4ZNGA

X-ray crystallography of recombinant lactococcus lactis prolidase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
362
structure length
362
Chain Sequence
MSKIERISAFLNDKEVDMTFITNPTTLNYLTGLAIDPHERIAGLMIFRDSTPMLFTPALEVEKAKEHTSGLDIFGYEDSQNPWEVVKNHVKSDVKSIAVEFSDIPLAKTEGLKAQFGDINFVNLTPLIERMRLIKSADEIEKMKVAGDFADKCFEIGFATAAERNGVTESDIVAKIEYEMKRMGVPQMSFDTLVLSGARAANPHGAPENVEIQENKLLLFDLGVMSGGYASDATRTIAIGQPNDFDAEIHKIVKEAQQAAMDFIKPGVTAHEVDAVARDLITKAGYGEYFNHRLGHGIGMDVHEYPSIVAGNDLVIQEGMCFSNEPGIYIPGKVGVRIEDCLYVTENGCESFTHTDHDLLIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallography of recombinant Lactococcus lactis prolidase
rcsb
source organism Lactococcus lactis
molecule tags Hydrolase
molecule keywords Prolidase
total genus 117
structure length 362
sequence length 362
chains with identical sequence B, C
ec nomenclature ec 3.4.13.9: Xaa-Pro dipeptidase.
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4zngA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4zngA02
4ZWPA 1B6AA 1KQ9A 1YW7A 4S2RP 3D27A 3S6BA 4ZWUA 3MR1A 2EA4A 3IU7A 3BIQA 2BN7A 3RVAA 4RZZA 5CDEA 1W7VA 2V3YA 1MATA 2BHCA 2P9AA 1XGSA 1YW8A 1N51A 5CIKA 2BB7A 4IKTA 2EVCA 1JAWA 2GTXA 2GA2A 1QXWA 2BWWA 1YVMA 3PKDA 2MATA 3MATA 4U6EA 1WBQA 3CB5A 4FLKA 3OOOA 5CDVA 4KM3A 3FM3A 4U76A 4U6ZA 1C23A 4IDYA 2GG0A 2Q96A 2Q8KA 2OKNA 2V6CA 5FCHA 2Q95A 2GU7A 4PNCA 1CHMA 3CTZA 4U75A 5E2CA 2GU5A 1O0XA 2P99A 5CDLA 4QR8A 1WY2A 2BWVA 1R58A 1WKMA 4ZNGA 1B59A 4A6VA 5CLSA 1W2MA 2BWUA 5CE6A 3PKEA 2P98A 4IKRA 2BWSA 2BWTA 4U69A 2GU4A 1R5HA 4EGEA 2ZSGA 5CNXA 1A16A 1M35A 4IKUA 2ADUA 4FO7A 4OOKA 4U70A 3IG4A 5JHUA 1XNZA 3TB5A 1QZYA 2V3ZA 2DFIA 2BHDA 2BHBA 4IPAA 4Z7MA 1YW9A 1C24A 4FO8A 1BN5A 3BITA 5E5BA 2Q93A 4IECA 3PN9A 3PKAA 3I7MA 2G6PA 2GGBA 3CB6A 4RGZ1 2GG5A 2BH3A 2BWXA 3RORA 5JI6A 2V3XA 2GG8A 1C22A 2EVOA 4U6JA 4A6WA 2GG3A 4U73A 2IW2A 1C21A 3TAVA 1XGMA 5FCFA 2B3KA 3PKCA 3PEBA 2Q92A 1WN1A 2GG7A 2GG9A 4R60A 2GZ5A 4JUQA 3IL0A 1XGOA 4HXXA 1KQ0A 1R5GA 4RZYA 5JFRA 1QXZA 4IKSA 1WLRA 4ZWOA 3Q6DA 1BOAA 4U1BA 3FMQA 1PV9A 4U71A 3L24A 3MX6A 2OAZA 4B28A 2NQ7A 3FMRA 3L7GA 3IU8A 2BHAA 5D6FA 4FLJA 2GG2A 5D6EA 2GU6A 4S01A 3IU9A 3O5VA 4IF7A 2BWYA 1QXYA 4FLLA 1WL6A 4PV4A 3OVKA 2Q94A 1XGNA 4IU6A 1KP0A 2B3LA 2B3HA 2GGCA 4U6CA 2EVMA 2EA2A 1Y1NA 4FUKA 3QOCA 4U6WA 2HOWA 1WL9A 3BIPA 2NQ6A 1C27A 4S2TP 3PKBA 4S00A 4FKCA 1YJ3A 4FLIA 4MATA
chains in the Genus database with same CATH superfamily
4ZWPA 1B6AA 1KQ9A 1YW7A 4S2RP 3D27A 3S6BA 4ZWUA 3MR1A 2EA4A 3IU7A 3BIQA 2BN7A 3RVAA 4RZZA 5CDEA 1W7VA 2V3YA 1MATA 2BHCA 2P9AA 1XGSA 1YW8A 1N51A 5CIKA 2BB7A 4IKTA 2EVCA 1JAWA 2GTXA 2GA2A 1QXWA 2BWWA 1YVMA 3PKDA 2MATA 3MATA 4U6EA 1WBQA 3CB5A 4FLKA 3OOOA 5CDVA 4KM3A 3FM3A 4U76A 4U6ZA 1C23A 4IDYA 2GG0A 2Q96A 2Q8KA 2OKNA 2V6CA 5FCHA 2Q95A 2GU7A 4PNCA 1CHMA 3CTZA 4U75A 5E2CA 2GU5A 1O0XA 2P99A 5CDLA 4QR8A 1WY2A 2BWVA 1R58A 1WKMA 4ZNGA 1B59A 4A6VA 5CLSA 1W2MA 2BWUA 5CE6A 3PKEA 2P98A 4IKRA 2BWSA 2BWTA 4U69A 2GU4A 1R5HA 4EGEA 2ZSGA 5CNXA 1A16A 1M35A 4IKUA 2ADUA 4FO7A 4OOKA 4U70A 3IG4A 5JHUA 1XNZA 3TB5A 1QZYA 2V3ZA 2DFIA 2BHDA 2BHBA 4IPAA 4Z7MA 1YW9A 1C24A 4FO8A 1BN5A 3BITA 5E5BA 2Q93A 4IECA 3PN9A 3PKAA 3I7MA 2G6PA 2GGBA 3CB6A 4RGZ1 2GG5A 2BH3A 2BWXA 3RORA 5JI6A 2V3XA 2GG8A 1C22A 2EVOA 4U6JA 4A6WA 2GG3A 4U73A 2IW2A 1C21A 3TAVA 1XGMA 5FCFA 2B3KA 3PKCA 3PEBA 2Q92A 1WN1A 2GG7A 2GG9A 4R60A 2GZ5A 4JUQA 3IL0A 1XGOA 4HXXA 1KQ0A 1R5GA 4RZYA 5JFRA 1QXZA 4IKSA 1WLRA 4ZWOA 3Q6DA 1BOAA 4U1BA 3FMQA 1PV9A 4U71A 3L24A 3MX6A 2OAZA 4B28A 2NQ7A 3FMRA 3L7GA 3IU8A 2BHAA 5D6FA 4FLJA 2GG2A 5D6EA 2GU6A 4S01A 3IU9A 3O5VA 4IF7A 2BWYA 1QXYA 4FLLA 1WL6A 4PV4A 3OVKA 2Q94A 1XGNA 4IU6A 1KP0A 2B3LA 2B3HA 2GGCA 4U6CA 2EVMA 2EA2A 1Y1NA 4FUKA 3QOCA 4U6WA 2HOWA 1WL9A 3BIPA 2NQ6A 1C27A 4S2TP 3PKBA 4S00A 4FKCA 1YJ3A 4FLIA 4MATA
chains in the Genus database with same CATH topology
4ZWPA 1B6AA 1KQ9A 1YW7A 4S2RP 3D27A 3S6BA 4ZWUA 3MR1A 2EA4A 3IU7A 3BIQA 2BN7A 3RVAA 4RZZA 5CDEA 1W7VA 2V3YA 1MATA 2BHCA 2P9AA 1XGSA 1YW8A 1N51A 5CIKA 2BB7A 4IKTA 2EVCA 1JAWA 2GTXA 2GA2A 1QXWA 2BWWA 1YVMA 3PKDA 2MATA 3MATA 4U6EA 1WBQA 3CB5A 4FLKA 3OOOA 5CDVA 4KM3A 3FM3A 4U76A 4U6ZA 1C23A 4IDYA 2GG0A 2Q96A 2Q8KA 2OKNA 2V6CA 5FCHA 2Q95A 2GU7A 4PNCA 1CHMA 3CTZA 4U75A 5E2CA 2GU5A 1O0XA 2P99A 5CDLA 4QR8A 1WY2A 2BWVA 1R58A 1WKMA 4ZNGA 1B59A 4A6VA 5CLSA 1W2MA 2BWUA 5CE6A 3PKEA 2P98A 4IKRA 2BWSA 2BWTA 4U69A 2GU4A 1R5HA 4EGEA 2ZSGA 5CNXA 1A16A 1M35A 4IKUA 2ADUA 4FO7A 4OOKA 4U70A 3IG4A 5JHUA 1XNZA 3TB5A 1QZYA 2V3ZA 2DFIA 2BHDA 2BHBA 4IPAA 4Z7MA 1YW9A 1C24A 4FO8A 1BN5A 3BITA 5E5BA 2Q93A 4IECA 3PN9A 3PKAA 3I7MA 2G6PA 2GGBA 3CB6A 4RGZ1 2GG5A 2BH3A 2BWXA 3RORA 5JI6A 2V3XA 2GG8A 1C22A 2EVOA 4U6JA 4A6WA 2GG3A 4U73A 2IW2A 1C21A 3TAVA 1XGMA 5FCFA 2B3KA 3PKCA 3PEBA 2Q92A 1WN1A 2GG7A 2GG9A 4R60A 2GZ5A 4JUQA 3IL0A 1XGOA 4HXXA 1KQ0A 1R5GA 4RZYA 5JFRA 1QXZA 4IKSA 1WLRA 4ZWOA 3Q6DA 1BOAA 4U1BA 3FMQA 1PV9A 4U71A 3L24A 3MX6A 2OAZA 4B28A 2NQ7A 3FMRA 3L7GA 3IU8A 2BHAA 5D6FA 4FLJA 2GG2A 5D6EA 2GU6A 4S01A 3IU9A 3O5VA 4IF7A 2BWYA 1QXYA 4FLLA 1WL6A 4PV4A 3OVKA 2Q94A 1XGNA 4IU6A 1KP0A 2B3LA 2B3HA 2GGCA 4U6CA 2EVMA 2EA2A 1Y1NA 4FUKA 3QOCA 4U6WA 2HOWA 1WL9A 3BIPA 2NQ6A 1C27A 4S2TP 3PKBA 4S00A 4FKCA 1YJ3A 4FLIA 4MATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZWP A;  1B6A A;  1KQ9 A;  1YW7 A;  4S2R P;  3D27 A;  3S6B A;  4ZWU A;  3MR1 A;  2EA4 A;  3IU7 A;  3BIQ A;  2BN7 A;  3RVA A;  4RZZ A;  5CDE A;  1W7V A;  2V3Y A;  1MAT A;  2BHC A;  2P9A A;  1XGS A;  1YW8 A;  1N51 A;  5CIK A;  2BB7 A;  4IKT A;  2EVC A;  1JAW A;  2GTX A;  2GA2 A;  1QXW A;  2BWW A;  1YVM A;  3PKD A;  2MAT A;  3MAT A;  4U6E A;  1WBQ A;  3CB5 A;  4FLK A;  3OOO A;  5CDV A;  4KM3 A;  3FM3 A;  4U76 A;  4U6Z A;  1C23 A;  4IDY A;  2GG0 A;  2Q96 A;  2Q8K A;  2OKN A;  2V6C A;  5FCH A;  2Q95 A;  2GU7 A;  4PNC A;  1CHM A;  3CTZ A;  4U75 A;  5E2C A;  2GU5 A;  1O0X A;  2P99 A;  5CDL A;  4QR8 A;  1WY2 A;  2BWV A;  1R58 A;  1WKM A;  4ZNG A;  1B59 A;  4A6V A;  5CLS A;  1W2M A;  2BWU A;  5CE6 A;  3PKE A;  2P98 A;  4IKR A;  2BWS A;  2BWT A;  4U69 A;  2GU4 A;  1R5H A;  4EGE A;  2ZSG A;  5CNX A;  1A16 A;  1M35 A;  4IKU A;  2ADU A;  4FO7 A;  4OOK A;  4U70 A;  3IG4 A;  5JHU A;  1XNZ A;  3TB5 A;  1QZY A;  2V3Z A;  2DFI A;  2BHD A;  2BHB A;  4IPA A;  4Z7M A;  1YW9 A;  1C24 A;  4FO8 A;  1BN5 A;  3BIT A;  5E5B A;  2Q93 A;  4IEC A;  3PN9 A;  3PKA A;  3I7M A;  2G6P A;  2GGB A;  3CB6 A;  4RGZ 1;  2GG5 A;  2BH3 A;  2BWX A;  3ROR A;  5JI6 A;  2V3X A;  2GG8 A;  1C22 A;  2EVO A;  4U6J A;  4A6W A;  2GG3 A;  4U73 A;  2IW2 A;  1C21 A;  3TAV A;  1XGM A;  5FCF A;  2B3K A;  3PKC A;  3PEB A;  2Q92 A;  1WN1 A;  2GG7 A;  2GG9 A;  4R60 A;  2GZ5 A;  4JUQ A;  3IL0 A;  1XGO A;  4HXX A;  1KQ0 A;  1R5G A;  4RZY A;  5JFR A;  1QXZ A;  4IKS A;  1WLR A;  4ZWO A;  3Q6D A;  1BOA A;  4U1B A;  3FMQ A;  1PV9 A;  4U71 A;  3L24 A;  3MX6 A;  2OAZ A;  4B28 A;  2NQ7 A;  3FMR A;  3L7G A;  3IU8 A;  2BHA A;  5D6F A;  4FLJ A;  2GG2 A;  5D6E A;  2GU6 A;  4S01 A;  3IU9 A;  3O5V A;  4IF7 A;  2BWY A;  1QXY A;  4FLL A;  1WL6 A;  4PV4 A;  3OVK A;  2Q94 A;  1XGN A;  4IU6 A;  1KP0 A;  2B3L A;  2B3H A;  2GGC A;  4U6C A;  2EVM A;  2EA2 A;  1Y1N A;  4FUK A;  3QOC A;  4U6W A;  2HOW A;  1WL9 A;  3BIP A;  2NQ6 A;  1C27 A;  4S2T P;  3PKB A;  4S00 A;  4FKC A;  1YJ3 A;  4FLI A;  4MAT A; 
#chains in the Genus database with same CATH topology
 4ZWP A;  1B6A A;  1KQ9 A;  1YW7 A;  4S2R P;  3D27 A;  3S6B A;  4ZWU A;  3MR1 A;  2EA4 A;  3IU7 A;  3BIQ A;  2BN7 A;  3RVA A;  4RZZ A;  5CDE A;  1W7V A;  2V3Y A;  1MAT A;  2BHC A;  2P9A A;  1XGS A;  1YW8 A;  1N51 A;  5CIK A;  2BB7 A;  4IKT A;  2EVC A;  1JAW A;  2GTX A;  2GA2 A;  1QXW A;  2BWW A;  1YVM A;  3PKD A;  2MAT A;  3MAT A;  4U6E A;  1WBQ A;  3CB5 A;  4FLK A;  3OOO A;  5CDV A;  4KM3 A;  3FM3 A;  4U76 A;  4U6Z A;  1C23 A;  4IDY A;  2GG0 A;  2Q96 A;  2Q8K A;  2OKN A;  2V6C A;  5FCH A;  2Q95 A;  2GU7 A;  4PNC A;  1CHM A;  3CTZ A;  4U75 A;  5E2C A;  2GU5 A;  1O0X A;  2P99 A;  5CDL A;  4QR8 A;  1WY2 A;  2BWV A;  1R58 A;  1WKM A;  4ZNG A;  1B59 A;  4A6V A;  5CLS A;  1W2M A;  2BWU A;  5CE6 A;  3PKE A;  2P98 A;  4IKR A;  2BWS A;  2BWT A;  4U69 A;  2GU4 A;  1R5H A;  4EGE A;  2ZSG A;  5CNX A;  1A16 A;  1M35 A;  4IKU A;  2ADU A;  4FO7 A;  4OOK A;  4U70 A;  3IG4 A;  5JHU A;  1XNZ A;  3TB5 A;  1QZY A;  2V3Z A;  2DFI A;  2BHD A;  2BHB A;  4IPA A;  4Z7M A;  1YW9 A;  1C24 A;  4FO8 A;  1BN5 A;  3BIT A;  5E5B A;  2Q93 A;  4IEC A;  3PN9 A;  3PKA A;  3I7M A;  2G6P A;  2GGB A;  3CB6 A;  4RGZ 1;  2GG5 A;  2BH3 A;  2BWX A;  3ROR A;  5JI6 A;  2V3X A;  2GG8 A;  1C22 A;  2EVO A;  4U6J A;  4A6W A;  2GG3 A;  4U73 A;  2IW2 A;  1C21 A;  3TAV A;  1XGM A;  5FCF A;  2B3K A;  3PKC A;  3PEB A;  2Q92 A;  1WN1 A;  2GG7 A;  2GG9 A;  4R60 A;  2GZ5 A;  4JUQ A;  3IL0 A;  1XGO A;  4HXX A;  1KQ0 A;  1R5G A;  4RZY A;  5JFR A;  1QXZ A;  4IKS A;  1WLR A;  4ZWO A;  3Q6D A;  1BOA A;  4U1B A;  3FMQ A;  1PV9 A;  4U71 A;  3L24 A;  3MX6 A;  2OAZ A;  4B28 A;  2NQ7 A;  3FMR A;  3L7G A;  3IU8 A;  2BHA A;  5D6F A;  4FLJ A;  2GG2 A;  5D6E A;  2GU6 A;  4S01 A;  3IU9 A;  3O5V A;  4IF7 A;  2BWY A;  1QXY A;  4FLL A;  1WL6 A;  4PV4 A;  3OVK A;  2Q94 A;  1XGN A;  4IU6 A;  1KP0 A;  2B3L A;  2B3H A;  2GGC A;  4U6C A;  2EVM A;  2EA2 A;  1Y1N A;  4FUK A;  3QOC A;  4U6W A;  2HOW A;  1WL9 A;  3BIP A;  2NQ6 A;  1C27 A;  4S2T P;  3PKB A;  4S00 A;  4FKC A;  1YJ3 A;  4FLI A;  4MAT A; 
#chains in the Genus database with same CATH homology
 4ZWP A;  1B6A A;  1KQ9 A;  1YW7 A;  4S2R P;  3D27 A;  3S6B A;  4ZWU A;  3MR1 A;  2EA4 A;  3IU7 A;  3BIQ A;  2BN7 A;  3RVA A;  4RZZ A;  5CDE A;  1W7V A;  2V3Y A;  1MAT A;  2BHC A;  2P9A A;  1XGS A;  1YW8 A;  1N51 A;  5CIK A;  2BB7 A;  4IKT A;  2EVC A;  1JAW A;  2GTX A;  2GA2 A;  1QXW A;  2BWW A;  1YVM A;  3PKD A;  2MAT A;  3MAT A;  4U6E A;  1WBQ A;  3CB5 A;  4FLK A;  3OOO A;  5CDV A;  4KM3 A;  3FM3 A;  4U76 A;  4U6Z A;  1C23 A;  4IDY A;  2GG0 A;  2Q96 A;  2Q8K A;  2OKN A;  2V6C A;  5FCH A;  2Q95 A;  2GU7 A;  4PNC A;  1CHM A;  3CTZ A;  4U75 A;  5E2C A;  2GU5 A;  1O0X A;  2P99 A;  5CDL A;  4QR8 A;  1WY2 A;  2BWV A;  1R58 A;  1WKM A;  4ZNG A;  1B59 A;  4A6V A;  5CLS A;  1W2M A;  2BWU A;  5CE6 A;  3PKE A;  2P98 A;  4IKR A;  2BWS A;  2BWT A;  4U69 A;  2GU4 A;  1R5H A;  4EGE A;  2ZSG A;  5CNX A;  1A16 A;  1M35 A;  4IKU A;  2ADU A;  4FO7 A;  4OOK A;  4U70 A;  3IG4 A;  5JHU A;  1XNZ A;  3TB5 A;  1QZY A;  2V3Z A;  2DFI A;  2BHD A;  2BHB A;  4IPA A;  4Z7M A;  1YW9 A;  1C24 A;  4FO8 A;  1BN5 A;  3BIT A;  5E5B A;  2Q93 A;  4IEC A;  3PN9 A;  3PKA A;  3I7M A;  2G6P A;  2GGB A;  3CB6 A;  4RGZ 1;  2GG5 A;  2BH3 A;  2BWX A;  3ROR A;  5JI6 A;  2V3X A;  2GG8 A;  1C22 A;  2EVO A;  4U6J A;  4A6W A;  2GG3 A;  4U73 A;  2IW2 A;  1C21 A;  3TAV A;  1XGM A;  5FCF A;  2B3K A;  3PKC A;  3PEB A;  2Q92 A;  1WN1 A;  2GG7 A;  2GG9 A;  4R60 A;  2GZ5 A;  4JUQ A;  3IL0 A;  1XGO A;  4HXX A;  1KQ0 A;  1R5G A;  4RZY A;  5JFR A;  1QXZ A;  4IKS A;  1WLR A;  4ZWO A;  3Q6D A;  1BOA A;  4U1B A;  3FMQ A;  1PV9 A;  4U71 A;  3L24 A;  3MX6 A;  2OAZ A;  4B28 A;  2NQ7 A;  3FMR A;  3L7G A;  3IU8 A;  2BHA A;  5D6F A;  4FLJ A;  2GG2 A;  5D6E A;  2GU6 A;  4S01 A;  3IU9 A;  3O5V A;  4IF7 A;  2BWY A;  1QXY A;  4FLL A;  1WL6 A;  4PV4 A;  3OVK A;  2Q94 A;  1XGN A;  4IU6 A;  1KP0 A;  2B3L A;  2B3H A;  2GGC A;  4U6C A;  2EVM A;  2EA2 A;  1Y1N A;  4FUK A;  3QOC A;  4U6W A;  2HOW A;  1WL9 A;  3BIP A;  2NQ6 A;  1C27 A;  4S2T P;  3PKB A;  4S00 A;  4FKC A;  1YJ3 A;  4FLI A;  4MAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...