 3TQPA 5EKYA 2GUBA 1W1TA 4X63A 3VOCA 2WCGA 5E0KA 2OTDA 1V6TA 3AHXA 2ZTKA 2WKGA 2NZLA 3E0VA 1DJWA 1XC6A 1MFUA 4CNTA 3RM4A 3UXLA 3OTRA 1HFBA 1HTIA 5E93A 3S2NA 4GUJA 4NU7A 2CNCA 2VX4A 1BG4A 2UY3A 2Y7DA 3WQCA 1WQ5A 2OSXA 4MB5A 2BVDA 4MUPA 4J7RA 2PTDA 1CNVA 5D09A 1VBHA 4O4VA 1IT8A 1W17A 4QAWA 3I4KA 3BGAA 4JN8A 1GKPA 3AWOA 4DYJA 1JG9A 3H4WA 3NQEA 3P62A 4UR7A 5EU9A 1R86A 1ZNNA 2XTKA 2XWDA 4LC8A 2EPNA 3CUFA 4F3HA 2C79A 4FAMA 2P3EA 1ENUA 3GSMA 2ATMA 2FTYA 1K7XA 1WDSA 1R85A 3VUSA 1K4HA 3C2FA 3PS7A 3ZYZA 3EX1A 2VT0A 3WUBA 3CEPA 3GBEA 2V38A 3S47A 4PCSA 1RBLA 2QHAA 1W9VA 4H8UA 4IQEA 3NDOA 4MY8A 3D46A 3M46A 3M4HA 4JD4A 2ZRYA 3BMVA 3WN6A 1N8WA 4UTUA 5AC4A 4S2CA 3MI2A 3V16A 2PDPA 2HRWA 3SIZA 3VZXA 5A6SA 3QHNA 3LNMA 4URIA 1IEXA 2GGHA 1IIHA 5I79A 1CGWA 2OWCA 3LBMA 4UNIA 3AU6A 3GC4A 2XG9A 4CQ9A 5CGMA 2PMQA 2P3ZA 5REQB 3CB8A 1RH9A 2E6FA 4LS2A 3WJWA 1RR2A 3PR2A 4O10A 2JALA 1RPXA 3W28A 1A5OC 3B0YA 2ODOA 3BV7A 4XTIA 3NIYA 1VCVA 1DWIM 3IUHA 1E6RA 1Y65A 4O18A 4XZLX 3VKCA 3R0UA 1QNOA 3TK7A 3GXIA 1DE5A 4MWAB 2DT2A 3QLLA 2J7FA 4A4AA 3SI9A 5I5RA 1FWDC 1UKTA 5DMNA 1G0CA 4L4MA 3P8JA 3A64A 4S3KA 1BYCA 1XD0A 4RNFA 5IDIA 2HXTA 1V7AA 4FNRA 3GVVA 3H4XA 4DXVA 2CPUA 3UY8A 3FA3A 1B9ZA 2KX9A 3SCVA 4GOAA 1A47A 5KETA 4UQBA 2CESA 3KL3A 4JTRA 1X1NA 1QBAA 3KL0A 3P5YA 1I1WA 1SFLA 2WC3A 4CEXC 4WSHA 2ZADA 3PK7A 3CQIA 2ZYFA 3N2BA 1X98A 4KFOA 4PEKA 2PD5A 1E6SM 1VAHA 3UXKA 4OUEA 4BF5A 3DYOA 4CQ8A 1C9DA 4N4QA 3OZYA 1HKMA 3WLJA 1EF2A 4D9PA 4QP0A 4W8BA 3HB9A 4GUIA 3TA9A 4L6DA 2EXOA 4C6OA 3TN4A 4IX0A 3WD1A 3H21A 1SFJA 1A0DA 2CC0A 2X40A 3LDVA 1ZS2A 3KHJA 7ENLA 2QCDB 2DZAA 1MRQA 3EWYA 4FX7A 5CPTA 3VIMA 3OVPA 2H8XA 5C9WA 3WLRA 1JCMP 2JEQA 4B4HA 1VPXA 4LYQA 4DUXA 4RE0A 3BARA 1O5QA 2XVGA 5IRPA 2NXGA 4LRSA 5E6ZA 2GSJA 4M0XA 1TR9A 4NF7A 4HHPA 2CHOA 3OZPA 4LUJA 3W2UA 3I68A 4V1XA 1FXQA 2INEA 3DFHA 4Y9MA 5F2MA 4R53A 3GXMA 1XLIA 2Y5SA 3EPNA 3SSZA 3TDFA 3NZGA 3WDQA 3K8MA 3KTCA 4WRHA 2CZDA 1DJXA 3T6CA 2BTMA 3LLFA 4O52A 1GTHA 2QVHA 5BZAA 1TJ0A 4KMQA 1Q8AA 3ES8A 1QNRA 1D8CA 3L12A 3RMJA 3MHUA 2QDGA 2GUYA 4H6RA 1S5WA 2OJPA 3GIPA 3BAYA 5C9RA 1TPEA 5I06A 2QPUA 5F7UA 1KTNA 4H8NA 3W73A 3VPLA 1V3JA 2PA6A 1EIXA 2D23A 3MC5A 3NQ8A 4M1RA 5M2FX 5CJ5A 3TH6A 3OP2A 1VFTA 1PS9A 1L9WA 1E0UA 2YZ5A 3T0CA 3DHDA 4IMEA 4GYFA 5DMLA 2WVVB 1EH9A 4RZ4A 2RUSA 3MWCA 3GTNA 2R1PA 1N8FA 5I3FA 1G4EA 2IPWA 2FVMA 4IXHA 4P7QA 1VEPA 2PS2A 3ARRA 1VLIA 3W7KA 3QYSA 2Y0FA 1Z41A 4NKCA 3JRKA 3LS9A 3SRHA 4E4PA 4P8WA 3IUIA 3CZJA 2E3ZA 2J78A 4RDWA 3G22A 5T26A 3MMDA 4GMEA 3MYPA 3KXQA 3KLKA 2QJNA 1I6NA 1PXGA 3C0JA 3N11A 4MPQA 4Q22A 1UR2A 4RKAA 2CKSA 1CDGA 4FNUA 2FMNA 2J79A 3E9AA 2YX0A 4XIMA 4AEFA 2OG9A 2HS6A 1XCXA 4FNQA 4TXEA 3PNZA 1DWJM 4GPNA 2CBVA 4XSLA 2X1TA 4JTHA 5HOSA 1S1RA 4AZCB 1VCFA 4XKMA 4NRRA 2FMOA 4QROA 1CENA 4RE2A 5DFAA 4BFAA 3VNZA 2OZTA 2D24A 5A6LA 3P0XA 3WJYA 5I07A 2QF8A 4JNZA 4Z1DA 2FH8A 1UD6A 1TRDA 3SURA 1RVGA 1XISA 1VZWA 2CLPA 4MKSA 1QR7A 4QLJA 1GYMA 3N25A 2VQTA 3UWQA 3BK0A 4K1WA 2YKKA 3WBAA 3O63A 2DU2A 1VGAA 3EMQA 2DIEA 4FSAA 1JDEA 1UCWA 4WDXA 2E9BA 1L6SA 1UR3M 5I09A 2VENA 2VR5A 3BSMA 3NVDA 4Q6XA 5TBOA 3B97A 2JKPA 4HZ6A 5I3DA 4LCQA 4DJFC 5DBUA 3GYEA 4PUUA 4KESA 1A0CA 2FGBA 1S3HA 1UBPC 2YL9A 4EXBA 1OT2A 1FHDA 2WKLA 1XLCA 4WXZA 4H9XA 3FKKA 2DSUA 2CLMA 3CM4A 1WZLA 4DAIA 4ZQRA 1CZ1A 3FKRA 3RYSA 4DN1A 1TELA 2X30A 5AYYA 2GGIA 2E9LA 1KQZA 1WO2A 2IXUA 3GH5A 4Q4MA 1AMKA 1H5YA 4NASA 2GDQA 3MVTA 3WK0A 1K8ZA 4YTTA 3WLNA 1WA3A 4DPPA 5LNWA 3W7OA 1M41A 3O15A 1NWUA 4GQGA 1GJUA 4M19A 1XKYA 1LRTA 4C1KA 5EY5A 5FL1A 2FDMA 3V1HA 2DSZA 1TV7A 1OG6A 3W6YA 4XG1A 3D6NA 4XBKA 2YIHA 3BICA 3N2OA 1Q2RA 1OVDA 1BEUA 4ICCX 1BYBA 3QYQA 1QUMA 3M47A 1TUFA 3DGBA 5CGTA 5T91A 1J6PA 4TX9A 3HJEA 1IXPA 1GVRA 4BR1A 3V4BA 1HP5A 2HZGA 2V3EA 4AZ6A 4PCPA 1D3GA 1EXPA 2VX6A 2PPGA 1MZHA 1EZ2A 3ITLA 4LF2A 2ZXDA 1PKYA 4P7NA 2Y88A 1VFMA 3QY6A 4P7OA 2YB4A 2NQLA 1R3TA 5BRBA 2QCNA 5C55A 4QX4A 3GU9A 1XH2A 4MFEA 4PMNA 5BXTA 3R2GA 3W1AA 3CGTA 1B2YA 1MMFA 4KRTA 3SCNA 5KINA 3AZRA 1G4SA 4WD0A 2REQB 1U30A 2C1HA 1XW8A 2D2HA 1A5UA 4UC5A 4GQ0A 4K8GA 3BAXA 3S1GA 1FCUA 1CX9A 4GACA 2I57A 5FJIA 3HG5A 4LRTA 3ZT6A 4MZYA 2DZTA 3EWCA 4XAGA 4XBJA 2A5HA 2ZUUA 5DCEA 1LLOA 1SJBA 4AWEA 1DQUA 3OJGA 4NJHA 4JDBA 1KBLA 4AF0B 4KH2A 4MB3A 2BVWA 1UPPA 5EFDA 2V2CA 4AD0A 1C3FA 2BMBA 1GQNA 1PYFA 5BW6A 4GXMA 3HOJA 2VD9A 2XWEA 1YLVA 4HP5A 3BLEA 2RAGA 1OT1A 3K13A 3IV8A 2QUMA 4O11A 4PMJA 3W71A 3II1A 1LBMA 2IKHA 2DZWA 4TV6A 2HBVA 1XI3A 6CGTA 3CAVA 2ZDSA 2WMGA 4LXFA 5FJOA 4DM1A 4RPQA 3FIGA 4HOXA 3ZJ6A 1XLDA 1EOMA 3TQVA 5F2IA 2TMDA 2WVUA 3GHTA 1UKOA 1EC7A 3MU7A 3PPCA 4GY0A 2YXGA 1TV4A 3IJLA 1ME7A 4P7LA 1QXLA 1UA7A 1M68A 4WSJA 2XYLA 3O16A 3NA8A 3U9IA 1O5RA 4AD5A 4PRTA 2OMAA 1JI1A 3O05A 4M3PA 3SCQA 2VUNA 3WNLA 4C6JA 3LU2A 2CWXA 3WK3A 3AS3A 3WD3A 1KRBC 4CQAA 2DW6A 1V08A 1WV2A 2J66A 5F2LA 3GR4A 2W62A 1XBXA 4CU6A 3TFXA 1E4MM 3IJ9A 2ZC1A 1ISXA 3FXGA 4GUFA 2VFFA 1UBSA 5LKYA 4MWAD 1E51A 4XVDA 4N9DA 3RM9A 4EVZA 4S3AA 2VNCA 4NX5A 4J40A 1YXDA 3ANYA 1Y5VA 1MWOA 5M03A 4Z0SA 3UNTA 1ZENA 4KWUA 1B3OA 2YDQA 4PA8A 4IJBA 1KD0A 1M6JA 3DHFA 4D6DA 3EX3A 4JTFA 2GDUA 2BS9A 1E1CB 3MV11 4XK2A 1R2SA 4CVWA 1S5VA 3JVAA 4UFLA 1E6XM 4PZVA 3BSHA 4FOUA 5CSUA 4FXJA 4JHOA 3AHZA 1TWDA 2VX5A 4ERIA 2OX1A 1E0WA 1W1IE 1C7TA 5D03A 2OXNA 3OZMA 3P8IA 3VKAA 1P0BA 1ME8A 3GC5A 1J01A 2Z4GA 1F07A 3FXYA 4EP8C 4ZFCA 3WLIA 1CYGA 3VM5A 2Q8ZA 3GE7A 4A3YA 1RQEA 1UQZA 5C54A 4W85A 1DYSA 3KW3A 3LHWA 5AHFA 4MFDA 1JYWA 4JS3A 2UY2A 1AVAA 3QM3A 1XLHA 5A8MA 4TOQA 4O57A 1TRIA 2BXYA 4AD1A 1PVNA 3GUGA 4MSSA 1JZ4A 4L4OA 1S38A 3OGRA 5JXQA 2HQAA 1XRVA 3ITVA 4NY2A 1HKWA 3CMJA 3FVMA 3VNYA 1MDRA 4O1BA 1CGXA 4D1IA 4RE3A 3E49A 3N1AA 4IGHA 2QDEA 2DFAA 2CLIA 2J8FA 1ITXA 4EPKA 5B80A 2PRHA 1IHIA 1Z32X 3VINA 1THFD 5KZEA 1XIBA 4JCLA 4O14A 1Z44A 5I02A 3MHGA 2X0SA 3H2AA 4W88A 5D9MA 1IGWA 2FH6A 4H2CA 2I5GA 4MKNA 4JGDA 4KRZA 5HK4A 4I3GA 1RLCL 4Y7EA 2FPVA 2DUAA 2W79A 5AB3A 1QJWA 2ZZ3A 2WSYA 3TXZA 4M80A 2EJAA 3W1MA 1F7BA 2I14A 5DT7A 3KOZA 2PDJA 2VDHA 3DDMA 3GNDA 2PD9A 3IJ6A 3QGKC 4J3WA 2EAWA 5CZSA 4O13A 3VNMA 1KM1A 2FZBA 4WOQA 2J74A 3LI1A 2QQ6A 3MSDA 4XZWA 1BVWA 3WJZA 4Q4QA 1XXXA 3T07A 1HJSA 1PZ0A 2BHZA 4Q4PA 4AD3A 3LHZA 1HNYA 3DECA 3FCPA 1XYZA 1ADDA 1JF5A 3U5YA 4IMFA 1KFKA 3ZR5A 4CN6A 5J5DA 3QBUA 3WBEA 2ZX7A 4AEEA 1W37A 2VCAA 2QLYA 1XLEA 3NEVA 1W8SA 4IPLA 4JFSA 1Q7ZA 1W9BM 4RLIA 4REQB 3BLPX 1OM0A 2WMIA 1HIZA 3VM7A 4A6GA 4HGXA 3O2LA 2QIIA 3UERA 4OTKA 1KM6A 3WQ8A 3L68A 2CWNA 3OVRA 3FK4A 3EBVA 1UR8A 5I23A 4PULA 3MB9A 5B7ZA 5H8UA 3GY1A 1BWLA 1FWWA 3SFKA 4K68A 4IQJA 4MTVA 3RHGA 3SR7A 4F0RA 4D6IA 2X7VA 3W7MA 4MLRA 2ZX6A 2PGEA 3GDRA 3NZQA 5J5RA 2QJGA 4QGCA 2W91A 1RBAA 1OBAA 1ECEA 3PBGA 3KX6A 4MWAC 4AZGA 1ZAJA 1S2AA 3RF9A 2PODA 1UR9A 1KKRA 1EF3A 2Q71A 4PSPA 1JUEA 1E3XA 1IT7A 2GJRA 1IR1A 1GG0A 3PZ9A 5DELA 2WKJA 5A8QA 1E6NA 1L6GA 1EZWA 4HZ8A 2QCLA 2TSYA 5BU6A 2Y70A 4WEVX 3L5MA 4IPIA 1LOLA 3AICA 4M7TA 4R27A 3WK2A 4FNTA 4HNNA 5TQLA 5AC8A 4LFYA 1JQXA 1SO6A 1VHCA 4O1FA 3U3HA 4C6PA 3GDLA 1GVEA 1PE1A 3FW6A 1OWQA 3QFEA 4ACZB 4YVXA 3AJ7A 3DFOA 4W8AA 2VR4A 3QQ0A 3G1YA 1X38A 5XIMA 2OKTA 4H6EA 2FIQA 3A3WA 1TE6A 3ABSA 4HKPA 1K1DA 2P53A 4DY1A 4JEJA 2VEIA 1FBAA 3RCYA 1JYVA 3G24A 3GNPA 1V4YA 1G7VA 4DIAA 1IEQA 4LVAA 1HL2A 4PEEA 3SRKA 4H9MA 4MNLA 1YBQA 4KGJA 2VD8A 4UTKA 4EF8A 3N4AA 2B7QA 3W1NA 1OIMA 3WQ4A 1ZSXA 3UPMA 1UR1A 3BOXA 2ONEA 3VMNA 4HK7A 3RCMA 2O9OA 2Y85A 4MF4A 1AG1O 3O6DA 4KBXA 3LEPA 3E0IA 4LUIA 4XKYA 4HSNA 1XQKA 3FYYA 3SCUA 2W6RA 4U4MA 3URBA 1AW5A 3AXKA 1HGYA 3DCPA 3STPA 2CLLA 3VGEA 1GQLA 3C61A 3NQGA 2C0AA 1TVNA 1XLGA 5JBEA 3LPPA 3VDHA 3L4WA 4PC8A 4C6IA 2CLEA 1PKLA 1TVLA 3E0FA 3TQKA 4HHMA 4K8HA 1JPIA 1WXZA 4E0CA 5I24A 1WE5A 3UW6A 3W23A 3W7DA 1E1EA 4FF5A 4US5A 3PNUA 1R3VA 4FXFA 4D6FA 2G3FA 3S9ZA 3PBMA 4K39A 2WZTA 4ZFMA 3POCA 3PZVA 1PTAA 3Q37A 1BKHA 3PZTA 1C8YA 4E6MA 1K9DA 2EO7A 2D20A 4K6AA 4U31A 2W5FA 3VOGA 3N12A 1VYSX 3G6MA 1XM3A 1I8JA 4I5UA 3G1VA 4HT3A 4IFKA 3PTKA 5CPSA 5HWNA 3T7VA 2YPIA 4O4WA 4UCFA 5CLTA 3UWYA 3LNPA 4LALA 2DUZA 4DXKA 3LCIA 2YJQA 2BB0A 4LBSA 1TFVA 2FFIA 3LHTA 1J5TA 5TNVA 3IAQA 2HE5A 1JXKA 3THUA 3BLKA 9CGTA 3BG5A 5EMUA 3TSDA 1VQTA 3SM0A 1Q6GA 3GVQA 1S2UA 3ATYA 1OF6A 2DW7A 2PDMA 2G4FA 1T0OA 1ICPA 3O6YX 3ZFHA 5T8GA 4Q3MA 4GZJA 2QJIA 4Y8EA 1KXQA 4YCOA 3MTWA 2WOQA 1QATA 3SQSA 1KRMA 4JCMA 1QNPA 4J28A 1XH0A 1RQHA 2PTXA 1P0KA 3K8LA 2A85A 4CD8A 3SUTA 4NAFB 2WWDA 1RK5A 4OWGA 5LNSA 1CPUA 1K70A 2F6XA 3PUOA 4LNCA 1NAL1 4UR9A 2XVPA 1AMYA 4IOTA 3WQGA 2GVEA 3RPTA 5GJPA 1D3CA 3B8VA 3V0TA 3QEZA 3N2XA 1OFDA 5D9OA 1FTXA 1W3LA 4CNSA 4KW2A 2GQ3A 3U0HA 4G2DA 4KPLA 1G4TA 3FSUA 4PCTA 2P1FA 4NUWA 5ECVA 4GY7A 3S6OA 2CXEA 3T2QA 4LAKA 4YYCA 3TW6A 3GVGA 1K8XA 4GJ1A 4HA3A 2V5LA 1Q3NA 1MUMA 1PIFA 1JPDX 3BJSA 3WH5A 1S2TA 4QDPA 1OX4B 1X6NA 3C4UA 2QCMA 3WD0A 3OOQA 3CB3A 4PFHA 2BX7A 5F4XA 1V6UA 2VM8A 4U33A 5L9FA 1TTPA 4Z42C 3PM6A 4HMNA 2ZBTA 3REQB 2R14A 2E5CA 1UUQA 4DB7A 3V0UA 4AFYA 1LYXA 1OZMA 1Z69A 4PTMA 3SY1A 1HT6A 3B03A 3M07A 2WK2A 4E2DA 2DORA 1CGVA 2WV8A 3D3FA 3KTXA 4PMDA 1Q4WA 3B9EA 4JBRA 1GHRA 2FLIA 3M7SA 4YNGA 1XSIA 3L0KA 4LUTA 4HIBA 2XH2A 4IQLA 4FO4A 3ES7A 3V75A 4AZ7A 4JKMA 2OLAA 1RZMA 1EJXC 2EPMX 3HPZA 1YNQA 5D32A 2DZXA 3A4AA 3D0CA 5BWAA 5C6MA 1HKVA 2GVJA 1NWTA 3BXWA 1KKOA 4IL2A 3A23A 5LA2A 5KZMA 1BSIA 2DH2A 5CPQA 1A0EA 4YHGA 5E70A 3GU1A 2VQUA 1HO4A 3GDTA 5A8PA 3SEPA 2OVLA 4H6KA 2ZE0A 1JPKA 3GC2A 4UFJA 1H3GA 2CHNA 3S5ZA 2ALDA 4ZXOA 1ZGDA 4EWND 4F0MA 2A7PA 1OX5A 4AWTA 2IKJA 4I9JA 4TVCA 4M81A 4F40A 3HURA 4ZVJA 4W5ZA 2CITA 1MDLA 4LQ1A 4NNCA 1EA9C 3QHMA 3FN9A 4DBEA 2BASA 2UY5A 1XL9A 1E9IA 4WLCA 3NOEA 1KFWA 2P88A 4ICNA 3Q67A 3VZZA 2BGSA 1JFXA 3SQLA 4S3EA 4NZ5A 1M7JA 1T6MA 1HL9A 2RJHA 2VVSA 1OC7A 4R85A 3RAOA 1VC4A 4E3TA 2XH0A 3OB8A 2XH4A 3KDOA 2IPGA 1KTBA 4UOZA 2TODA 2IKGA 3NQMA 3OLEA 2EGZA 4LVFA 3VOFA 3NGFA 3F2CA 4D6HA 3U2ZA 4L4PA 3UWEA 3DBNA 3BJTA 4GXPA 4LC6A 4RZ5A 4UTTC 4AHOA 3SGGA 4IJRA 1DORA 3H2CA 1RUSA 4U2ZA 4PE8A 3DC0A 3VCCA 1KRCC 5CC6A 2GYIA 4J3VA 4L6OA 4JIQA 3VIHA 2D3LA 4ORIA 4AD2A 4CGTA 1UOZA 4DUWA 2YCLB 1NM9A 3AYSA 1J5SA 1IT0A 4JX6A 3LV5A 4ZSTA 2PGFA 3WQ6A 3FLUA 3EX6A 2P76A 3N04A 4XO7A 3NSXA 5FF3A 3B04A 3MI3A 4EPDC 1TMLA 4JOMA 5KTLA 1XYFA 1J9YA 2D3NA 1XLKA 1SR9A 4GVGA 4LAZA 3AIWA 3K1GA 8A3HA 5D37A 4Q8MA 1R2TA 1VJZA 1AL8A 4ROQA 4H1ZA 5CC3A 3PFMA 3RLVA 3W9ZA 4FOKA 3N6HA 1D2KA 4UUIA 2HK0A 3D47A 5CZJA 4NP7A 3A9BA 3ID7A 3W7HA 3TA6A 1EGVA 3RMEA 4ERGA 1A5CA 4JHMA 3G6LA 3L7RA 4PYSA 3WQ5A 2A7RA 2KAUC 1P5BA 3M1ZA 4Q8VA 3WNMA 4G9PA 2IPJA 3S1XA 4EWJA 1JRBA 3EB3A 2DQWA 2FYMA 3ZLFA 4A8LA 4Z17A 1ONXA 1E40A 2DGAA 1K9FA 3H23A 2VJXA 4Q8WA 2J25A 2DJLA 4ZB0A 4MWAA 1E56A 2YA2A 3H12A 1UP2A 1AW2A 4J2PA 9XIMA 3UPBA 4IL0A 3SCRA 1ISYA 1J96A 4MYXA 4GH1A 3LRKA 1IQ8A 4GVHA 3VKBA 4H7CA 1O60A 1OGBA 3MDWA 5CG0A 4JN6A 4ZQMA 3W83A 3QSRA 3NDYA 3RFAA 5HMSA 4XX6A 2Z1WA 1F3TA 4V28A 3R6IA 2Y4SA 4D6CA 3SB0A 4AU0A 5C7VA 4RNJA 3CIWA 4QRNA 2J24A 3N9RA 1S2CA 1PB0A 4LB3A 4A8NA 4DELA 2VR2A 4RXGA 5DXXA 3KBNA 2V68A 1M53A 4RNHA 2OZ0A 5CCZA 3NOYA 1GVOA 1XSJA 1EOKA 4Q8UA 1YPXA 1ISVA 4HHHA 3ME3A 4GISA 5BYWA 3OQEA 4FHAA 3U48A 2XZ7A 5LHFA 1XBYA 1PHQA 2RHGA 1PIIA 4CCEA 2Z27A 2QCDA 5PTDA 3W2KA 2DVTA 5D8WA 2Q09A 2HV5A 3W38A 3OLDA 4NAEB 5LXXA 4WF7A 3LXBA 4KT2A 1H41A 3MVIA 3RIKA 1ECQA 1QPNA 2BNJA 1UG6A 2OZ8A 1MO0A 2E6DA 2XN0A 1KBJA 3WEZA 2GQ8A 1W9XA 4B4FA 2QZRA 1UD4A 3VC6A 1EQPA 1CXEA 5IFPA 4IIGA 1EPVA 1UWSA 3GYCA 3BW4A 3EA3A 1QVBA 4PH6A 4MJ4A 5AKQA 3FGCB 3A3HA 2BG5A 2FGZA 4AVOA 3BLLA 2WHJA 3ITGA 3N19B 3NAVA 4LBRA 2YCJA 4GX9A 1KGUA 1V5XA 1AFSA 2DZSA 1MI3A 1RK6A 3B8WA 2G5WA 2RKXA 4GIYA 4UTWC 3ABQA 3AYVA 3MP4A 3SJ3A 4RPPA 3HGOA 4HPNA 1YE6A 2PB1A 3QV7A 1EO7A 2HXUA 3SFWA 3WJXA 1MNZA 3R43A 8XIMA 2PURA 4J1OA 4JHZA 3QMTA 1NIUA 1Q6QA 4DRSA 1TCMA 2O56A 4JFTA 8CGTA 3H6OA 2POZA 3JZUA 4DI9A 2VGIA 3MDUA 1RA5A 1KM2A 4IJCA 3STGA 2WLYA 3C8FA 2E0PA 3MKVA 2L5HA 3ZMRA 2AQOA 3EOSA 1UA3A 1XUUA 3GG0A 4PMOA 2WVVA 4PMRA 2YXXA 5BOOA 1OF8A 2YBVA 1O66A 4O15A 2VC5A 2CIPA 4PUJA 4ZR8A 3F4VA 3IPWA 1UP0A 1P7TB 1W54A 3KFTA 1R87A 2DQXA 2VEFA 1O4UA 1Q66A 3D3AA 3DYMA 4HMDA 2ANUA 2OB3A 4BI7A 1OYBA 3RG6A 1ZRQA 4JFWA 2C19A 2C8NA 2GOUA 5MF5A 5LGXA 3CL6A 3H7RA 5A6MA 1V02E 1L6FA 1TYGA 1QRQA 1DV7A 4IIDA 2PF8A 3GB6A 1YTKA 1BTCA 1LM1A 4F0LA 1I4NA 4H4IA 2PGWA 1EXBA 5MKGB 1E9ZB 3P67A 4JIPA 1VBGA 3NO3A 2PDNA 3SJNA 2H8ZA 1AD1A 4WJXA 1EQCA 4FLQA 3ARQA 3GTIA 2BOFX 1UMLA 1QNVA 1N55A 4DZAA 4IM4A 1UB3A 1GK8A 3CK5A 3O8AA 2VZTA 4QM1A 1UOKA 1S5MA 4J4KA 2PF0A 3HO8A 3GG7A 4AZCA 3FA5A 3RO8A 1GVFA 4KIRA 3NURA 5I2UA 4YTSA 1VENA 3PAJA 2WVTA 4X61A 5CC7A 3AAMA 1XLAA 1VKFA 4MKVA 1AH0A 3CAWA 4XVEA 1PKNA 5E6YA 3RJYA 1XFCA 1T5AA 2GVYA 1PYMA 4CD7A 1PTGA 1HVXA 3PB0A 3KVKA 3GDMA 4NNBA 1EUAA 1AA1B 2NWRA 1RJQA 4Q8OA 5KZ6A 3QKZA 2RDWA 3U8GA 1ISZA 3C0QA 3M64A 1JPMA 4NJGA 2YLLA 2X7WA 1EWEA 5RUBA 1XLJA 2VC6A 1KFJA 4YVVA 1NQKA 2G96A 3OU8A 3M0YA 2DPEA 4G1NA 3OG2A 1B3VA 2YFNA 4N02A 3NYDA 4WDTA 1OFOA 1A50A 1OEPA 3TV8A 1F4HA 3KP1A 1PEZA 1M65A 5HNRA 5A6JA 2NX1A 3VAVA 4RL3A 1VBRA 3TYEA 1I2NA 3HG4A 4IWWA 4GX8A 1F3EA 4MDPA 2EEXA 1KA9F 2Z6IA 2E8ZA 4PMUA 2WPGA 1G69A 3MCNA 3VGBA 4K36A 3MZ2A 1HVQA 4PTXA 3KUMA 1LWIA 3FS2A 2G37A 1OYAA 5HR6A 1QPOA 1YW1A 1H49A 4G7EB 4H9TA 3FNDA 2FVLA 2VFDA 2PU1A 4WGHA 1UIPA 3WFZA 1YE4A 1Q63A 5I00A 1JL8A 1MUWA 4OQVA 4K37A 3TX9A 2OGYA 4FA3A 2CW6A 3LPOA 1SMDA 3NQ6A 3L4TA 3IGSA 3UY7A 4YYFA 2I9EA 3PZUA 4JZ5A 5G1YA 3NPVA 3OGVA 3W24A 1IEVA 3MJMA 3OIXA 1IGSA 1XRTA 5BROA 3WF2A 1KBIA 1DQXA 2ZICA 2D73A 4L9ZA 3HG3A 3QKEA 3ZM8A 2QF7A 1M3UA 2YW3A 3LSCA 3AYTA 2V6AA 3PJTA 3TTYA 3I3DA 2YR1A 2DEPA 4O0ZA 4D71A 3W7QA 3WCZA 1H60A 3EDJA 2REQA 4YS1A 3VYLA 3W6LA 3SCSA 1OGSA 2GFTA 2V5CA 2VFIA 3QH2A 3B9DA 4V15A 2CBJA 5HPCA 3P6LA 5IDZA 1WZKA 4UTTA 3M6YA 4QE1A 3VZYA 2VGBA 5I78A 3UWUA 3C2OA 1MYRA 2C91A 3EOEA 3IARA 3MY9A 1F4AA 4JIIX 4KETA 3PP7A 2B7PA 4U28A 1LROA 4JTAA 3KZSA 3E5BA 3BG3A 2QUTA 3NCOA 5CEWA 2Z1SA 4JQ4A 3S2LA 1GW9A 1UPMB 3HQ1A 4M5PA 4MB4A 5CC5A 3CWHA 4JTKA 2ALRA 4F0HA 3NPXA 2AKZA 3QR3A 4OVXA 4I9TA 1T8QA 2DVXA 1K6WA 3AZSA 3CQJA 1W6TA 1TE1A 3L2MA 4ENLA 3B40A 2FHFA 4DWSD 4JIEA 3VD4A 1BQGA 3VFLA 2ZTJA 1NF7A 1TTJA 1F73A 1UD2A 3R8GA 2ICSA 2G3JA 3LG3A 3AC0A 1KQYA 1LT8A 3UPWA 4MOZA 2VUYA 4O1DA 2ZXBA 4UNKA 3GXFA 1UWIA 2EG7A 1XRFA 2IW0A 4Q4OA 4C6QA 1TB3A 5I3KA 1C93A 4UTLA 3GKAA 1JQVA 1SUXA 3R10A 4HPHA 1V3HA 1F3XA 4CCZA 1IZCA 4C6KA 2NQ5A 1OK4A 1XPGA 4AXNA 1EHNA 4YCPA 3K1DA 2OEKA 2FPYA 3EB4A 1K3UA 2POTA 3L0NA 4QR6A 5D05A 4ZODA 4MHBA 3URQA 1E15A 3MSRA 1C9WA 4MM1A 3WKZA 4ECLA 4ZQOA 1HW6A 1FFQA 4BCEA 3NXLA 1KR0A 4EAMA 4QJ3B 4HU0A 4R9XA 4AX6A 1AQMA 4HTBA 1UD8A 3DHUA 3ZJ7A 4D6JA 2V8ZA 3MUCA 4OIFA 3W76A 4C6CA 3CUZA 3WIJA 5LYRA 1P6CA 2R1NA 2FJKA 3NSNA 4JNYA 4IIEA 1Z42A 1RP8A 2JIEA 5I3IA 3ARWA 4MIMA 4DBWA 3BZJA 2R8WA 1HO1A 2G41A 3GDKA 3URAA 4O53A 4MB1A 4OFCA 4JTCA 3XISA 3BZGA 1NTHA 2J77A 2ZDRA 4TTGA 4O8RA 3B9NA 1DJGA 3QN3A 3GH4A 2FTWA 2NX9A 1DTUA 1H4PA 3CQHA 4LEQA 1BWVA 3Q58A 2GVLA 1YXYA 3UQNA 1A5BA 3I7QA 4QG9A 1M5WA 1JULA 3UGRA 2J8GA 5DRIA 2NQHA 1KM4A 3GQYA 5T9BG 1H7XA 5C2CA 3GNNA 1TQJA 2G3MA 3U2EA 3L67A 4KGLA 1QO2A 1QK2A 1FH9A 2F6KA 2C6QA 2O7QA 1HKKA 4LGXA 4UTFA 2QCEA 4GJIA 5FESA 4G6CA 5FIPA 2FZ8A 4E8GA 1Q85A 4K3ZA 1W1PA 3JR2A 1V6WA 2JF7A 3QY8A 2XIBA 2V63A 1SO4A 1FVPA 3WH6A 2GK1B 2GLKA 3M44A 3TONA 1A4MA 3LQGA 4PL2A 1AQ0A 1G6CA 1XIDA 3KP0A 2PP0A 4JTQA 2ISSA 4ZE4A 4W7UA 5A94A 1IE7C 3CC1A 1UD5A 4H01A 3SCPA 2PDBA 1EJWC 1HG3A 4Z1BA 1NFBA 3TR2A 1NSJA 4R33A 4A8IA 3H2NA 1J0HA 3BO9A 2B31A 2BZNA 3DN5A 4B5XA 1KFCA 3GFXA 3N17A 5C0QA 3AQUA 2UZ9A 1ONRA 1X1OA 4XZIA 3PWAA 2H9AB 5DXYA 3AXHA 4WQ6A 4ZENA 3W81A 4CVUA 2PLJA 3NZRA 1TPH1 5JIWA 4QG8A 3M7WA 4PGLA 3QC0A 1XDJA 2ZUVA 4ORMA 2VGGA 4DWSC 2NVCA 3B9OA 1WUEA 3KL5A 2QYGA 3N9KA 1XHGA 3LMYA 2GGJA 1QI3A 2X8RA 2QMJA 2ON3A 1H1ZA 2W63A 3G2GA 4UMBA 1FRBA 2HWGA 5KZDA 1V6XA 4CNOA 4ZL1A 3A4WA 4F2TA 3L23A 1PBGA 4LUYA 3TW9A 4FMVA 2GJXB 1JUBA 1KGWA 1VFSA 3LGDA 2O4MA 1ZALA 3N3TA 3AXXA 1S39A 3G1XA 3R7MA 1QOXA 3QF0A 2JGYA 4P8VA 4REQA 1W3NA 2EG6A 3N6QA 5H91A 5LA0A 1YMYA 5BXRA 2E7FA 3GVRA 3N13A 2Q02A 4ADTA 4AH7A 2A3HA 1SFTA 4K8EA 4LV4A 1BQCA 3IUDA 1PTDA 3R25A 1CLKA 2PFHA 3WL0A 3LBCA 3W7NA 4DNHA 1VPYA 4W8LA 2W4XA 1YPIA 4GYKA 3PB2A 3TR9A 3CPRA 5BWFA 4UTMA 5E5CA 3L4YA 3F03K 2CZEA 4LVDA 1NARA 3NZ1A 1SU5A 4QCEA 1RY0A 1E0TA 4YTUA 4TVUA 4GA8A 4D72A 1E6ZA 5FEXA 4C6MA 4NZ1A 3PZMA 3VDGA 2BY2A 3TJ4A 1QI0A 1QFEA 1GPWA 1NQ6A 2QULA 4G8TA 1ALDA 5EMJA 3M0LA 3EA1A 1WKYA 3M0JA 5BRQA 1MW3A 1UWAA 1DJYA 3DI0A 3CZGA 4JNMA 1ESWA 1ITUA 3UG4A 3P81A 4ACZA 2C1GA 3QW3A 3CUHA 2SFPA 3JUGA 2FHBA 3VABA 2D0HA 3T2OA 2R82A 1AJZA 2VC7A 3ZJ8A 3TC7A 2O55A 3AOFA 5CH9A 1PL9A 2WM1A 3H4GA 3ORWA 3T4WA 1A5NC 3GX9A 3ZSSA 4GD0A 2HE8A 1B5TA 4JTIA 1P0NA 3OQ8A 3PJXA 1LBFA 5B7YA 4IP7A 3VGHA 3BJFA 2D2OA 2ASHA 3BG9A 3TEVA 1OADA 3GK0A 3RU6A 1G1YA 2YXOA 3GBDA 3M0ZA 2YL5A 1X1ZA 1MXDA 3CWOX 1J0ZA 1QCWA 4M29A 3WUEA 1F5ZA 7ODCA 1KWKA 4GJJA 4YWIA 2QV4A 2QCHA 2Z1VA 3IGXA 1CXHA 3VK5A 3NL5A 2PWHA 3EKLA 4AIOA 2F84A 1OIFA 1XKJA 4RV8A 1BFNA 3QRHA 4HYWA 4X2PA 1OX6A 2WSRA 5HWMA 3ERPA 3FJLA 3EOOA 4DF1A 5I03A 4KCWA 3EXSA 3GKFA 5CZ0A 1FY6A 4H8HA 1GKQA 3WYZA 4CN1A 4JQ2A 1MEIA 3MO4A 3EWDA 4KCVA 5HUOA 1E6QM 1K4GA 1OCNA 1XIGA 1B30A 1JDAA 4ADUA 1M1BA 3VKJA 4GZIA 2O92A 4AVNA 2Z25A 3EDDA 4S23A 3ELFA 2C1IA 3UNDA 1P0DA 4GABA 4NILA 2VO5A 2PLMA 3UYCA 2XZ9A 3DG7A 1TQXA 4Q8NA 1B90A 2XFFA 1MW1A 3E1F1 3W29A 4NX0A 3WJSA 3PBVA 2FVKA 2ZA3A 1VP5A 1V3LA 3VVGA 1PDYA 3KDNA 3VOIA 2J88A 4HJFA 4ZO7A 1W1YA 2DZPA 3NZPA 3G0UA 2AGTA 1KV8A 1DXEA 4GIRA 4LOCA 1DIKA 2NX3A 3O0KA 2R9RA 1Z9AA 4HBKA 5CJNA 1VCGA 4LWWA 3Q45A 4HNVA 4JEQA 1F61A 5JQ9A 5EMKA 3DU0A 1HKIA 3UR5A 2AMGA 5HDRA 4GNJA 5LXEA 1V6YA 4I90A 5FSEC 1G67A 1EJ7L 2ZQ0A 4NAFA 5E9AA 2VTFA 2WMHA 5ABEA 4MLJA 3G8RA 4B2DD 1F74A 1KFLA 4IMGA 4X9YA 4YTRA 3TWAA 3PHAA 4LVGA 2ACQA 3NNTA 3L4XA 2JGQA 4HNTA 2V67A 3W86A 2XVKA 1S3TC 4JY9A 4YTQA 4KWSA 3CYJA 4E38A 3S2CA 1DWFM 1JCLA 3S8HA 2QNEA 1J11A 3MO7A 3EWWA 4V2XA 1MQRA 4LVBA 1EGZA 4HOWA 2GQAA 2C15A 3UR8A 3COTA 3GH7A 4L80A 1TIWA 1LWJA 2NXIA 1KFBA 4EPEC 3M0IA 1ISWA 2NT1A 3I65A 1FH7A 1FWRA 1YNYA 3TCSA 3W3OA 1DJQA 4LUSB 4JQ1A 5DLCA 2QJMA 1B3XA 4XWUA 3S9IA 3U4AA 2WO5A 6ENLA 4TU1A 1FKXA 3WNKA 2IXVA 4Q4RA 2OELA 3OHMB 3REQA 4UIOA 2EQDA 5J04A 2IS7A 4FZIA 1BXNA 1GUVA 3GZ3A 4IPPA 2ZFAA 2Y5EA 3L5AA 5FEPA 3PUDA 3BL3A 4GBUA 1OFEA 3NG3A 1SW0A 4XB3A 1B57A 3B8UA 4ACYA 1NDYA 1TCDA 4ILSA 5U7SA 3L66A 1UASA 2DSVA 2FFCA 3EOLA 1KCZA 5GPRA 4HB7A 3GXDA 3QVQA 1VH7A 2WCSA 4LX4A 3MBFA 2WZMA 1ME9A 1OQFA 1QT1A 4M82A 5FEZA 4NJIA 1JEZA 4MWAE 3OO2A 3HGJA 2CZVA 4GKLA 1W5OA 5EMYA 3T4CA 1A5KC 4PRWA 4EAYA 3ZIZA 5F2GA 2WPBA 3VE7A 3CHFA 4FK9A 2VWTA 2PDUA 2J7CA 3AU2A 3QOKA 3A5VA 5DX7A 1E1FA 2X09A 1P1XA 1EEXA 5E0CA 1XS2A 3W72A 3TTOA 1CGTA 2Z7GA 4GNKB 1GVQA 4GIEA 3DX5A 1F8IA 2YCKX 2EPHA 1XJBA 2XFYA 1BAGA 1RV8A 1TSIA 2P0IA 5FJRA 3S3GA 4V27A 5FKYA 4JIRA 2Z2AA 5DO8A 4AC7C 1FWEC 4W87A 3F4CA 2NV1A 3AALA 4V1YA 3TTEA 1B9BA 2WJEA 2WMFA 2X1UA 3I6RA 1PZ1A 3AXIA 5A8GA 3LCHA 4GRSA 4LBUA 1GOQA 5EMMA 3H70A 1US2A 3NQFA 4Y90A 1M7XA 2R1LA 5ECUA 2QEZA 3LCLA 3UZXA 2WHLA 1K7EA 3WBXA 5MHBA 2E68A 1KGXA 3CZEA 2QMKA 4WKFA 2YCEA 1I1XA 5I3HA 4BZYA 3S5YA 2ZCGA 4HK6A 3FOKA 3P0WA 3TN3A 3SSJA 1QNSA 3UCDA 3WH9A 2X42A 1UR4A 3QLDA 4WDWA 1EBGA 4RV3A 1KCKA 3A24A 1T8XA 3TVAA 1HP4A 1E43A 4WZHA 4WXYA 1GG1A 3PVFA 3QMSA 1W2PA 2PDIA 3IRDA 1U5HA 5D2XA 3TN5A 2WMKA 1XDLA 4QAIA 7REQB 1XC4A 1X7IA 2QVNA 3LX9A 3BURA 4I9AA 1AD4A 1GYLA 2DZBA 4QS6A 3WDPP 4HCLA 4E2VA 1UD3A 3QGVA 1A3WA 1E73M 5IXEA 5IHRA 4JTTA 2Z2UA 2YCLA 3R11A 1CIUA 3GDBA 2X0HA 1JIBA 4L65A 4NI3A 4AZ5A 3GHUA 1Q6EA 2GJLA 2MUCA 5BRPA 3OBKA 4IP4A 3TXVA 3MCMA 2H90A 2F8QA 1K03A 2EKCA 4DWSA 1RQBA 4Z2HA 3TYUA 1QHPA 3WEMA 1LL6A 3NR0A 1KXTA 4HPXA 1VYRA 4I5XA 3RGTA 3U57A 5HJLA 2E5DA 3H2OA 5LGZA 3ONCA 5A8NA 4MJ2A 4UZSA 4ERAA 4EF9A 4GI8A 3UG8A 4XZNX 4S3FA 5D2VA 3EEGA 2OCZA 2ZUSA 2XIJA 1R6WA 2I17A 3WQFA 4DEFA 1LCOA 1KLYA 3QOMA 4XZ9A 4AG0A 5HANA 5HMDA 5BMWA 1J0JA 4QEEA 2XSBA 3EDEA 4UOJA 1YIXA 1DEDA 1VYPX 2ISWA 3GUWA 3VNKA 4KIEA 4LY4A 3VNIA 2WNQA 1FP9A 3CPUA 1GCYA 1RVKA 3CWNA 3LZ3A 3W82A 3TYBA 4ATDA 4A8RA 1OCQA 1E5NA 1DBTA 1S46A 1AJ0A 1JDCA 2WJZA 5U4NA 2XJ7A 3A12A 2ZUMA 3HQNA 3IWPA 4GKTA 2G50A 3SRFA 2GSHA 4L64A 3VD3A 5JIPA 4EE9A 4DNMA 1VFFA 3IK4A 3MI6A 1JR1A 2BY1A 3GU2A 3A13A 2FHCA 1JZ8A 4GO8A 2G8ZA 1CWYA 5A1AA 3WSUA 1BXCA 4JTLA 2XIOA 4JQAA 2LLEA 4F0KA 3I6TA 4EXAA 3QR0A 5CPLA 4OKDA 5CG7A 1CLVA 2GDVA 4TMBA 1QU4A 1UZ1A 4KERA 4PUNA 1Y5XA 2OPJA 5G4HC 1FDJA 1FDYA 2ATSA 1EEPA 5F1UA 3WELA 3CO4A 1KV5A 2NWSA 3LYEA 3CIXA 1V79A 3TZNA 1IWBA 3OGSA 3R0DA 2WNZA 5E1QA 1FX6A 4N6FA 4RJEA 4JTSA 2FGLA 3RRXA 3FAXA 2XN2A 5K4ZA 1J93A 4IH3A 1W2VA 1S5TA 5KEZA 2VZSA 1RA0A 3MMTA 1LUCA 3GG1A 3VNDA 3PWGA 3DFYA 3CT7A 1A3XA 5A8OA 3QV9A 4P61A 1EX1A 2F7FA 2FQIA 3W2JA 2CYGA 1O68A 1FWFC 3W1PA 5ABGA 8TIMA 3PPGA 2J6XA 5CSYA 2H6RA 2JFEX 4IMAA 2KZHA 3KVMA 1FCQA 2XUCA 5DANA 3KOFA 2PDWA 3N4FA 1AZ2A 9XIAA 3CV7A 3T0BA 2TYSA 3AXMA 1GORA 3T0AA 4NAEA 1M03A 3CHCA 4KKXA 5D38A 3KCJA 1MQPA 4JL2A 3AFBA 4J35A 1WOBA 1JCNA 1VF8A 2MANA 3QPEA 3PZGA 2J75A 1KXHA 5A6AA 4TIMA 1W1VA 5HQLA 3AUOA 2ZUNA 1FWAC 3P7YA 3MUAA 2YSWA 1QAPA 3C0LA 1OFRA 3T42A 2BDQA 1KM3A 3UA4A 4QDWA 4O1AA 3H53A 1FWJC 4XUGA 3BGGA 4C6BA 2VFEA 2XHYA 3P2VA 4AXKA 2Y7EA 3FGCA 3UG3A 1DP0A 3NQVA 3LCXA 3P60A 1V77A 1HF6A 3VMPA 4ZQCA 1I2OA 1R9XA 2RDTA 4QIUA 3VIJA 4FR1A 1FWCC 3WDIA 2E09A 3GHRA 4WVXA 1ZBKA 1BSLA 4ATWA 3GFZA 4WJEA 4UTIA 4JPGA 5CPNA 3W7JA 1X39A 3LTYA 4C91A 2W92A 2OSWA 1PJ9A 4HA1A 1W5NA 4K2SA 5L6UA 2BHUA 2VDIA 1Q65A 4QNEA 1SGJA 2O9PA 1XCWA 4OJYA 6A3HA 4LAOA 2G97A 4HU3A 4N42A 5AC7A 2OODA 3S2JA 3CHDA 2PP3A 4JX5A 4YXGA 1SMAA 4C6DA 2IQDA 5BOEA 2E25A 2PTWA 1ZJIA 4KQNA 1OINA 1GOOA 4KWOA 2VRQA 3NQCA 5C2XA 2QKFA 1P7TA 3UVAA 1ELSA 3IACA 1T41A 2BOEX 4E4UA 3L2LA 5FA5A 1EC8A 3GNXA 5HMFA 2J62A 4DBSA 4X60A 3LRMA 3CBWA 3TSMA 3EA2A 4CQDA 1GONA 1ZBWA 2OOFA 1QHOA 3LBOA 1H1NA 1DIDA 2PE4A 5K9XA 4DVOA 3QQ1A 1I75A 1VLWA 3WQPA 2PDLA 2E40A 5FJTA 4DZ5A 4GQQA 1H1YA 2AOSA 2JE8A 4FR6A 3VUPA 3O1NA 5MKGA 3S5SA 3EYPA 5JVLA 3LCFA 1PPIA 1H2JA 2Y62A 3UR7A 2XGBA 5HXMA 1OC6A 4HU8A 2YA0A 4BF7A 1OJXA 1OABA 2OKOA 1LBLA 4HOZA 5FF2A 1TA3B 2Z6JA 1R0MA 1LT7A 3UGVA 3AYRA 2PU0A 3CUXA 4KFNA 3W7IA 2DY3A 1DL3A 5EPDA 4W89A 3NL3A 4D2JA 1V6VA 2QV5A 3P3BA 3S5OA 5A6KA 2WBKA 2NVDA 3AIQA 3BAIA 4GZ7A 3E12A 2XGIA 4W4QA 4EACA 4PBEA 2AAAA 1YBQB 4RZBA 3OYZA 2B7NA 2XFRA 1O1ZA 3L2IA 3NWRA 3VIPA 3CU2A 5AYXA 1GTEA 4E3VA 5CAHA 1BGAA 4M1BA 4BHYA 2YBTA 2O7SA 1LZOA 4N0RA 3WF3A 4PUWA 1FHLA 2W66A 1S2VA 1H0GA 5I7GA 1R7OA 3KBSA 4NVTA 4LB4A 1Q4NX 3FDGA 1Q8JA 2AL2B 4XKYB 5I3GA 3BAKA 2PGRA 1M01A 1I0BA 3RJXA 1NOWA 1XQLA 5K3VA 5DF0A 4DBDA 3DBPA 3VOJA 2ZZ5A 1K77A 1ZCCA 4PUEA 3PG8A 4YU1A 1ZB5A 3H2FA 3KBJA 2WZIA 3B8DA 4MJZA 3TC3A 3O06A 4MNMA 1L8NA 4QJ5B 1FWGC 4L6HA 4H7VA 3N18A 2Z1XA 1SQ7A 4IIHA 3HF3A 2HPMA 3EGJA 3S1UA 1QK0A 2WSQA 3TYAA 2Y6ZA 2X41A 1HJUA 2BVTA 1CGYA 1ADSA 3LY0A 1D7KA 2VWSA 3HA1A 3ALGA 4EXQA 1K7FA 3CS2A 4G7EA 2FDSA 4ZQNA 1VFHA 4DF0A 2NV9A 2W27A 1NOUA 4GYJA 2Z1KA 4JTGA 3W2NA 4TTUA 2AGKA 4QS5A 2OT1A 1TVPA 2XSXA 2Y8VA 3IIXA 3NEHA 4ZBCA 4IFKB 3HG2A 4H04A 4HNUA 2V2HA 1E70M 4DQWA 3HM7A 3THAA 1QOPA 4YPJA 3CASA 4R3UA 5H6HA 2GJPA 1JI2A 1G5AA 5GQBA 4NL1A 4I8DA 5ABFB 2PLKA 1DOSA 3DZ1A 4A3RA 4NXSA 3VX1A 1S1PA 1V51A 3L4UA 4YL2A 5HQEA 4F4RA 2YDSA 1IXQA 3R13A 1W31A 4XD5A 1XWYA 1NDZA 3W0KA 4B90A 3IJDA 4LCRA 3XINA 4XQ6A 2WBGA 4ONVA 4JXCA 3ITOA 4H8VA 1EYEA 1WAUA 2IMRA 4LAUA 3G77A 1SM9A 2OYLA 4HTYA 1KBKA 2BHYA 1WKDA 4LW7A 1F9CA 1UKPA 1UQYA 1OSEA 4BI6A 3IGUA 4OZOA 3A4JA 3T8LA 1ZBCA 4R7JA 3HGSA 4B2DA 2PWDA 4FIRA 3ZVHB 4C1LA 1J0YA 3ONBA 2NSXA 1REQB 1TTQA 3JU2A 3ZS4A 1WB0A 4C5YA 4M56A 2PWEA 1N8IA 1FWNA 3SN4A 3F4WA 1EL3A 1MRAA 3ZVIA 1JUKA 5CZTA 4JTEA 1ODUA 3MUIA 1NWSA 1OFPA 4UQAA 5C9UA 5KMYA 4X2RA 3IIPA 4QTGA 4Y9OA 3HPXA 3AMLA 3AIBA 3OG3A 1TPUA 3U6WA 4FP1A 1XIIA 6ALDA 2WANA 4L4LA 3ISIX 1NEYA 3EWZA 2P10A 3PAOA 4OT7A 5CPMA 3ICJA 4OE7A 2O0TA 2WHMA 4ZSUA 5C9ZA 3LENA 1MXSA 5I3JA 4H41A 4E4FA 2V3DA 1JCJA 3IIVA 4LJ3A 3E2VA 3W37A 3T78A 4DM2A 3ZWTA 1U2YA 5AYZA 1J2BA 2WB5A 3LLDA 2NQ9A 2WJDA 4KRUA 5D02A 1W3HA 4KF1A 3N2MA 1XLLA 3WO8A 4ZOEA 3HTWA 4ZCWA 4FS9A 4MVAA 4CCDA 4GHRA 1Q45A 2UY4A 3A22A 4IZGA 3GM8A 4DF2A 1SJDA 1QTWA 3N3MA 1C8XA 1IZJA 4PTWA 4GI6A 2Y61A 4O1CA 4MG4A 1N7KA 2ACSA 3KBVA 2EBNA 1GZGA 2NSOA 1EGMA 4JICA 1HGWA 2PRMA 2A6LA 1EJVC 3GFYA 4CLMA 1R2RA 2B4GA 3CPGA 3NM1A 2DV0A 2Z26A 1DVJA 4TQTA 3VCNA 3BVJA 1SYTA 5G5IA 2ZRWA 3UZZA 4R7OA 2NQJA 4KEMA 1TIMA 1ZHAA 4GUGA 4KFPA 4AQLA 1VIWA 2V30A 3W1UA 1VEOA 5F4WA 1XF0A 1UW9A 4X9SA 3GVWA 4L1XA 3THCA 2V3GA 3B9AA 3NQBA 3BV4A 3HV9A 6XIMA 4JAWA 1JCTA 1R3WA 4NYYA 2RGLA 4ZOAA 3UR2A 4QXIA 3RXZA 4J3SA 2Q3RA 3DG3A 4H00A 5LNVA 4D8LA 2E9MA 4MY1A 2PI6A 1JZ7A 3DC8A 4R9OA 4JL1A 3UCCA 4AX7A 1SZNA 3LLXA 5GNYA 3LTPA 1ZBVA 4QNWA 3BDKA 3VTRA 1TREA 4YHEA 2PDCA 3RILA 3RPMA 4PBFA 2FPTA 2C18A 4OBTA 4W93A 1JAKA 2BXVA 1R46A 2VEMA 4S38A 3E38A 3KOYA 1LL4A 1GZ1A 1WDWA 5IBXC 4E5TA 3TYDA 2GK1A 4PL1A 4WGXA 1LLZA 2OX4A 1PCKA 3U7VA 2W9MA 3WENA 4AB4A 4UCGA 4DYKA 2MNRA 3UJEA 1MW2A 1XLMA 2ZC8A 4JDYA 2H3BA 4NIRA 2AMXA 3MMWA 1WBHA 2A6NA 4M8UA 3VIIA 1PUDA 1VRDA 3ENLA 1O12A 4PTVA 4W84A 5FJPA 3K4DA 4LS0A 4UBPC 1AUSL 1B4KA 1GJPA 5A2AA 5C71A 4Q4SA 4TVDA 4NNAA 3N2CA 2I7GA 1E0XA 1CXLA 2XU2A 3B8SA 1BRLB 1TZZA 4ALDA 4O1EA 3SO7A 1CCWB 1R3SA 4WOZA 1XDMA 4WY0B 3G18A 2H9AA 3QQWA 1JGMA 4AD4A 1PAMA 1RAKA 2P0OA 4C6EA 1NFPA 1NVMA 5G4EA 1X96A 2J13A 3UJ2A 4O54A 2VURA 1XFBA 3QW4B 5CLWA 4JYDA 4PCNA 1TWSA 1SVDA 1XSKA 3EKZA 3NO5A 4NSBA 1JXJA 1UMYA 3S4TA 3GRIA 5AOUA 3EKGA 3KWXA 3ALFA 4U5KA 1ICQA 1HJQA 2AQWA 4JTJA 4MAVA 1VIZA 3HFYA 1MW0A 2UWFA 1XBZA 2C7FA 2J47A 3PUEA 1P0EA 2JBMA 2QS8A 3DAQA 4IGMA 3STCA 2E5BA 3A4XA 3AMDA 3F5KA 1QOQA 2GJXA 2J7DA 7TIMA 4MPKA 4WIWA 1V93A 1JD7A 4NI8A 4FXSA 3CTTA 4LF1A 2WC4A 4FI4A 1R3RA 4QSFA 3W25A 2J9ZA 1A3HA 4IISA 4C6LA 5IHSA 5D4YA 4K7YA 1PV8A 3CUGA 3FY1A 3S1WA 1ZTVA 1G4PA 2C71A 2VC9A 4L1WA 4M6PA 1T99A 1R9ZA 3KZPA 4NHVA 4LT9A 4G1KA 3FHAA 1VFOA 4BI5A 1FH8A 3WDJA 1PZ2A 4FOJA 4XD4A 2QXWA 6REQB 2IKIA 3HU7A 3HBLA 5D8ZA 3L4VA 1KO0A 5HBFA 1L6YA 2R94A 3BWWA 3NVTA 1H5VA 2OWWA 3SCWA 4ADSA 3TP4A 2FZ9A 1PHWA 3DKJA 3QFWA 3CJPA 4AEOA 3MMUA 1YEYA 4Z1CA 1PO9A 1HN1A 1Z6KA 1R38A 2ZRUA 2C16A 5FD0A 1JF6A 4HA4A 2PZNA 4IICA 2R24A 2CZFA 1PX4A 3KBWA 4AZBA 8RUCA 2GL5A 1SW3A 2CLOA 3K8KA 3VGFA 4WDUA 1AODA 4H9UA 4UQ9A 2ZRVA 4YWSA 1WP6A 2ZVRA 1C29A 3IV3A 2ISDA 5HAOA 4DUVA 3BLOA 3F2DA 2QAPA 1XIJA 3VA8A 4IFRA 2P50A 3CQ0A 4PUKA 3APTA 1GVIA 3EAUA 1H51A 3ABOA 3UU0A 4ZB2A 4DJFD 3WQOA 5LSMA 2BP1A 3FYPA 4DO6A 3N15A 3R1ZA 1A5SA 5BMXA 1AZ1A 2XGZA 4Q7NA 3BLIA 5CQ1A 1I9CB 5D33A 1K9EA 1CBGA 1E3ZA 1SJAA 3FV9A 1GQKA 3LGEA 1JZ6A 5DMYA 4BA0A 4UTJA 4OECA 4QJ1A 1PWLA 1OFQA 1ZY9A 3W01A 4DJDD 1TZ9A 1MQQA 4Z2GA 3W7GA 4GI9A 4M6QA 9RUBA 3HMJG 1LLWA 3B8TA 4J3ZA 3MJYA 2YW4A 1W9DM 2E67A 3T8QA 4MNKA 5GNZA 3BQ5A 3R0KA 1YYAA 3GTHA 3QC3A 5HATA 3F5LA 1BGGA 5E09A 1P1MA 5A3HA 3PTDA 3TOPA 1YXCA 4Y8FA 2R1MA 3CHVA 2X16A 3IEBA 3KS6A 3W7LA 2P5NA 5AY7A 1B4EA 1R3QA 2ZZ2A 1U1UA 3GIQA 1I45A 1GOKA 1S5NA 4US5D 1V3KA 3LPFA 3N4EA 2ZZ1A 1ONWA 1FQ0A 4MADA 2J7BA 3S0CA 3N9SA 4K1GA 5BOFA 3VIOA 2XPKA 3E6EA 3PUGA 2Y5JA 4IGNA 1QPKA 2VOMA 4AUBA 3LTSA 3BCJA 5GJNA 2AL1A 1H11A 2JKEA 1J10A 3PY2A 3R8HA 3R12A 4IG2B 3LI0A 4E8DA 2WHKA 5G4WA 1TMHA 2EHHA 3HFTA 3USZA 4YLWA 2BGNE 4LYPA 3UG5A 1NF0A 1DWHM 2VEPA 5TIMA 4ZZ9A 1LRQA 2IQ0A 2I5QA 1JNEA 5AHLA 1KFEA 4GZEA 1FDZA 4H7ZA 1NP0A 1H62A 2VKZG 4F9JA 2J27A 3AMKA 1CT5A 4Z2KA 3G8EA 1YHTA 2D0GA 1NDWA 4PMQA 5AC5A 3BQ6A 2J6VA 3O07A 2J4GA 3G3DA 1WAWA 3WL1A 4S39A 4D8AA 5HJYA 4XBSA 1DXIA 4Z0JA 4AZIA 1JAEA 4V33A 4I7UA 4UFIA 1KM5A 4NZ3A 3L65A 4PMXA 5CBBA 2ZVIA 3IJ7A 2CBUA 1T96A 3TMQA 3HPAA 1YTDA 3W84A 1H50A 2OEJA 4ZXLA 2OZ3A 2DT3A 1WXYA 2BVYA 3VNLA 4R7WA 1LWHA 5LIXX